easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

occisoque

backscatter

recusenturque

solitare

coenure

thoughtlessly

minemur

foggages

aphrasia

ureteroproctostomy

underlaps

klinger

incoherences

habebit

utebaturque

challender

needleworks

vitaremque


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: retroque
cipher variations:
sfusprvf tgvtqswg uhwurtxh vixvsuyi wjywtvzj
xkzxuwak ylayvxbl zmbzwycm ancaxzdn bodbyaeo
cpeczbfp dqfdacgq ergebdhr fshfceis gtigdfjt
hujhegku ivkifhlv jwljgimw kxmkhjnx lynlikoy
mzomjlpz napnkmqa obqolnrb pcrpmosc qdsqnptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: retroque
Cipher: ivgiljfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: retroque
Cipher: BAAAA AABAA BAABA BAAAA ABBAB ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: retroque
cipher variations:
sfusprvfangarxjnivsitdxvqdeqvjldylqyxpzlgtcgzvntwjawdhpjermefndr
mzymhtrzuhkujzfhcpwclftpkxiknlhxtgvtqswgbohbsykojwtjueywrefrwkme
zmrzyqamhudhawouxkbxeiqkfsnfgoesnazniusavilvkagidqxdmguqlyjlomiy
uhwurtxhcpictzlpkxukvfzxsfgsxlnfansazrbniveibxpvylcyfjrlgtoghpft
obaojvtbwjmwlbhjeryenhvrmzkmpnjzvixvsuyidqjduamqlyvlwgaytghtymog
botbascojwfjcyqwzmdzgksmhuphiqgupcbpkwucxknxmcikfszfoiwsnalnqoka
wjywtvzjerkevbnrmzwmxhbzuhiuznphcpucbtdpkxgkdzrxaneahltnivqijrhv
qdcqlxvdyloyndjlgtagpjxtobmorplbxkzxuwakfslfwcosnaxnyicavijvaoqi
dqvdcueqlyhleasybofbimuojwrjksiwredrmywezmpzoekmhubhqkyupcnpsqmc
ylayvxblgtmgxdptobyozjdbwjkwbprjerwedvfrmzimfbtzcpgcjnvpkxskltjx
sfesnzxfanqapflnivcirlzvqdoqtrndzmbzwycmhunhyequpczpakecxklxcqsk
fsxfewgsnajngcuadqhdkowqlytlmukytgftoaygborbqgmojwdjsmawreprusoe
ancaxzdnivoizfrvqdaqblfdylmydrtlgtygfxhtobkohdvberielpxrmzumnvlz
uhgupbzhcpscrhnpkxektnbxsfqsvtpfbodbyaeojwpjagswrebrcmgezmnzesum
huzhgyiupclpiewcfsjfmqysnavnowmavihvqcaidqtdsioqlyfluocytgrtwuqg
cpeczbfpkxqkbhtxsfcsdnhfanoaftvnivaihzjvqdmqjfxdgtkgnrztobwopxnb
wjiwrdbjeruetjprmzgmvpdzuhsuxvrhdqfdacgqlyrlciuytgdteoigbopbguwo
jwbjiakwrenrkgyehulhosaupcxpqyocxkjxseckfsvfukqsnahnwqeavitvywsi
ergebdhrmzsmdjvzuheufpjhcpqchvxpkxckjblxsfoslhzfivmiptbvqdyqrzpd
ylkytfdlgtwgvlrtobioxrfbwjuwzxtjfshfceisnatnekwavifvgqkidqrdiwyq
lydlkcmytgptmiagjwnjqucwrezrsaqezmlzugemhuxhwmsupcjpysgcxkvxayuk
gtigdfjtobuoflxbwjgwhrljersejxzrmzemldnzuhqunjbhkxokrvdxsfastbrf
anmavhfnivyixntvqdkqzthdylwybzvlhujhegkupcvpgmycxkhxismkfstfkyas
nafnmeoavirvokcilyplsweytgbtucsgbonbwigojwzjyouwrelrauiezmxzcawm
ivkifhlvqdwqhnzdyliyjtnlgtuglzbtobgonfpbwjswpldjmzqmtxfzuhcuvdth
cpocxjhpkxakzpvxsfmsbvjfanyadbxnjwljgimwrexrioaezmjzkuomhuvhmacu
pchpogqcxktxqmeknarnuygavidvweuidqpdykiqlyblaqwytgntcwkgbozbecyo
kxmkhjnxsfysjpbfankalvpnivwinbdvqdiqphrdyluyrnflobsovzhbwjewxfvj
erqezljrmzcmbrxzuhoudxlhcpacfdzplynlikoytgztkqcgbolbmwqojwxjocew
rejrqisezmvzsogmpctpwaicxkfxygwkfsrfamksnadncsyavipveymidqbdgeaq
mzomjlpzuhaulrdhcpmcnxrpkxykpdfxsfksrjtfanwatphnqduqxbjdylgyzhxl
gtsgbnltobeodtzbwjqwfznjercehfbrnapnkmqavibvmseidqndoysqlyzlqegy
tgltskugboxbuqiorevryckezmhzaiymhuthcomupcfpeuacxkrxgaokfsdfigcs
obqolnrbwjcwntfjeroepztrmzamrfhzuhmutlvhcpycvrjpsfwszdlfaniabjzn
ivuidpnvqdgqfvbdylsyhbplgtegjhdtpcrpmoscxkdxougkfspfqausnabnsgia
vinvumwidqzdwskqtgxtaemgbojbckaojwvjeqowrehrgwcezmtzicqmhufhkieu
qdsqnptdyleypvhlgtqgrbvtobcothjbwjowvnxjeraextlruhyubfnhcpkcdlbp
kxwkfrpxsfishxdfanuajdrnivgiljfvretroquezmfzqwimhurhscwupcdpuikc
xkpxwoykfsbfyumsvizvcgoidqldemcqlyxlgsqytgjtiyegbovbkesojwhjmkgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: retroque
Cipher: ergebdhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: retroque
Cipher: 2451442443145451

Extended Methods:
Method #1

Plaintext: retroque
method variations:
wkywtvzkbpdbyaepguigdfkumzomilpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
r e t r o q u e 
2 5 4 2 4 1 5 5 
4 1 4 4 3 4 4 1 
They are then read out in rows:
2542415541443441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: retroque
Cipher: widzdtsd

Read more ...
Method #3

Plaintext: retroque
method variations:
yqitcyyf qitcyyfy itcyyfyq
tcyyfyqi cyyfyqit yyfyqitc
yfyqitcy fyqitcyy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: retroque

