easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

eltzroth

pedotrophy

schyndel

consulabatque

overbrace

miargyrite

caedimur

krykkje

saucerize

redintegroque

popify

derided

errabundus

subhyaloid

carew

heliamphora

broadcas

guanajuatite


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: retched
cipher variations:
sfudife tgvejgf uhwfkhg vixglih wjyhmji
xkzinkj ylajolk zmbkpml anclqnm bodmron
cpenspo dqfotqp ergpurq fshqvsr gtirwts
hujsxut ivktyvu jwluzwv kxmvaxw lynwbyx
mzoxczy napydaz obqzeba pcrafcb qdsbgdc

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: retched
Cipher: ivgxsvw

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: retched
Cipher: BAAAA AABAA BAABA AAABA AABBB AABAA AAABB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: retched
cipher variations:
sfudifeanghwnkivslkvqqdepydwylqtmlcgtcxatiwjafcjuermjqra
mzynezguhkrshmcpwvgpskxizuxytgvejgfbohixoljwtmlwrrefqzex
zmrunmdhudybujxkbgdkvfsnkrsbnazofahvilstindqxwhqtlyjavyz
uhwfkhgcpijypmkxunmxssfgrafyansvoneivezcvkylchelwgtolstc
obapgbiwjmtujoeryxirumzkbwzavixglihdqjkzqnlyvonyttghsbgz
botwpofjwfadwlzmdifmxhupmtudpcbqhcjxknuvkpfszyjsvnalcxab
wjyhmjierklaromzwpozuuhitchacpuxqpgkxgbexmanejgnyivqnuve
qdcridkylovwlqgtazktwobmdybcxkzinkjfslmbspnaxqpavvijudib
dqvyrqhlyhcfynbofkhozjwrovwfredsjelzmpwxmrhubaluxpcnezcd
ylajolkgtmnctqobyrqbwwjkvejcerwzsrimzidgzocpglipakxspwxg
sfetkfmanqxynsivcbmvyqdofadezmbkpmlhunodurpczsrcxxklwfkd
fsxatsjnajehapdqhmjqblytqxyhtgfulgnboryzotjwdcnwzrepgbef
anclqnmivopevsqdatsdyylmxglegtybutkobkfibqerinkrcmzuryzi
uhgvmhocpszapukxedoxasfqhcfgbodmronjwpqfwtrebutezzmnyhmf
huzcvulpclgjcrfsjolsdnavszajvihwnipdqtabqvlyfepybtgridgh
cpenspokxqrgxusfcvufaanozingivadwvmqdmhkdsgtkpmteobwtabk
wjixojqerubcrwmzgfqzcuhsjehidqfotqplyrshyvtgdwvgbbopajoh
jwbexwnrenilethulqnufpcxubclxkjypkrfsvcdsxnahgradvitkfij
ergpurqmzstizwuhexwhccpqbkpikxcfyxosfojmfuivmrovgqdyvcdm
ylkzqlsgtwdetyobihsbewjulgjkfshqvsrnatujaxvifyxiddqrclqj
lydgzyptgpkngvjwnspwhrezwdenzmlarmthuxefuzpcjitcfxkvmhkl
gtirwtsobuvkbywjgzyjeersdmrkmzehazquhqlohwkxotqxisfaxefo
anmbsnuivyfgvaqdkjudgylwnilmhujsxutpcvwlczxkhazkffstensl
nafibarvirmpixlypuryjtgbyfgpbonctovjwzghwbrelkvehzmxojmn
ivktyvuqdwxmdaylibalggtufotmobgjcbswjsnqjymzqvszkuhczghq
cpodupwkxahixcsfmlwfianypknojwluzwvrexynebzmjcbmhhuvgpun
pchkdctxktorkznarwtalvidahirdqpevqxlybijydtgnmxgjbozqlop
kxmvaxwsfyzofcankdcniivwhqvoqdileduylupslaobsxubmwjebijs
erqfwrymzcjkzeuhonyhkcparmpqlynwbyxtgzapgdboledojjwxirwp
rejmfevzmvqtmbpctyvcnxkfcjktfsrgxsznadklafvipozildqbsnqr
mzoxczyuhabqhecpmfepkkxyjsxqsfkngfwanwruncqduzwdoylgdklu
gtshytaobelmbgwjqpajmerctorsnapydazvibcrifdqngfqllyzktyr
tglohgxboxsvodrevaxepzmhelmvhutizubpcfmnchxkrqbknfsdupst
obqzebawjcdsjgerohgrmmzaluzsuhmpihycpytwpesfwbyfqanifmnw
ivujavcqdgnodiylsrclogtevqtupcrafcbxkdetkhfspihsnnabmvat
vinqjizdqzuxqftgxczgrbojgnoxjwvkbwdrehopejzmtsdmphufwruv
qdsbgdcylefuligtqjitoobcnwbuwjorkjaeravyrguhydahscpkhopy
kxwlcxesfipqfkanutenqivgxsvwretchedzmfgvmjhurkjuppcdoxcv
xkpslkbfsbwzshvizebitdqlipqzlyxmdyftgjqrglbovuforjwhytwx