first 5040 cipher variations(40320 total)
retroque retroqeu retrouqe retroueq retroeuq retroequ retrqoue retrqoeu retrquoe retrqueo retrqeuo
retrqeou retruqoe retruqeo retruoqe retruoeq retrueoq retrueqo retrequo retreqou retreuqo retreuoq
retreouq retreoqu retorque retorqeu retoruqe retorueq retoreuq retorequ retoqrue retoqreu retoqure
retoquer retoqeur retoqeru retouqre retouqer retourqe retoureq retouerq retoueqr retoequr retoeqru
retoeuqr retoeurq retoeruq retoerqu retqorue retqoreu retqoure retqouer retqoeur retqoeru retqroue
retqroeu retqruoe retqrueo retqreuo retqreou retquroe retqureo retquore retquoer retqueor retquero
retqeruo retqerou retqeuro retqeuor retqeour retqeoru retuoqre retuoqer retuorqe retuoreq retuoerq
retuoeqr retuqore retuqoer retuqroe retuqreo retuqero retuqeor returqoe returqeo returoqe returoeq
retureoq retureqo retueqro retueqor retuerqo retueroq retueorq retueoqr reteoqur reteoqru reteouqr
reteourq reteoruq reteorqu reteqour reteqoru retequor retequro reteqruo reteqrou reteuqor reteuqro
reteuoqr reteuorq reteuroq reteurqo reterquo reterqou reteruqo reteruoq reterouq reteroqu rertoque
rertoqeu rertouqe rertoueq rertoeuq rertoequ rertqoue rertqoeu rertquoe rertqueo rertqeuo rertqeou
rertuqoe rertuqeo rertuoqe rertuoeq rertueoq rertueqo rertequo rerteqou rerteuqo rerteuoq rerteouq
rerteoqu rerotque rerotqeu rerotuqe rerotueq reroteuq rerotequ reroqtue reroqteu reroqute reroquet
reroqeut reroqetu rerouqte rerouqet reroutqe rerouteq rerouetq reroueqt reroequt reroeqtu reroeuqt
reroeutq reroetuq reroetqu rerqotue rerqoteu rerqoute rerqouet rerqoeut rerqoetu rerqtoue rerqtoeu
rerqtuoe rerqtueo rerqteuo rerqteou rerqutoe rerquteo rerquote rerquoet rerqueot rerqueto rerqetuo
rerqetou rerqeuto rerqeuot rerqeout rerqeotu reruoqte reruoqet reruotqe reruoteq reruoetq reruoeqt
reruqote reruqoet reruqtoe reruqteo reruqeto reruqeot rerutqoe rerutqeo rerutoqe rerutoeq reruteoq
reruteqo rerueqto rerueqot reruetqo reruetoq rerueotq rerueoqt rereoqut rereoqtu rereouqt rereoutq
rereotuq rereotqu rereqout rereqotu rerequot rerequto rereqtuo rereqtou rereuqot rereuqto rereuoqt
rereuotq rereutoq rereutqo reretquo reretqou reretuqo reretuoq reretouq reretoqu reortque reortqeu
reortuqe reortueq reorteuq reortequ reorqtue reorqteu reorqute reorquet reorqeut reorqetu reoruqte
reoruqet reorutqe reoruteq reoruetq reorueqt reorequt reoreqtu reoreuqt reoreutq reoretuq reoretqu
reotrque reotrqeu reotruqe reotrueq reotreuq reotrequ reotqrue reotqreu reotqure reotquer reotqeur
reotqeru reotuqre reotuqer reoturqe reotureq reotuerq reotueqr reotequr reoteqru reoteuqr reoteurq
reoteruq reoterqu reoqtrue reoqtreu reoqture reoqtuer reoqteur reoqteru reoqrtue reoqrteu reoqrute
reoqruet reoqreut reoqretu reoqurte reoquret reoqutre reoquter reoquetr reoquert reoqerut reoqertu
reoqeurt reoqeutr reoqetur reoqetru reoutqre reoutqer reoutrqe reoutreq reouterq reouteqr reouqtre
reouqter reouqrte reouqret reouqert reouqetr reourqte reourqet reourtqe reourteq reouretq reoureqt
reoueqrt reoueqtr reouerqt reouertq reouetrq reouetqr reoetqur reoetqru reoetuqr reoeturq reoetruq
reoetrqu reoeqtur reoeqtru reoequtr reoequrt reoeqrut reoeqrtu reoeuqtr reoeuqrt reoeutqr reoeutrq
reoeurtq reoeurqt reoerqut reoerqtu reoeruqt reoerutq reoertuq reoertqu reqrotue reqroteu reqroute
reqrouet reqroeut reqroetu reqrtoue reqrtoeu reqrtuoe reqrtueo reqrteuo reqrteou reqrutoe reqruteo
reqruote reqruoet reqrueot reqrueto reqretuo reqretou reqreuto reqreuot reqreout reqreotu reqortue
reqorteu reqorute reqoruet reqoreut reqoretu reqotrue reqotreu reqoture reqotuer reqoteur reqoteru
reqoutre reqouter reqourte reqouret reqouert reqouetr reqoetur reqoetru reqoeutr reqoeurt reqoerut
reqoertu reqtorue reqtoreu reqtoure reqtouer reqtoeur reqtoeru reqtroue reqtroeu reqtruoe reqtrueo
reqtreuo reqtreou reqturoe reqtureo reqtuore reqtuoer reqtueor reqtuero reqteruo reqterou reqteuro
reqteuor reqteour reqteoru requotre requoter requorte requoret requoert requoetr requtore requtoer
requtroe requtreo requtero requteor requrtoe requrteo requrote requroet requreot requreto requetro
requetor requerto requerot requeort requeotr reqeotur reqeotru reqeoutr reqeourt reqeorut reqeortu
reqetour reqetoru reqetuor reqeturo reqetruo reqetrou reqeutor reqeutro reqeuotr reqeuort reqeurot
reqeurto reqertuo reqertou reqeruto reqeruot reqerout reqerotu reuroqte reuroqet reurotqe reuroteq
reuroetq reuroeqt reurqote reurqoet reurqtoe reurqteo reurqeto reurqeot reurtqoe reurtqeo reurtoqe
reurtoeq reurteoq reurteqo reureqto reureqot reuretqo reuretoq reureotq reureoqt reuorqte reuorqet
reuortqe reuorteq reuoretq reuoreqt reuoqrte reuoqret reuoqtre reuoqter reuoqetr reuoqert reuotqre
reuotqer reuotrqe reuotreq reuoterq reuoteqr reuoeqtr reuoeqrt reuoetqr reuoetrq reuoertq reuoerqt
reuqorte reuqoret reuqotre reuqoter reuqoetr reuqoert reuqrote reuqroet reuqrtoe reuqrteo reuqreto
reuqreot reuqtroe reuqtreo reuqtore reuqtoer reuqteor reuqtero reuqerto reuqerot reuqetro reuqetor
reuqeotr reuqeort reutoqre reutoqer reutorqe reutoreq reutoerq reutoeqr reutqore reutqoer reutqroe
reutqreo reutqero reutqeor reutrqoe reutrqeo reutroqe reutroeq reutreoq reutreqo reuteqro reuteqor
reuterqo reuteroq reuteorq reuteoqr reueoqtr reueoqrt reueotqr reueotrq reueortq reueorqt reueqotr
reueqort reueqtor reueqtro reueqrto reueqrot reuetqor reuetqro reuetoqr reuetorq reuetroq reuetrqo
reuerqto reuerqot reuertqo reuertoq reuerotq reueroqt reeroqut reeroqtu reerouqt reeroutq reerotuq
reerotqu reerqout reerqotu reerquot reerquto reerqtuo reerqtou reeruqot reeruqto reeruoqt reeruotq
reerutoq reerutqo reertquo reertqou reertuqo reertuoq reertouq reertoqu reeorqut reeorqtu reeoruqt
reeorutq reeortuq reeortqu reeoqrut reeoqrtu reeoqurt reeoqutr reeoqtur reeoqtru reeouqrt reeouqtr
reeourqt reeourtq reeoutrq reeoutqr reeotqur reeotqru reeotuqr reeoturq reeotruq reeotrqu reeqorut
reeqortu reeqourt reeqoutr reeqotur reeqotru reeqrout reeqrotu reeqruot reeqruto reeqrtuo reeqrtou
reequrot reequrto reequort reequotr reequtor reequtro reeqtruo reeqtrou reeqturo reeqtuor reeqtour
reeqtoru reeuoqrt reeuoqtr reeuorqt reeuortq reeuotrq reeuotqr reeuqort reeuqotr reeuqrot reeuqrto
reeuqtro reeuqtor reeurqot reeurqto reeuroqt reeurotq reeurtoq reeurtqo reeutqro reeutqor reeutrqo
reeutroq reeutorq reeutoqr reetoqur reetoqru reetouqr reetourq reetoruq reetorqu reetqour reetqoru
reetquor reetquro reetqruo reetqrou reetuqor reetuqro reetuoqr reetuorq reeturoq reeturqo reetrquo
reetrqou reetruqo reetruoq reetrouq reetroqu rteroque rteroqeu rterouqe rteroueq rteroeuq rteroequ
rterqoue rterqoeu rterquoe rterqueo rterqeuo rterqeou rteruqoe rteruqeo rteruoqe rteruoeq rterueoq
rterueqo rterequo rtereqou rtereuqo rtereuoq rtereouq rtereoqu rteorque rteorqeu rteoruqe rteorueq
rteoreuq rteorequ rteoqrue rteoqreu rteoqure rteoquer rteoqeur rteoqeru rteouqre rteouqer rteourqe
rteoureq rteouerq rteoueqr rteoequr rteoeqru rteoeuqr rteoeurq rteoeruq rteoerqu rteqorue rteqoreu
rteqoure rteqouer rteqoeur rteqoeru rteqroue rteqroeu rteqruoe rteqrueo rteqreuo rteqreou rtequroe
rtequreo rtequore rtequoer rtequeor rtequero rteqeruo rteqerou rteqeuro rteqeuor rteqeour rteqeoru
rteuoqre rteuoqer rteuorqe rteuoreq rteuoerq rteuoeqr rteuqore rteuqoer rteuqroe rteuqreo rteuqero
rteuqeor rteurqoe rteurqeo rteuroqe rteuroeq rteureoq rteureqo rteueqro rteueqor rteuerqo rteueroq
rteueorq rteueoqr rteeoqur rteeoqru rteeouqr rteeourq rteeoruq rteeorqu rteeqour rteeqoru rteequor
rteequro rteeqruo rteeqrou rteeuqor rteeuqro rteeuoqr rteeuorq rteeuroq rteeurqo rteerquo rteerqou
rteeruqo rteeruoq rteerouq rteeroqu rtreoque rtreoqeu rtreouqe rtreoueq rtreoeuq rtreoequ rtreqoue
rtreqoeu rtrequoe rtrequeo rtreqeuo rtreqeou rtreuqoe rtreuqeo rtreuoqe rtreuoeq rtreueoq rtreueqo
rtreequo rtreeqou rtreeuqo rtreeuoq rtreeouq rtreeoqu rtroeque rtroeqeu rtroeuqe rtroeueq rtroeeuq
rtroeequ rtroqeue rtroqeeu rtroquee rtroquee rtroqeue rtroqeeu rtrouqee rtrouqee rtroueqe rtroueeq
rtroueeq rtroueqe rtroeque rtroeqeu rtroeuqe rtroeueq rtroeeuq rtroeequ rtrqoeue rtrqoeeu rtrqouee
rtrqouee rtrqoeue rtrqoeeu rtrqeoue rtrqeoeu rtrqeuoe rtrqeueo rtrqeeuo rtrqeeou rtrqueoe rtrqueeo
rtrquoee rtrquoee rtrqueoe rtrqueeo rtrqeeuo rtrqeeou rtrqeueo rtrqeuoe rtrqeoue rtrqeoeu rtruoqee
rtruoqee rtruoeqe rtruoeeq rtruoeeq rtruoeqe rtruqoee rtruqoee rtruqeoe rtruqeeo rtruqeeo rtruqeoe
rtrueqoe rtrueqeo rtrueoqe rtrueoeq rtrueeoq rtrueeqo rtrueqeo rtrueqoe rtrueeqo rtrueeoq rtrueoeq
rtrueoqe rtreoque rtreoqeu rtreouqe rtreoueq rtreoeuq rtreoequ rtreqoue rtreqoeu rtrequoe rtrequeo
rtreqeuo rtreqeou rtreuqoe rtreuqeo rtreuoqe rtreuoeq rtreueoq rtreueqo rtreequo rtreeqou rtreeuqo
rtreeuoq rtreeouq rtreeoqu rtoreque rtoreqeu rtoreuqe rtoreueq rtoreeuq rtoreequ rtorqeue rtorqeeu
rtorquee rtorquee rtorqeue rtorqeeu rtoruqee rtoruqee rtorueqe rtorueeq rtorueeq rtorueqe rtoreque
rtoreqeu rtoreuqe rtoreueq rtoreeuq rtoreequ rtoerque rtoerqeu rtoeruqe rtoerueq rtoereuq rtoerequ
rtoeqrue rtoeqreu rtoequre rtoequer rtoeqeur rtoeqeru rtoeuqre rtoeuqer rtoeurqe rtoeureq rtoeuerq
rtoeueqr rtoeequr rtoeeqru rtoeeuqr rtoeeurq rtoeeruq rtoeerqu rtoqerue rtoqereu rtoqeure rtoqeuer
rtoqeeur rtoqeeru rtoqreue rtoqreeu rtoqruee rtoqruee rtoqreue rtoqreeu rtoquree rtoquree rtoquere
rtoqueer rtoqueer rtoquere rtoqerue rtoqereu rtoqeure rtoqeuer rtoqeeur rtoqeeru rtoueqre rtoueqer
rtouerqe rtouereq rtoueerq rtoueeqr rtouqere rtouqeer rtouqree rtouqree rtouqere rtouqeer rtourqee
rtourqee rtoureqe rtoureeq rtoureeq rtoureqe rtoueqre rtoueqer rtouerqe rtouereq rtoueerq rtoueeqr
rtoeequr rtoeeqru rtoeeuqr rtoeeurq rtoeeruq rtoeerqu rtoeqeur rtoeqeru rtoequer rtoequre rtoeqrue
rtoeqreu rtoeuqer rtoeuqre rtoeueqr rtoeuerq rtoeureq rtoeurqe rtoerque rtoerqeu rtoeruqe rtoerueq
rtoereuq rtoerequ rtqroeue rtqroeeu rtqrouee rtqrouee rtqroeue rtqroeeu rtqreoue rtqreoeu rtqreuoe
rtqreueo rtqreeuo rtqreeou rtqrueoe rtqrueeo rtqruoee rtqruoee rtqrueoe rtqrueeo rtqreeuo rtqreeou
rtqreueo rtqreuoe rtqreoue rtqreoeu rtqoreue rtqoreeu rtqoruee rtqoruee rtqoreue rtqoreeu rtqoerue
rtqoereu rtqoeure rtqoeuer rtqoeeur rtqoeeru rtqouere rtqoueer rtqouree rtqouree rtqouere rtqoueer
rtqoeeur rtqoeeru rtqoeuer rtqoeure rtqoerue rtqoereu rtqeorue rtqeoreu rtqeoure rtqeouer rtqeoeur
rtqeoeru rtqeroue rtqeroeu rtqeruoe rtqerueo rtqereuo rtqereou rtqeuroe rtqeureo rtqeuore rtqeuoer
rtqeueor rtqeuero rtqeeruo rtqeerou rtqeeuro rtqeeuor rtqeeour rtqeeoru rtquoere rtquoeer rtquoree
rtquoree rtquoere rtquoeer rtqueore rtqueoer rtqueroe rtquereo rtqueero rtqueeor rtqureoe rtqureeo
rtquroee rtquroee rtqureoe rtqureeo rtqueero rtqueeor rtquereo rtqueroe rtqueore rtqueoer rtqeoeur
rtqeoeru rtqeouer rtqeoure rtqeorue rtqeoreu rtqeeour rtqeeoru rtqeeuor rtqeeuro rtqeeruo rtqeerou
rtqeueor rtqeuero rtqeuoer rtqeuore rtqeuroe rtqeureo rtqereuo rtqereou rtqerueo rtqeruoe rtqeroue
rtqeroeu rturoqee rturoqee rturoeqe rturoeeq rturoeeq rturoeqe rturqoee rturqoee rturqeoe rturqeeo
rturqeeo rturqeoe rtureqoe rtureqeo rtureoqe rtureoeq rtureeoq rtureeqo rtureqeo rtureqoe rtureeqo
rtureeoq rtureoeq rtureoqe rtuorqee rtuorqee rtuoreqe rtuoreeq rtuoreeq rtuoreqe rtuoqree rtuoqree
rtuoqere rtuoqeer rtuoqeer rtuoqere rtuoeqre rtuoeqer rtuoerqe rtuoereq rtuoeerq rtuoeeqr rtuoeqer
rtuoeqre rtuoeeqr rtuoeerq rtuoereq rtuoerqe rtuqoree rtuqoree rtuqoere rtuqoeer rtuqoeer rtuqoere
rtuqroee rtuqroee rtuqreoe rtuqreeo rtuqreeo rtuqreoe rtuqeroe rtuqereo rtuqeore rtuqeoer rtuqeeor
rtuqeero rtuqereo rtuqeroe rtuqeero rtuqeeor rtuqeoer rtuqeore rtueoqre rtueoqer rtueorqe rtueoreq
rtueoerq rtueoeqr rtueqore rtueqoer rtueqroe rtueqreo rtueqero rtueqeor rtuerqoe rtuerqeo rtueroqe
rtueroeq rtuereoq rtuereqo rtueeqro rtueeqor rtueerqo rtueeroq rtueeorq rtueeoqr rtueoqer rtueoqre
rtueoeqr rtueoerq rtueoreq rtueorqe rtueqoer rtueqore rtueqeor rtueqero rtueqreo rtueqroe rtueeqor
rtueeqro rtueeoqr rtueeorq rtueeroq rtueerqo rtuerqeo rtuerqoe rtuereqo rtuereoq rtueroeq rtueroqe
rteroque rteroqeu rterouqe rteroueq rteroeuq rteroequ rterqoue rterqoeu rterquoe rterqueo rterqeuo
rterqeou rteruqoe rteruqeo rteruoqe rteruoeq rterueoq rterueqo rterequo rtereqou rtereuqo rtereuoq
rtereouq rtereoqu rteorque rteorqeu rteoruqe rteorueq rteoreuq rteorequ rteoqrue rteoqreu rteoqure
rteoquer rteoqeur rteoqeru rteouqre rteouqer rteourqe rteoureq rteouerq rteoueqr rteoequr rteoeqru
rteoeuqr rteoeurq rteoeruq rteoerqu rteqorue rteqoreu rteqoure rteqouer rteqoeur rteqoeru rteqroue
rteqroeu rteqruoe rteqrueo rteqreuo rteqreou rtequroe rtequreo rtequore rtequoer rtequeor rtequero
rteqeruo rteqerou rteqeuro rteqeuor rteqeour rteqeoru rteuoqre rteuoqer rteuorqe rteuoreq rteuoerq
rteuoeqr rteuqore rteuqoer rteuqroe rteuqreo rteuqero rteuqeor rteurqoe rteurqeo rteuroqe rteuroeq
rteureoq rteureqo rteueqro rteueqor rteuerqo rteueroq rteueorq rteueoqr rteeoqur rteeoqru rteeouqr
rteeourq rteeoruq rteeorqu rteeqour rteeqoru rteequor rteequro rteeqruo rteeqrou rteeuqor rteeuqro
rteeuoqr rteeuorq rteeuroq rteeurqo rteerquo rteerqou rteeruqo rteeruoq rteerouq rteeroqu rrteoque