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: retched
Cipher: ergpurq

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: retched
Cipher: 24514431325141

Extended Methods:
Method #1

Plaintext: retched
method variations:
wkyhnkibpdnspoguisxutmzoxczy

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
r e t c h e d 
2 5 4 3 3 5 4 
4 1 4 1 2 1 1 
They are then read out in rows:
25433544141211
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: retched
Cipher: woxtqfa

Read more ...
Method #3

Plaintext: retched
method variations:
yqolwqf qolwqfy olwqfyq
lwqfyqo wqfyqol qfyqolw
fyqolwq

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: retched

all 5040 cipher variations:
retched retchde retcehd retcedh retcdeh retcdhe rethced rethcde rethecd rethedc rethdec
rethdce retehcd retehdc retechd retecdh retedch retedhc retdhec retdhce retdehc retdech
retdceh retdche recthed recthde rectehd rectedh rectdeh rectdhe rechted rechtde rechetd
rechedt rechdet rechdte recehtd recehdt recethd recetdh recedth recedht recdhet recdhte
recdeht recdeth recdteh recdthe rehcted rehctde rehcetd rehcedt rehcdet rehcdte rehtced
rehtcde rehtecd rehtedc rehtdec rehtdce rehetcd rehetdc rehectd rehecdt rehedct rehedtc
rehdtec rehdtce rehdetc rehdect rehdcet rehdcte reechtd reechdt reecthd reectdh reecdth
reecdht reehctd reehcdt reehtcd reehtdc reehdtc reehdct reethcd reethdc reetchd reetcdh
reetdch reetdhc reedhtc reedhct reedthc reedtch reedcth reedcht redchet redchte redceht
redceth redcteh redcthe redhcet redhcte redhect redhetc redhtec redhtce redehct redehtc
redecht redecth redetch redethc redthec redthce redtehc redtech redtceh redtche rteched
rtechde rtecehd rtecedh rtecdeh rtecdhe rtehced rtehcde rtehecd rtehedc rtehdec rtehdce
rteehcd rteehdc rteechd rteecdh rteedch rteedhc rtedhec rtedhce rtedehc rtedech rtedceh
rtedche rtcehed rtcehde rtceehd rtceedh rtcedeh rtcedhe rtcheed rtchede rtcheed rtchede
rtchdee rtchdee rtcehed rtcehde rtceehd rtceedh rtcedeh rtcedhe rtcdhee rtcdhee rtcdehe
rtcdeeh rtcdeeh rtcdehe rthceed rthcede rthceed rthcede rthcdee rthcdee rtheced rthecde
rtheecd rtheedc rthedec rthedce rtheecd rtheedc rtheced rthecde rthedce rthedec rthdeec
rthdece rthdeec rthdece rthdcee rthdcee rteched rtechde rtecehd rtecedh rtecdeh rtecdhe
rtehced rtehcde rtehecd rtehedc rtehdec rtehdce rteehcd rteehdc rteechd rteecdh rteedch
rteedhc rtedhec rtedhce rtedehc rtedech rtedceh rtedche rtdchee rtdchee rtdcehe rtdceeh
rtdceeh rtdcehe rtdhcee rtdhcee rtdhece rtdheec rtdheec rtdhece rtdehce rtdehec rtdeche
rtdeceh rtdeech rtdeehc rtdehec rtdehce rtdeehc rtdeech rtdeceh rtdeche rctehed rctehde
rcteehd rcteedh rctedeh rctedhe rctheed rcthede rctheed rcthede rcthdee rcthdee rctehed