rrteoqeu rrteouqe rrteoueq rrteoeuq rrteoequ rrteqoue rrteqoeu rrtequoe rrtequeo rrteqeuo rrteqeou
rrteuqoe rrteuqeo rrteuoqe rrteuoeq rrteueoq rrteueqo rrteequo rrteeqou rrteeuqo rrteeuoq rrteeouq
rrteeoqu rrtoeque rrtoeqeu rrtoeuqe rrtoeueq rrtoeeuq rrtoeequ rrtoqeue rrtoqeeu rrtoquee rrtoquee
rrtoqeue rrtoqeeu rrtouqee rrtouqee rrtoueqe rrtoueeq rrtoueeq rrtoueqe rrtoeque rrtoeqeu rrtoeuqe
rrtoeueq rrtoeeuq rrtoeequ rrtqoeue rrtqoeeu rrtqouee rrtqouee rrtqoeue rrtqoeeu rrtqeoue rrtqeoeu
rrtqeuoe rrtqeueo rrtqeeuo rrtqeeou rrtqueoe rrtqueeo rrtquoee rrtquoee rrtqueoe rrtqueeo rrtqeeuo
rrtqeeou rrtqeueo rrtqeuoe rrtqeoue rrtqeoeu rrtuoqee rrtuoqee rrtuoeqe rrtuoeeq rrtuoeeq rrtuoeqe
rrtuqoee rrtuqoee rrtuqeoe rrtuqeeo rrtuqeeo rrtuqeoe rrtueqoe rrtueqeo rrtueoqe rrtueoeq rrtueeoq
rrtueeqo rrtueqeo rrtueqoe rrtueeqo rrtueeoq rrtueoeq rrtueoqe rrteoque rrteoqeu rrteouqe rrteoueq
rrteoeuq rrteoequ rrteqoue rrteqoeu rrtequoe rrtequeo rrteqeuo rrteqeou rrteuqoe rrteuqeo rrteuoqe
rrteuoeq rrteueoq rrteueqo rrteequo rrteeqou rrteeuqo rrteeuoq rrteeouq rrteeoqu rretoque rretoqeu
rretouqe rretoueq rretoeuq rretoequ rretqoue rretqoeu rretquoe rretqueo rretqeuo rretqeou rretuqoe
rretuqeo rretuoqe rretuoeq rretueoq rretueqo rretequo rreteqou rreteuqo rreteuoq rreteouq rreteoqu
rreotque rreotqeu rreotuqe rreotueq rreoteuq rreotequ rreoqtue rreoqteu rreoqute rreoquet rreoqeut
rreoqetu rreouqte rreouqet rreoutqe rreouteq rreouetq rreoueqt rreoequt rreoeqtu rreoeuqt rreoeutq
rreoetuq rreoetqu rreqotue rreqoteu rreqoute rreqouet rreqoeut rreqoetu rreqtoue rreqtoeu rreqtuoe
rreqtueo rreqteuo rreqteou rrequtoe rrequteo rrequote rrequoet rrequeot rrequeto rreqetuo rreqetou
rreqeuto rreqeuot rreqeout rreqeotu rreuoqte rreuoqet rreuotqe rreuoteq rreuoetq rreuoeqt rreuqote
rreuqoet rreuqtoe rreuqteo rreuqeto rreuqeot rreutqoe rreutqeo rreutoqe rreutoeq rreuteoq rreuteqo
rreueqto rreueqot rreuetqo rreuetoq rreueotq rreueoqt rreeoqut rreeoqtu rreeouqt rreeoutq rreeotuq
rreeotqu rreeqout rreeqotu rreequot rreequto rreeqtuo rreeqtou rreeuqot rreeuqto rreeuoqt rreeuotq
rreeutoq rreeutqo rreetquo rreetqou rreetuqo rreetuoq rreetouq rreetoqu rroetque rroetqeu rroetuqe
rroetueq rroeteuq rroetequ rroeqtue rroeqteu rroequte rroequet rroeqeut rroeqetu rroeuqte rroeuqet
rroeutqe rroeuteq rroeuetq rroeueqt rroeequt rroeeqtu rroeeuqt rroeeutq rroeetuq rroeetqu rroteque
rroteqeu rroteuqe rroteueq rroteeuq rroteequ rrotqeue rrotqeeu rrotquee rrotquee rrotqeue rrotqeeu
rrotuqee rrotuqee rrotueqe rrotueeq rrotueeq rrotueqe rroteque rroteqeu rroteuqe rroteueq rroteeuq
rroteequ rroqteue rroqteeu rroqtuee rroqtuee rroqteue rroqteeu rroqetue rroqeteu rroqeute rroqeuet
rroqeeut rroqeetu rroquete rroqueet rroqutee rroqutee rroquete rroqueet rroqeeut rroqeetu rroqeuet
rroqeute rroqetue rroqeteu rroutqee rroutqee rrouteqe rrouteeq rrouteeq rrouteqe rrouqtee rrouqtee
rrouqete rrouqeet rrouqeet rrouqete rroueqte rroueqet rrouetqe rroueteq rroueetq rroueeqt rroueqet
rroueqte rroueeqt rroueetq rroueteq rrouetqe rroetque rroetqeu rroetuqe rroetueq rroeteuq rroetequ
rroeqtue rroeqteu rroequte rroequet rroeqeut rroeqetu rroeuqte rroeuqet rroeutqe rroeuteq rroeuetq
rroeueqt rroeequt rroeeqtu rroeeuqt rroeeutq rroeetuq rroeetqu rrqeotue rrqeoteu rrqeoute rrqeouet
rrqeoeut rrqeoetu rrqetoue rrqetoeu rrqetuoe rrqetueo rrqeteuo rrqeteou rrqeutoe rrqeuteo rrqeuote
rrqeuoet rrqeueot rrqeueto rrqeetuo rrqeetou rrqeeuto rrqeeuot rrqeeout rrqeeotu rrqoetue rrqoeteu
rrqoeute rrqoeuet rrqoeeut rrqoeetu rrqoteue rrqoteeu rrqotuee rrqotuee rrqoteue rrqoteeu rrqoutee
rrqoutee rrqouete rrqoueet rrqoueet rrqouete rrqoetue rrqoeteu rrqoeute rrqoeuet rrqoeeut rrqoeetu
rrqtoeue rrqtoeeu rrqtouee rrqtouee rrqtoeue rrqtoeeu rrqteoue rrqteoeu rrqteuoe rrqteueo rrqteeuo
rrqteeou rrqtueoe rrqtueeo rrqtuoee rrqtuoee rrqtueoe rrqtueeo rrqteeuo rrqteeou rrqteueo rrqteuoe
rrqteoue rrqteoeu rrquotee rrquotee rrquoete rrquoeet rrquoeet rrquoete rrqutoee rrqutoee rrquteoe
rrquteeo rrquteeo rrquteoe rrquetoe rrqueteo rrqueote rrqueoet rrqueeot rrqueeto rrqueteo rrquetoe
rrqueeto rrqueeot rrqueoet rrqueote rrqeotue rrqeoteu rrqeoute rrqeouet rrqeoeut rrqeoetu rrqetoue
rrqetoeu rrqetuoe rrqetueo rrqeteuo rrqeteou rrqeutoe rrqeuteo rrqeuote rrqeuoet rrqeueot rrqeueto
rrqeetuo rrqeetou rrqeeuto rrqeeuot rrqeeout rrqeeotu rrueoqte rrueoqet rrueotqe rrueoteq rrueoetq
rrueoeqt rrueqote rrueqoet rrueqtoe rrueqteo rrueqeto rrueqeot rruetqoe rruetqeo rruetoqe rruetoeq
rrueteoq rrueteqo rrueeqto rrueeqot rrueetqo rrueetoq rrueeotq rrueeoqt rruoeqte rruoeqet rruoetqe
rruoeteq rruoeetq rruoeeqt rruoqete rruoqeet rruoqtee rruoqtee rruoqete rruoqeet rruotqee rruotqee
rruoteqe rruoteeq rruoteeq rruoteqe rruoeqte rruoeqet rruoetqe rruoeteq rruoeetq rruoeeqt rruqoete
rruqoeet rruqotee rruqotee rruqoete rruqoeet rruqeote rruqeoet rruqetoe rruqeteo rruqeeto rruqeeot
rruqteoe rruqteeo rruqtoee rruqtoee rruqteoe rruqteeo rruqeeto rruqeeot rruqeteo rruqetoe rruqeote
rruqeoet rrutoqee rrutoqee rrutoeqe rrutoeeq rrutoeeq rrutoeqe rrutqoee rrutqoee rrutqeoe rrutqeeo
rrutqeeo rrutqeoe rruteqoe rruteqeo rruteoqe rruteoeq rruteeoq rruteeqo rruteqeo rruteqoe rruteeqo
rruteeoq rruteoeq rruteoqe rrueoqte rrueoqet rrueotqe rrueoteq rrueoetq rrueoeqt rrueqote rrueqoet
rrueqtoe rrueqteo rrueqeto rrueqeot rruetqoe rruetqeo rruetoqe rruetoeq rrueteoq rrueteqo rrueeqto
rrueeqot rrueetqo rrueetoq rrueeotq rrueeoqt rreeoqut rreeoqtu rreeouqt rreeoutq rreeotuq rreeotqu
rreeqout rreeqotu rreequot rreequto rreeqtuo rreeqtou rreeuqot rreeuqto rreeuoqt rreeuotq rreeutoq
rreeutqo rreetquo rreetqou rreetuqo rreetuoq rreetouq rreetoqu rreoequt rreoeqtu rreoeuqt rreoeutq
rreoetuq rreoetqu rreoqeut rreoqetu rreoquet rreoqute rreoqtue rreoqteu rreouqet rreouqte rreoueqt
rreouetq rreouteq rreoutqe rreotque rreotqeu rreotuqe rreotueq rreoteuq rreotequ rreqoeut rreqoetu
rreqouet rreqoute rreqotue rreqoteu rreqeout rreqeotu rreqeuot rreqeuto rreqetuo rreqetou rrequeot
rrequeto rrequoet rrequote rrequtoe rrequteo rreqteuo rreqteou rreqtueo rreqtuoe rreqtoue rreqtoeu
rreuoqet rreuoqte rreuoeqt rreuoetq rreuoteq rreuotqe rreuqoet rreuqote rreuqeot rreuqeto rreuqteo
rreuqtoe rreueqot rreueqto rreueoqt rreueotq rreuetoq rreuetqo rreutqeo rreutqoe rreuteqo rreuteoq
rreutoeq rreutoqe rretoque rretoqeu rretouqe rretoueq rretoeuq rretoequ rretqoue rretqoeu rretquoe
rretqueo rretqeuo rretqeou rretuqoe rretuqeo rretuoqe rretuoeq rretueoq rretueqo rretequo rreteqou