rctehde rcteehd rcteedh rctedeh rctedhe rctdhee rctdhee rctdehe rctdeeh rctdeeh rctdehe
rcethed rcethde rcetehd rcetedh rcetdeh rcetdhe rcehted rcehtde rcehetd rcehedt rcehdet
rcehdte rceehtd rceehdt rceethd rceetdh rceedth rceedht rcedhet rcedhte rcedeht rcedeth
rcedteh rcedthe rcheted rchetde rcheetd rcheedt rchedet rchedte rchteed rchtede rchteed
rchtede rchtdee rchtdee rcheted rchetde rcheetd rcheedt rchedet rchedte rchdtee rchdtee
rchdete rchdeet rchdeet rchdete rceehtd rceehdt rceethd rceetdh rceedth rceedht rcehetd
rcehedt rcehted rcehtde rcehdte rcehdet rcethed rcethde rcetehd rcetedh rcetdeh rcetdhe
rcedhte rcedhet rcedthe rcedteh rcedeth rcedeht rcdehet rcdehte rcdeeht rcdeeth rcdeteh
rcdethe rcdheet rcdhete rcdheet rcdhete rcdhtee rcdhtee rcdehet rcdehte rcdeeht rcdeeth
rcdeteh rcdethe rcdthee rcdthee rcdtehe rcdteeh rcdteeh rcdtehe rhtceed rhtcede rhtceed
rhtcede rhtcdee rhtcdee rhteced rhtecde rhteecd rhteedc rhtedec rhtedce rhteecd rhteedc
rhteced rhtecde rhtedce rhtedec rhtdeec rhtdece rhtdeec rhtdece rhtdcee rhtdcee rhcteed
rhctede rhcteed rhctede rhctdee rhctdee rhceted rhcetde rhceetd rhceedt rhcedet rhcedte
rhceetd rhceedt rhceted rhcetde rhcedte rhcedet rhcdeet rhcdete rhcdeet rhcdete rhcdtee
rhcdtee rhected rhectde rhecetd rhecedt rhecdet rhecdte rhetced rhetcde rhetecd rhetedc
rhetdec rhetdce rheetcd rheetdc rheectd rheecdt rheedct rheedtc rhedtec rhedtce rhedetc
rhedect rhedcet rhedcte rhecetd rhecedt rhected rhectde rhecdte rhecdet rheectd rheecdt
rheetcd rheetdc rheedtc rheedct rhetecd rhetedc rhetced rhetcde rhetdce rhetdec rhedetc
rhedect rhedtec rhedtce rhedcte rhedcet rhdceet rhdcete rhdceet rhdcete rhdctee rhdctee
rhdecet rhdecte rhdeect rhdeetc rhdetec rhdetce rhdeect rhdeetc rhdecet rhdecte rhdetce
rhdetec rhdteec rhdtece rhdteec rhdtece rhdtcee rhdtcee retched retchde retcehd retcedh
retcdeh retcdhe rethced rethcde rethecd rethedc rethdec rethdce retehcd retehdc retechd
retecdh retedch retedhc retdhec retdhce retdehc retdech retdceh retdche recthed recthde
rectehd rectedh rectdeh rectdhe rechted rechtde rechetd rechedt rechdet rechdte recehtd
recehdt recethd recetdh recedth recedht recdhet recdhte recdeht recdeth recdteh recdthe
rehcted rehctde rehcetd rehcedt rehcdet rehcdte rehtced rehtcde rehtecd rehtedc rehtdec
rehtdce rehetcd rehetdc rehectd rehecdt rehedct rehedtc rehdtec rehdtce rehdetc rehdect
rehdcet rehdcte reechtd reechdt reecthd reectdh reecdth reecdht reehctd reehcdt reehtcd
reehtdc reehdtc reehdct reethcd reethdc reetchd reetcdh reetdch reetdhc reedhtc reedhct
reedthc reedtch reedcth reedcht redchet redchte redceht redceth redcteh redcthe redhcet
redhcte redhect redhetc redhtec redhtce redehct redehtc redecht redecth redetch redethc
redthec redthce redtehc redtech redtceh redtche rdtchee rdtchee rdtcehe rdtceeh rdtceeh
rdtcehe rdthcee rdthcee rdthece rdtheec rdtheec rdthece rdtehce rdtehec rdteche rdteceh
rdteech rdteehc rdtehec rdtehce rdteehc rdteech rdteceh rdteche rdcthee rdcthee rdctehe
rdcteeh rdcteeh rdctehe rdchtee rdchtee rdchete rdcheet rdcheet rdchete rdcehte rdcehet
rdcethe rdceteh rdceeth rdceeht rdcehet rdcehte rdceeht rdceeth rdceteh rdcethe rdhctee
rdhctee rdhcete rdhceet rdhceet rdhcete rdhtcee rdhtcee rdhtece rdhteec rdhteec rdhtece
rdhetce rdhetec rdhecte rdhecet rdheect rdheetc rdhetec rdhetce rdheetc rdheect rdhecet
rdhecte rdechte rdechet rdecthe rdecteh rdeceth rdeceht rdehcte rdehcet rdehtce rdehtec
rdehetc rdehect rdethce rdethec rdetche rdetceh rdetech rdetehc rdeehtc rdeehct rdeethc
rdeetch rdeecth rdeecht rdechet rdechte rdeceht rdeceth rdecteh rdecthe rdehcet rdehcte
rdehect rdehetc rdehtec rdehtce rdeehct rdeehtc rdeecht rdeecth rdeetch rdeethc rdethec
rdethce rdetehc rdetech rdetceh rdetche ertched ertchde ertcehd ertcedh ertcdeh ertcdhe
erthced erthcde erthecd erthedc erthdec erthdce ertehcd ertehdc ertechd ertecdh ertedch
ertedhc ertdhec ertdhce ertdehc ertdech ertdceh ertdche ercthed ercthde erctehd erctedh
erctdeh erctdhe erchted erchtde erchetd erchedt erchdet erchdte ercehtd ercehdt ercethd
ercetdh ercedth ercedht ercdhet ercdhte ercdeht ercdeth ercdteh ercdthe erhcted erhctde
erhcetd erhcedt erhcdet erhcdte erhtced erhtcde erhtecd erhtedc erhtdec erhtdce erhetcd
erhetdc erhectd erhecdt erhedct erhedtc erhdtec erhdtce erhdetc erhdect erhdcet erhdcte
erechtd erechdt erecthd erectdh erecdth erecdht erehctd erehcdt erehtcd erehtdc erehdtc
erehdct erethcd erethdc eretchd eretcdh eretdch eretdhc eredhtc eredhct eredthc eredtch
eredcth eredcht erdchet erdchte erdceht erdceth erdcteh erdcthe erdhcet erdhcte erdhect
erdhetc erdhtec erdhtce erdehct erdehtc erdecht erdecth erdetch erdethc erdthec erdthce
erdtehc erdtech erdtceh erdtche etrched etrchde etrcehd etrcedh etrcdeh etrcdhe etrhced
etrhcde etrhecd etrhedc etrhdec etrhdce etrehcd etrehdc etrechd etrecdh etredch etredhc
etrdhec etrdhce etrdehc etrdech etrdceh etrdche etcrhed etcrhde etcrehd etcredh etcrdeh
etcrdhe etchred etchrde etcherd etchedr etchder etchdre etcehrd etcehdr etcerhd etcerdh
etcedrh etcedhr etcdher etcdhre etcdehr etcderh etcdreh etcdrhe ethcred ethcrde ethcerd
ethcedr ethcder ethcdre ethrced ethrcde ethrecd ethredc ethrdec ethrdce ethercd etherdc
ethecrd ethecdr ethedcr ethedrc ethdrec ethdrce ethderc ethdecr ethdcer ethdcre etechrd
etechdr etecrhd etecrdh etecdrh etecdhr etehcrd etehcdr etehrcd etehrdc etehdrc etehdcr
eterhcd eterhdc eterchd etercdh eterdch eterdhc etedhrc etedhcr etedrhc etedrch etedcrh
etedchr etdcher etdchre etdcehr etdcerh etdcreh etdcrhe etdhcer etdhcre etdhecr etdherc