rreteuqo rreteuoq rreteouq rreteoqu rotreque rotreqeu rotreuqe rotreueq rotreeuq rotreequ rotrqeue
rotrqeeu rotrquee rotrquee rotrqeue rotrqeeu rotruqee rotruqee rotrueqe rotrueeq rotrueeq rotrueqe
rotreque rotreqeu rotreuqe rotreueq rotreeuq rotreequ roterque roterqeu roteruqe roterueq rotereuq
roterequ roteqrue roteqreu rotequre rotequer roteqeur roteqeru roteuqre roteuqer roteurqe roteureq
roteuerq roteueqr roteequr roteeqru roteeuqr roteeurq roteeruq roteerqu rotqerue rotqereu rotqeure
rotqeuer rotqeeur rotqeeru rotqreue rotqreeu rotqruee rotqruee rotqreue rotqreeu rotquree rotquree
rotquere rotqueer rotqueer rotquere rotqerue rotqereu rotqeure rotqeuer rotqeeur rotqeeru rotueqre
rotueqer rotuerqe rotuereq rotueerq rotueeqr rotuqere rotuqeer rotuqree rotuqree rotuqere rotuqeer
roturqee roturqee rotureqe rotureeq rotureeq rotureqe rotueqre rotueqer rotuerqe rotuereq rotueerq
rotueeqr roteequr roteeqru roteeuqr roteeurq roteeruq roteerqu roteqeur roteqeru rotequer rotequre
roteqrue roteqreu roteuqer roteuqre roteueqr roteuerq roteureq roteurqe roterque roterqeu roteruqe
roterueq rotereuq roterequ rorteque rorteqeu rorteuqe rorteueq rorteeuq rorteequ rortqeue rortqeeu
rortquee rortquee rortqeue rortqeeu rortuqee rortuqee rortueqe rortueeq rortueeq rortueqe rorteque
rorteqeu rorteuqe rorteueq rorteeuq rorteequ roretque roretqeu roretuqe roretueq roreteuq roretequ
roreqtue roreqteu rorequte rorequet roreqeut roreqetu roreuqte roreuqet roreutqe roreuteq roreuetq
roreueqt roreequt roreeqtu roreeuqt roreeutq roreetuq roreetqu rorqetue rorqeteu rorqeute rorqeuet
rorqeeut rorqeetu rorqteue rorqteeu rorqtuee rorqtuee rorqteue rorqteeu rorqutee rorqutee rorquete
rorqueet rorqueet rorquete rorqetue rorqeteu rorqeute rorqeuet rorqeeut rorqeetu rorueqte rorueqet
roruetqe rorueteq rorueetq rorueeqt roruqete roruqeet roruqtee roruqtee roruqete roruqeet rorutqee
rorutqee roruteqe roruteeq roruteeq roruteqe rorueqte rorueqet roruetqe rorueteq rorueetq rorueeqt
roreequt roreeqtu roreeuqt roreeutq roreetuq roreetqu roreqeut roreqetu rorequet rorequte roreqtue
roreqteu roreuqet roreuqte roreueqt roreuetq roreuteq roreutqe roretque roretqeu roretuqe roretueq
roreteuq roretequ roertque roertqeu roertuqe roertueq roerteuq roertequ roerqtue roerqteu roerqute
roerquet roerqeut roerqetu roeruqte roeruqet roerutqe roeruteq roeruetq roerueqt roerequt roereqtu
roereuqt roereutq roeretuq roeretqu roetrque roetrqeu roetruqe roetrueq roetreuq roetrequ roetqrue
roetqreu roetqure roetquer roetqeur roetqeru roetuqre roetuqer roeturqe roetureq roetuerq roetueqr
roetequr roeteqru roeteuqr roeteurq roeteruq roeterqu roeqtrue roeqtreu roeqture roeqtuer roeqteur
roeqteru roeqrtue roeqrteu roeqrute roeqruet roeqreut roeqretu roequrte roequret roequtre roequter
roequetr roequert roeqerut roeqertu roeqeurt roeqeutr roeqetur roeqetru roeutqre roeutqer roeutrqe
roeutreq roeuterq roeuteqr roeuqtre roeuqter roeuqrte roeuqret roeuqert roeuqetr roeurqte roeurqet
roeurtqe roeurteq roeuretq roeureqt roeueqrt roeueqtr roeuerqt roeuertq roeuetrq roeuetqr roeetqur
roeetqru roeetuqr roeeturq roeetruq roeetrqu roeeqtur roeeqtru roeequtr roeequrt roeeqrut roeeqrtu
roeeuqtr roeeuqrt roeeutqr roeeutrq roeeurtq roeeurqt roeerqut roeerqtu roeeruqt roeerutq roeertuq
roeertqu roqretue roqreteu roqreute roqreuet roqreeut roqreetu roqrteue roqrteeu roqrtuee roqrtuee
roqrteue roqrteeu roqrutee roqrutee roqruete roqrueet roqrueet roqruete roqretue roqreteu roqreute
roqreuet roqreeut roqreetu roqertue roqerteu roqerute roqeruet roqereut roqeretu roqetrue roqetreu
roqeture roqetuer roqeteur roqeteru roqeutre roqeuter roqeurte roqeuret roqeuert roqeuetr roqeetur
roqeetru roqeeutr roqeeurt roqeerut roqeertu roqterue roqtereu roqteure roqteuer roqteeur roqteeru
roqtreue roqtreeu roqtruee roqtruee roqtreue roqtreeu roqturee roqturee roqtuere roqtueer roqtueer
roqtuere roqterue roqtereu roqteure roqteuer roqteeur roqteeru roquetre roqueter roquerte roqueret
roqueert roqueetr roqutere roquteer roqutree roqutree roqutere roquteer roqurtee roqurtee roqurete
roqureet roqureet roqurete roquetre roqueter roquerte roqueret roqueert roqueetr roqeetur roqeetru
roqeeutr roqeeurt roqeerut roqeertu roqeteur roqeteru roqetuer roqeture roqetrue roqetreu roqeuter
roqeutre roqeuetr roqeuert roqeuret roqeurte roqertue roqerteu roqerute roqeruet roqereut roqeretu
roureqte roureqet rouretqe roureteq roureetq roureeqt rourqete rourqeet rourqtee rourqtee rourqete
rourqeet rourtqee rourtqee rourteqe rourteeq rourteeq rourteqe roureqte roureqet rouretqe roureteq
roureetq roureeqt rouerqte rouerqet rouertqe rouerteq roueretq rouereqt roueqrte roueqret roueqtre
roueqter roueqetr roueqert rouetqre rouetqer rouetrqe rouetreq roueterq roueteqr roueeqtr roueeqrt
roueetqr roueetrq roueertq roueerqt rouqerte rouqeret rouqetre rouqeter rouqeetr rouqeert rouqrete
rouqreet rouqrtee rouqrtee rouqrete rouqreet rouqtree rouqtree rouqtere rouqteer rouqteer rouqtere
rouqerte rouqeret rouqetre rouqeter rouqeetr rouqeert routeqre routeqer routerqe routereq routeerq
routeeqr routqere routqeer routqree routqree routqere routqeer routrqee routrqee routreqe routreeq
routreeq routreqe routeqre routeqer routerqe routereq routeerq routeeqr roueeqtr roueeqrt roueetqr
roueetrq roueertq roueerqt roueqetr roueqert roueqter roueqtre roueqrte roueqret rouetqer rouetqre
roueteqr roueterq rouetreq rouetrqe rouerqte rouerqet rouertqe rouerteq roueretq rouereqt roerequt
roereqtu roereuqt roereutq roeretuq roeretqu roerqeut roerqetu roerquet roerqute roerqtue roerqteu
roeruqet roeruqte roerueqt roeruetq roeruteq roerutqe roertque roertqeu roertuqe roertueq roerteuq
roertequ roeerqut roeerqtu roeeruqt roeerutq roeertuq roeertqu roeeqrut roeeqrtu roeequrt roeequtr
roeeqtur roeeqtru roeeuqrt roeeuqtr roeeurqt roeeurtq roeeutrq roeeutqr roeetqur roeetqru roeetuqr
roeeturq roeetruq roeetrqu roeqerut roeqertu roeqeurt roeqeutr roeqetur roeqetru roeqreut roeqretu
roeqruet roeqrute roeqrtue roeqrteu roequret roequrte roequert roequetr roequter roequtre roeqtrue
roeqtreu roeqture roeqtuer roeqteur roeqteru roeueqrt roeueqtr roeuerqt roeuertq roeuetrq roeuetqr
roeuqert roeuqetr roeuqret roeuqrte roeuqtre roeuqter roeurqet roeurqte roeureqt roeuretq roeurteq
roeurtqe roeutqre roeutqer roeutrqe roeutreq roeuterq roeuteqr roetequr roeteqru roeteuqr roeteurq
roeteruq roeterqu roetqeur roetqeru roetquer roetqure roetqrue roetqreu roetuqer roetuqre roetueqr
roetuerq roetureq roeturqe roetrque roetrqeu roetruqe roetrueq roetreuq roetrequ rqtroeue rqtroeeu
rqtrouee rqtrouee rqtroeue rqtroeeu rqtreoue rqtreoeu rqtreuoe rqtreueo rqtreeuo rqtreeou rqtrueoe
rqtrueeo rqtruoee rqtruoee rqtrueoe rqtrueeo rqtreeuo rqtreeou rqtreueo rqtreuoe rqtreoue rqtreoeu
rqtoreue rqtoreeu rqtoruee rqtoruee rqtoreue rqtoreeu rqtoerue rqtoereu rqtoeure rqtoeuer rqtoeeur
rqtoeeru rqtouere rqtoueer rqtouree rqtouree rqtouere rqtoueer rqtoeeur rqtoeeru rqtoeuer rqtoeure
rqtoerue rqtoereu rqteorue rqteoreu rqteoure rqteouer rqteoeur rqteoeru rqteroue rqteroeu rqteruoe
rqterueo rqtereuo rqtereou rqteuroe rqteureo rqteuore rqteuoer rqteueor rqteuero rqteeruo rqteerou
rqteeuro rqteeuor rqteeour rqteeoru rqtuoere rqtuoeer rqtuoree rqtuoree rqtuoere rqtuoeer rqtueore
rqtueoer rqtueroe rqtuereo rqtueero rqtueeor rqtureoe rqtureeo rqturoee rqturoee rqtureoe rqtureeo
rqtueero rqtueeor rqtuereo rqtueroe rqtueore rqtueoer rqteoeur rqteoeru rqteouer rqteoure rqteorue
rqteoreu rqteeour rqteeoru rqteeuor rqteeuro rqteeruo rqteerou rqteueor rqteuero rqteuoer rqteuore
rqteuroe rqteureo rqtereuo rqtereou rqterueo rqteruoe rqteroue rqteroeu rqrtoeue rqrtoeeu rqrtouee
rqrtouee rqrtoeue rqrtoeeu rqrteoue rqrteoeu rqrteuoe rqrteueo rqrteeuo rqrteeou rqrtueoe rqrtueeo
rqrtuoee rqrtuoee rqrtueoe rqrtueeo rqrteeuo rqrteeou rqrteueo rqrteuoe rqrteoue rqrteoeu rqroteue
rqroteeu rqrotuee rqrotuee rqroteue rqroteeu rqroetue rqroeteu rqroeute rqroeuet rqroeeut rqroeetu
rqrouete rqroueet rqroutee rqroutee rqrouete rqroueet rqroeeut rqroeetu rqroeuet rqroeute rqroetue
rqroeteu rqreotue rqreoteu rqreoute rqreouet rqreoeut rqreoetu rqretoue rqretoeu rqretuoe rqretueo
rqreteuo rqreteou rqreutoe rqreuteo rqreuote rqreuoet rqreueot rqreueto rqreetuo rqreetou rqreeuto
rqreeuot rqreeout rqreeotu rqruoete rqruoeet rqruotee rqruotee rqruoete rqruoeet rqrueote rqrueoet
rqruetoe rqrueteo rqrueeto rqrueeot rqruteoe rqruteeo rqrutoee rqrutoee rqruteoe rqruteeo rqrueeto
rqrueeot rqrueteo rqruetoe rqrueote rqrueoet rqreoeut rqreoetu rqreouet rqreoute rqreotue rqreoteu
rqreeout rqreeotu rqreeuot rqreeuto rqreetuo rqreetou rqreueot rqreueto rqreuoet rqreuote rqreutoe
rqreuteo rqreteuo rqreteou rqretueo rqretuoe rqretoue rqretoeu rqorteue rqorteeu rqortuee rqortuee
rqorteue rqorteeu rqoretue rqoreteu rqoreute rqoreuet rqoreeut rqoreetu rqoruete rqorueet rqorutee
rqorutee rqoruete rqorueet rqoreeut rqoreetu rqoreuet rqoreute rqoretue rqoreteu rqotreue rqotreeu
rqotruee rqotruee rqotreue rqotreeu rqoterue rqotereu rqoteure rqoteuer rqoteeur rqoteeru rqotuere
rqotueer rqoturee rqoturee rqotuere rqotueer rqoteeur rqoteeru rqoteuer rqoteure rqoterue rqotereu
rqoetrue rqoetreu rqoeture rqoetuer rqoeteur rqoeteru rqoertue rqoerteu rqoerute rqoeruet rqoereut
rqoeretu rqoeurte rqoeuret rqoeutre rqoeuter rqoeuetr rqoeuert rqoeerut rqoeertu rqoeeurt rqoeeutr
rqoeetur rqoeetru rqoutere rqouteer rqoutree rqoutree rqoutere rqouteer rqouetre rqoueter rqouerte
rqoueret rqoueert rqoueetr rqourete rqoureet rqourtee rqourtee rqourete rqoureet rqoueert rqoueetr
rqoueret rqouerte rqouetre rqoueter rqoeteur rqoeteru rqoetuer rqoeture rqoetrue rqoetreu rqoeetur
rqoeetru rqoeeutr rqoeeurt rqoeerut rqoeertu rqoeuetr rqoeuert rqoeuter rqoeutre rqoeurte rqoeuret
rqoereut rqoeretu rqoeruet rqoerute rqoertue rqoerteu rqerotue rqeroteu rqeroute rqerouet rqeroeut
rqeroetu rqertoue rqertoeu rqertuoe rqertueo rqerteuo rqerteou rqerutoe rqeruteo rqeruote rqeruoet
rqerueot rqerueto rqeretuo rqeretou rqereuto rqereuot rqereout rqereotu rqeortue rqeorteu rqeorute
rqeoruet rqeoreut rqeoretu rqeotrue rqeotreu rqeoture rqeotuer rqeoteur rqeoteru rqeoutre rqeouter
rqeourte rqeouret rqeouert rqeouetr rqeoetur rqeoetru rqeoeutr rqeoeurt rqeoerut rqeoertu rqetorue
rqetoreu rqetoure rqetouer rqetoeur rqetoeru rqetroue rqetroeu rqetruoe rqetrueo rqetreuo rqetreou
rqeturoe rqetureo rqetuore rqetuoer rqetueor rqetuero rqeteruo rqeterou rqeteuro rqeteuor rqeteour
rqeteoru rqeuotre rqeuoter rqeuorte rqeuoret rqeuoert rqeuoetr rqeutore rqeutoer rqeutroe rqeutreo
rqeutero rqeuteor rqeurtoe rqeurteo rqeurote rqeuroet rqeureot rqeureto rqeuetro rqeuetor rqeuerto
rqeuerot rqeueort rqeueotr rqeeotur rqeeotru rqeeoutr rqeeourt rqeeorut rqeeortu rqeetour rqeetoru
rqeetuor rqeeturo rqeetruo rqeetrou rqeeutor rqeeutro rqeeuotr rqeeuort rqeeurot rqeeurto rqeertuo
rqeertou rqeeruto rqeeruot rqeerout rqeerotu rquroete rquroeet rqurotee rqurotee rquroete rquroeet
rqureote rqureoet rquretoe rqureteo rqureeto rqureeot rqurteoe rqurteeo rqurtoee rqurtoee rqurteoe
rqurteeo rqureeto rqureeot rqureteo rquretoe rqureote rqureoet rquorete rquoreet rquortee rquortee
rquorete rquoreet rquoerte rquoeret rquoetre rquoeter rquoeetr rquoeert rquotere rquoteer rquotree
rquotree rquotere rquoteer rquoeetr rquoeert rquoeter rquoetre rquoerte rquoeret rqueorte rqueoret
rqueotre rqueoter rqueoetr rqueoert rquerote rqueroet rquertoe rquerteo rquereto rquereot rquetroe
rquetreo rquetore rquetoer rqueteor rquetero rqueerto rqueerot rqueetro rqueetor rqueeotr rqueeort
rqutoere rqutoeer rqutoree rqutoree rqutoere rqutoeer rquteore rquteoer rquteroe rqutereo rquteero
rquteeor rqutreoe rqutreeo rqutroee rqutroee rqutreoe rqutreeo rquteero rquteeor rqutereo rquteroe
rquteore rquteoer rqueoetr rqueoert rqueoter rqueotre rqueorte rqueoret rqueeotr rqueeort rqueetor
rqueetro rqueerto rqueerot rqueteor rquetero rquetoer rquetore rquetroe rquetreo rquereto rquereot
rquerteo rquertoe rquerote rqueroet rqeroeut rqeroetu rqerouet rqeroute rqerotue rqeroteu rqereout
rqereotu rqereuot rqereuto rqeretuo rqeretou rqerueot rqerueto rqeruoet rqeruote rqerutoe rqeruteo
rqerteuo rqerteou rqertueo rqertuoe rqertoue rqertoeu rqeoreut rqeoretu rqeoruet rqeorute rqeortue
rqeorteu rqeoerut rqeoertu rqeoeurt rqeoeutr rqeoetur rqeoetru rqeouert rqeouetr rqeouret rqeourte
rqeoutre rqeouter rqeoteur rqeoteru rqeotuer rqeoture rqeotrue rqeotreu rqeeorut rqeeortu rqeeourt
rqeeoutr rqeeotur rqeeotru rqeerout rqeerotu rqeeruot rqeeruto rqeertuo rqeertou rqeeurot rqeeurto
rqeeuort rqeeuotr rqeeutor rqeeutro rqeetruo rqeetrou rqeeturo rqeetuor rqeetour rqeetoru rqeuoert
rqeuoetr rqeuoret rqeuorte rqeuotre rqeuoter rqeueort rqeueotr rqeuerot rqeuerto rqeuetro rqeuetor
rqeureot rqeureto rqeuroet rqeurote rqeurtoe rqeurteo rqeutero rqeuteor rqeutreo rqeutroe rqeutore
rqeutoer rqetoeur rqetoeru rqetouer rqetoure rqetorue rqetoreu rqeteour rqeteoru rqeteuor rqeteuro
rqeteruo rqeterou rqetueor rqetuero rqetuoer rqetuore rqeturoe rqetureo rqetreuo rqetreou rqetrueo
rqetruoe rqetroue rqetroeu rutroqee rutroqee rutroeqe rutroeeq rutroeeq rutroeqe rutrqoee rutrqoee
rutrqeoe rutrqeeo rutrqeeo rutrqeoe rutreqoe rutreqeo rutreoqe rutreoeq rutreeoq rutreeqo rutreqeo
rutreqoe rutreeqo rutreeoq rutreoeq rutreoqe rutorqee rutorqee rutoreqe rutoreeq rutoreeq rutoreqe
rutoqree rutoqree rutoqere rutoqeer rutoqeer rutoqere rutoeqre rutoeqer rutoerqe rutoereq rutoeerq
rutoeeqr rutoeqer rutoeqre rutoeeqr rutoeerq rutoereq rutoerqe rutqoree rutqoree rutqoere rutqoeer
rutqoeer rutqoere rutqroee rutqroee rutqreoe rutqreeo rutqreeo rutqreoe rutqeroe rutqereo rutqeore
rutqeoer rutqeeor rutqeero rutqereo rutqeroe rutqeero rutqeeor rutqeoer rutqeore ruteoqre ruteoqer
ruteorqe ruteoreq ruteoerq ruteoeqr ruteqore ruteqoer ruteqroe ruteqreo ruteqero ruteqeor ruterqoe
ruterqeo ruteroqe ruteroeq rutereoq rutereqo ruteeqro ruteeqor ruteerqo ruteeroq ruteeorq ruteeoqr
ruteoqer ruteoqre ruteoeqr ruteoerq ruteoreq ruteorqe ruteqoer ruteqore ruteqeor ruteqero ruteqreo
ruteqroe ruteeqor ruteeqro ruteeoqr ruteeorq ruteeroq ruteerqo ruterqeo ruterqoe rutereqo rutereoq
ruteroeq ruteroqe rurtoqee rurtoqee rurtoeqe rurtoeeq rurtoeeq rurtoeqe rurtqoee rurtqoee rurtqeoe
rurtqeeo rurtqeeo rurtqeoe rurteqoe rurteqeo rurteoqe rurteoeq rurteeoq rurteeqo rurteqeo rurteqoe
rurteeqo rurteeoq rurteoeq rurteoqe rurotqee rurotqee ruroteqe ruroteeq ruroteeq ruroteqe ruroqtee
ruroqtee ruroqete ruroqeet ruroqeet ruroqete ruroeqte ruroeqet ruroetqe ruroeteq ruroeetq ruroeeqt
ruroeqet ruroeqte ruroeeqt ruroeetq ruroeteq ruroetqe rurqotee rurqotee rurqoete rurqoeet rurqoeet
rurqoete rurqtoee rurqtoee rurqteoe rurqteeo rurqteeo rurqteoe rurqetoe rurqeteo rurqeote rurqeoet
rurqeeot rurqeeto rurqeteo rurqetoe rurqeeto rurqeeot rurqeoet rurqeote rureoqte rureoqet rureotqe
rureoteq rureoetq rureoeqt rureqote rureqoet rureqtoe rureqteo rureqeto rureqeot ruretqoe ruretqeo
ruretoqe ruretoeq rureteoq rureteqo rureeqto rureeqot rureetqo rureetoq rureeotq rureeoqt rureoqet
rureoqte rureoeqt rureoetq rureoteq rureotqe rureqoet rureqote rureqeot rureqeto rureqteo rureqtoe
rureeqot rureeqto rureeoqt rureeotq rureetoq rureetqo ruretqeo ruretqoe rureteqo rureteoq ruretoeq
ruretoqe ruortqee ruortqee ruorteqe ruorteeq ruorteeq ruorteqe ruorqtee ruorqtee ruorqete ruorqeet
ruorqeet ruorqete ruoreqte ruoreqet ruoretqe ruoreteq ruoreetq ruoreeqt ruoreqet ruoreqte ruoreeqt
ruoreetq ruoreteq ruoretqe ruotrqee ruotrqee ruotreqe ruotreeq ruotreeq ruotreqe ruotqree ruotqree
ruotqere ruotqeer ruotqeer ruotqere ruoteqre ruoteqer ruoterqe ruotereq ruoteerq ruoteeqr ruoteqer
ruoteqre ruoteeqr ruoteerq ruotereq ruoterqe ruoqtree ruoqtree ruoqtere ruoqteer ruoqteer ruoqtere
ruoqrtee ruoqrtee ruoqrete ruoqreet ruoqreet ruoqrete ruoqerte ruoqeret ruoqetre ruoqeter ruoqeetr
ruoqeert ruoqeret ruoqerte ruoqeert ruoqeetr ruoqeter ruoqetre ruoetqre ruoetqer ruoetrqe ruoetreq
ruoeterq ruoeteqr ruoeqtre ruoeqter ruoeqrte ruoeqret ruoeqert ruoeqetr ruoerqte ruoerqet ruoertqe
ruoerteq ruoeretq ruoereqt ruoeeqrt ruoeeqtr ruoeerqt ruoeertq ruoeetrq ruoeetqr ruoetqer ruoetqre
ruoeteqr ruoeterq ruoetreq ruoetrqe ruoeqter ruoeqtre ruoeqetr ruoeqert ruoeqret ruoeqrte ruoeeqtr
ruoeeqrt ruoeetqr ruoeetrq ruoeertq ruoeerqt ruoerqet ruoerqte ruoereqt ruoeretq ruoerteq ruoertqe
ruqrotee ruqrotee ruqroete ruqroeet ruqroeet ruqroete ruqrtoee ruqrtoee ruqrteoe ruqrteeo ruqrteeo
ruqrteoe ruqretoe ruqreteo ruqreote ruqreoet ruqreeot ruqreeto ruqreteo ruqretoe ruqreeto ruqreeot
ruqreoet ruqreote ruqortee ruqortee ruqorete ruqoreet ruqoreet ruqorete ruqotree ruqotree ruqotere
ruqoteer ruqoteer ruqotere ruqoetre ruqoeter ruqoerte ruqoeret ruqoeert ruqoeetr ruqoeter ruqoetre
ruqoeetr ruqoeert ruqoeret ruqoerte ruqtoree ruqtoree ruqtoere ruqtoeer ruqtoeer ruqtoere ruqtroee
ruqtroee ruqtreoe ruqtreeo ruqtreeo ruqtreoe ruqteroe ruqtereo ruqteore ruqteoer ruqteeor ruqteero
ruqtereo ruqteroe ruqteero ruqteeor ruqteoer ruqteore ruqeotre ruqeoter ruqeorte ruqeoret ruqeoert
ruqeoetr ruqetore ruqetoer ruqetroe ruqetreo ruqetero ruqeteor ruqertoe ruqerteo ruqerote ruqeroet
ruqereot ruqereto ruqeetro ruqeetor ruqeerto ruqeerot ruqeeort ruqeeotr ruqeoter ruqeotre ruqeoetr
ruqeoert ruqeoret ruqeorte ruqetoer ruqetore ruqeteor ruqetero ruqetreo ruqetroe ruqeetor ruqeetro
ruqeeotr ruqeeort ruqeerot ruqeerto ruqerteo ruqertoe ruqereto ruqereot ruqeroet ruqerote rueroqte
rueroqet ruerotqe rueroteq rueroetq rueroeqt ruerqote ruerqoet ruerqtoe ruerqteo ruerqeto ruerqeot
ruertqoe ruertqeo ruertoqe ruertoeq ruerteoq ruerteqo ruereqto ruereqot rueretqo rueretoq ruereotq
ruereoqt rueorqte rueorqet rueortqe rueorteq rueoretq rueoreqt rueoqrte rueoqret rueoqtre rueoqter
rueoqetr rueoqert rueotqre rueotqer rueotrqe rueotreq rueoterq rueoteqr rueoeqtr rueoeqrt rueoetqr
rueoetrq rueoertq rueoerqt rueqorte rueqoret rueqotre rueqoter rueqoetr rueqoert rueqrote rueqroet
rueqrtoe rueqrteo rueqreto rueqreot rueqtroe rueqtreo rueqtore rueqtoer rueqteor rueqtero rueqerto
rueqerot rueqetro rueqetor rueqeotr rueqeort ruetoqre ruetoqer ruetorqe ruetoreq ruetoerq ruetoeqr
ruetqore ruetqoer ruetqroe ruetqreo ruetqero ruetqeor ruetrqoe ruetrqeo ruetroqe ruetroeq ruetreoq
ruetreqo rueteqro rueteqor rueterqo rueteroq rueteorq rueteoqr rueeoqtr rueeoqrt rueeotqr rueeotrq
rueeortq rueeorqt rueeqotr rueeqort rueeqtor rueeqtro rueeqrto rueeqrot rueetqor rueetqro rueetoqr
rueetorq rueetroq rueetrqo rueerqto rueerqot rueertqo rueertoq rueerotq rueeroqt rueroqet rueroqte
rueroeqt rueroetq rueroteq ruerotqe ruerqoet ruerqote ruerqeot ruerqeto ruerqteo ruerqtoe ruereqot
ruereqto ruereoqt ruereotq rueretoq rueretqo ruertqeo ruertqoe ruerteqo ruerteoq ruertoeq ruertoqe
rueorqet rueorqte rueoreqt rueoretq rueorteq rueortqe rueoqret rueoqrte rueoqert rueoqetr rueoqter
rueoqtre rueoeqrt rueoeqtr rueoerqt rueoertq rueoetrq rueoetqr rueotqer rueotqre rueoteqr rueoterq
rueotreq rueotrqe rueqoret rueqorte rueqoert rueqoetr rueqoter rueqotre rueqroet rueqrote rueqreot
rueqreto rueqrteo rueqrtoe rueqerot rueqerto rueqeort rueqeotr rueqetor rueqetro rueqtreo rueqtroe
rueqtero rueqteor rueqtoer rueqtore rueeoqrt rueeoqtr rueeorqt rueeortq rueeotrq rueeotqr rueeqort
rueeqotr rueeqrot rueeqrto rueeqtro rueeqtor rueerqot rueerqto rueeroqt rueerotq rueertoq rueertqo
rueetqro rueetqor rueetrqo rueetroq rueetorq rueetoqr ruetoqer ruetoqre ruetoeqr ruetoerq ruetoreq
ruetorqe ruetqoer ruetqore ruetqeor ruetqero ruetqreo ruetqroe rueteqor rueteqro rueteoqr rueteorq
rueteroq rueterqo ruetrqeo ruetrqoe ruetreqo ruetreoq ruetroeq ruetroqe retroque retroqeu retrouqe
retroueq retroeuq retroequ retrqoue retrqoeu retrquoe retrqueo retrqeuo retrqeou retruqoe retruqeo
retruoqe retruoeq retrueoq retrueqo retrequo retreqou retreuqo retreuoq retreouq retreoqu retorque
retorqeu retoruqe retorueq retoreuq retorequ retoqrue retoqreu retoqure retoquer retoqeur retoqeru
retouqre retouqer retourqe retoureq retouerq retoueqr retoequr retoeqru retoeuqr retoeurq retoeruq
retoerqu retqorue retqoreu retqoure retqouer retqoeur retqoeru retqroue retqroeu retqruoe retqrueo
retqreuo retqreou retquroe retqureo retquore retquoer retqueor retquero retqeruo retqerou retqeuro
retqeuor retqeour retqeoru retuoqre retuoqer retuorqe retuoreq retuoerq retuoeqr retuqore retuqoer
retuqroe retuqreo retuqero retuqeor returqoe returqeo returoqe returoeq retureoq retureqo retueqro
retueqor retuerqo retueroq retueorq retueoqr reteoqur reteoqru reteouqr reteourq reteoruq reteorqu
reteqour reteqoru retequor retequro reteqruo reteqrou reteuqor reteuqro reteuoqr reteuorq reteuroq
reteurqo reterquo reterqou reteruqo reteruoq reterouq reteroqu rertoque rertoqeu rertouqe rertoueq
rertoeuq rertoequ rertqoue rertqoeu rertquoe rertqueo rertqeuo rertqeou rertuqoe rertuqeo rertuoqe
rertuoeq rertueoq rertueqo rertequo rerteqou rerteuqo rerteuoq rerteouq rerteoqu rerotque rerotqeu
rerotuqe rerotueq reroteuq rerotequ reroqtue reroqteu reroqute reroquet reroqeut reroqetu rerouqte
rerouqet reroutqe rerouteq rerouetq reroueqt reroequt reroeqtu reroeuqt reroeutq reroetuq reroetqu
rerqotue rerqoteu rerqoute rerqouet rerqoeut rerqoetu rerqtoue rerqtoeu rerqtuoe rerqtueo rerqteuo
rerqteou rerqutoe rerquteo rerquote rerquoet rerqueot rerqueto rerqetuo rerqetou rerqeuto rerqeuot
rerqeout rerqeotu reruoqte reruoqet reruotqe reruoteq reruoetq reruoeqt reruqote reruqoet reruqtoe
reruqteo reruqeto reruqeot rerutqoe rerutqeo rerutoqe rerutoeq reruteoq reruteqo rerueqto rerueqot
reruetqo reruetoq rerueotq rerueoqt rereoqut rereoqtu rereouqt rereoutq rereotuq rereotqu rereqout
rereqotu rerequot rerequto rereqtuo rereqtou rereuqot rereuqto rereuoqt rereuotq rereutoq rereutqo
reretquo reretqou reretuqo reretuoq reretouq reretoqu reortque reortqeu reortuqe reortueq reorteuq
reortequ reorqtue reorqteu reorqute reorquet reorqeut reorqetu reoruqte reoruqet reorutqe reoruteq
reoruetq reorueqt reorequt reoreqtu reoreuqt reoreutq reoretuq reoretqu reotrque reotrqeu reotruqe
reotrueq reotreuq reotrequ reotqrue reotqreu reotqure reotquer reotqeur reotqeru reotuqre reotuqer
reoturqe reotureq reotuerq reotueqr reotequr reoteqru reoteuqr reoteurq reoteruq reoterqu reoqtrue
reoqtreu reoqture reoqtuer reoqteur reoqteru reoqrtue reoqrteu reoqrute reoqruet reoqreut reoqretu
reoqurte reoquret reoqutre reoquter reoquetr reoquert reoqerut reoqertu reoqeurt reoqeutr reoqetur
reoqetru reoutqre reoutqer reoutrqe reoutreq reouterq reouteqr reouqtre reouqter reouqrte reouqret
reouqert reouqetr reourqte reourqet reourtqe reourteq reouretq reoureqt reoueqrt reoueqtr reouerqt
reouertq reouetrq reouetqr reoetqur reoetqru reoetuqr reoeturq reoetruq reoetrqu reoeqtur reoeqtru
reoequtr reoequrt reoeqrut reoeqrtu reoeuqtr reoeuqrt reoeutqr reoeutrq reoeurtq reoeurqt reoerqut
reoerqtu reoeruqt reoerutq reoertuq reoertqu reqrotue reqroteu reqroute reqrouet reqroeut reqroetu
reqrtoue reqrtoeu reqrtuoe reqrtueo reqrteuo reqrteou reqrutoe reqruteo reqruote reqruoet reqrueot
reqrueto reqretuo reqretou reqreuto reqreuot reqreout reqreotu reqortue reqorteu reqorute reqoruet
reqoreut reqoretu reqotrue reqotreu reqoture reqotuer reqoteur reqoteru reqoutre reqouter reqourte
reqouret reqouert reqouetr reqoetur reqoetru reqoeutr reqoeurt reqoerut reqoertu reqtorue reqtoreu
reqtoure reqtouer reqtoeur reqtoeru reqtroue reqtroeu reqtruoe reqtrueo reqtreuo reqtreou reqturoe
reqtureo reqtuore reqtuoer reqtueor reqtuero reqteruo reqterou reqteuro reqteuor reqteour reqteoru
requotre requoter requorte requoret requoert requoetr requtore requtoer requtroe requtreo requtero
requteor requrtoe requrteo requrote requroet requreot requreto requetro requetor requerto requerot
requeort requeotr reqeotur reqeotru reqeoutr reqeourt reqeorut reqeortu reqetour reqetoru reqetuor
reqeturo reqetruo reqetrou reqeutor reqeutro reqeuotr reqeuort reqeurot reqeurto reqertuo reqertou
reqeruto reqeruot reqerout reqerotu reuroqte reuroqet reurotqe reuroteq reuroetq reuroeqt reurqote
reurqoet reurqtoe reurqteo reurqeto reurqeot reurtqoe reurtqeo reurtoqe reurtoeq reurteoq reurteqo
reureqto reureqot reuretqo reuretoq reureotq reureoqt reuorqte reuorqet reuortqe reuorteq reuoretq
reuoreqt reuoqrte reuoqret reuoqtre reuoqter reuoqetr reuoqert reuotqre reuotqer reuotrqe reuotreq
reuoterq reuoteqr reuoeqtr reuoeqrt reuoetqr reuoetrq reuoertq reuoerqt reuqorte reuqoret reuqotre
reuqoter reuqoetr reuqoert reuqrote reuqroet reuqrtoe reuqrteo reuqreto reuqreot reuqtroe reuqtreo
reuqtore reuqtoer reuqteor reuqtero reuqerto reuqerot reuqetro reuqetor reuqeotr reuqeort reutoqre
reutoqer reutorqe reutoreq reutoerq reutoeqr reutqore reutqoer reutqroe reutqreo reutqero reutqeor
reutrqoe reutrqeo reutroqe reutroeq reutreoq reutreqo reuteqro reuteqor reuterqo reuteroq reuteorq
reuteoqr reueoqtr reueoqrt reueotqr reueotrq reueortq reueorqt reueqotr reueqort reueqtor reueqtro
reueqrto reueqrot reuetqor reuetqro reuetoqr reuetorq reuetroq reuetrqo reuerqto reuerqot reuertqo
reuertoq reuerotq reueroqt reeroqut reeroqtu reerouqt reeroutq reerotuq reerotqu reerqout reerqotu
reerquot reerquto reerqtuo reerqtou reeruqot reeruqto reeruoqt reeruotq reerutoq reerutqo reertquo
reertqou reertuqo reertuoq reertouq reertoqu reeorqut reeorqtu reeoruqt reeorutq reeortuq reeortqu
reeoqrut reeoqrtu reeoqurt reeoqutr reeoqtur reeoqtru reeouqrt reeouqtr reeourqt reeourtq reeoutrq
reeoutqr reeotqur reeotqru reeotuqr reeoturq reeotruq reeotrqu reeqorut reeqortu reeqourt reeqoutr
reeqotur reeqotru reeqrout reeqrotu reeqruot reeqruto reeqrtuo reeqrtou reequrot reequrto reequort
reequotr reequtor reequtro reeqtruo reeqtrou reeqturo reeqtuor reeqtour reeqtoru reeuoqrt reeuoqtr
reeuorqt reeuortq reeuotrq reeuotqr reeuqort reeuqotr reeuqrot reeuqrto reeuqtro reeuqtor reeurqot
reeurqto reeuroqt reeurotq reeurtoq reeurtqo reeutqro reeutqor reeutrqo reeutroq reeutorq reeutoqr
reetoqur reetoqru reetouqr reetourq reetoruq reetorqu reetqour reetqoru reetquor reetquro reetqruo
reetqrou reetuqor reetuqro reetuoqr reetuorq reeturoq reeturqo reetrquo reetrqou reetruqo reetruoq
reetrouq reetroqu

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us