etdhrec etdhrce etdehcr etdehrc etdechr etdecrh etderch etderhc etdrhec etdrhce etdrehc
etdrech etdrceh etdrche ectrhed ectrhde ectrehd ectredh ectrdeh ectrdhe ecthred ecthrde
ectherd ecthedr ecthder ecthdre ectehrd ectehdr ecterhd ecterdh ectedrh ectedhr ectdher
ectdhre ectdehr ectderh ectdreh ectdrhe ecrthed ecrthde ecrtehd ecrtedh ecrtdeh ecrtdhe
ecrhted ecrhtde ecrhetd ecrhedt ecrhdet ecrhdte ecrehtd ecrehdt ecrethd ecretdh ecredth
ecredht ecrdhet ecrdhte ecrdeht ecrdeth ecrdteh ecrdthe echrted echrtde echretd echredt
echrdet echrdte echtred echtrde echterd echtedr echtder echtdre echetrd echetdr echertd
echerdt echedrt echedtr echdter echdtre echdetr echdert echdret echdrte ecerhtd ecerhdt
ecerthd ecertdh ecerdth ecerdht ecehrtd ecehrdt ecehtrd ecehtdr ecehdtr ecehdrt ecethrd
ecethdr ecetrhd ecetrdh ecetdrh ecetdhr ecedhtr ecedhrt ecedthr ecedtrh ecedrth ecedrht
ecdrhet ecdrhte ecdreht ecdreth ecdrteh ecdrthe ecdhret ecdhrte ecdhert ecdhetr ecdhter
ecdhtre ecdehrt ecdehtr ecderht ecderth ecdetrh ecdethr ecdther ecdthre ecdtehr ecdterh
ecdtreh ecdtrhe ehtcred ehtcrde ehtcerd ehtcedr ehtcder ehtcdre ehtrced ehtrcde ehtrecd
ehtredc ehtrdec ehtrdce ehtercd ehterdc ehtecrd ehtecdr ehtedcr ehtedrc ehtdrec ehtdrce
ehtderc ehtdecr ehtdcer ehtdcre ehctred ehctrde ehcterd ehctedr ehctder ehctdre ehcrted
ehcrtde ehcretd ehcredt ehcrdet ehcrdte ehcertd ehcerdt ehcetrd ehcetdr ehcedtr ehcedrt
ehcdret ehcdrte ehcdert ehcdetr ehcdter ehcdtre ehrcted ehrctde ehrcetd ehrcedt ehrcdet
ehrcdte ehrtced ehrtcde ehrtecd ehrtedc ehrtdec ehrtdce ehretcd ehretdc ehrectd ehrecdt
ehredct ehredtc ehrdtec ehrdtce ehrdetc ehrdect ehrdcet ehrdcte ehecrtd ehecrdt ehectrd
ehectdr ehecdtr ehecdrt eherctd ehercdt ehertcd ehertdc eherdtc eherdct ehetrcd ehetrdc
ehetcrd ehetcdr ehetdcr ehetdrc ehedrtc ehedrct ehedtrc ehedtcr ehedctr ehedcrt ehdcret
ehdcrte ehdcert ehdcetr ehdcter ehdctre ehdrcet ehdrcte ehdrect ehdretc ehdrtec ehdrtce
ehderct ehdertc ehdecrt ehdectr ehdetcr ehdetrc ehdtrec ehdtrce ehdterc ehdtecr ehdtcer
ehdtcre eetchrd eetchdr eetcrhd eetcrdh eetcdrh eetcdhr eethcrd eethcdr eethrcd eethrdc
eethdrc eethdcr eetrhcd eetrhdc eetrchd eetrcdh eetrdch eetrdhc eetdhrc eetdhcr eetdrhc
eetdrch eetdcrh eetdchr eecthrd eecthdr eectrhd eectrdh eectdrh eectdhr eechtrd eechtdr
eechrtd eechrdt eechdrt eechdtr eecrhtd eecrhdt eecrthd eecrtdh eecrdth eecrdht eecdhrt
eecdhtr eecdrht eecdrth eecdtrh eecdthr eehctrd eehctdr eehcrtd eehcrdt eehcdrt eehcdtr
eehtcrd eehtcdr eehtrcd eehtrdc eehtdrc eehtdcr eehrtcd eehrtdc eehrctd eehrcdt eehrdct
eehrdtc eehdtrc eehdtcr eehdrtc eehdrct eehdcrt eehdctr eerchtd eerchdt eercthd eerctdh
eercdth eercdht eerhctd eerhcdt eerhtcd eerhtdc eerhdtc eerhdct eerthcd eerthdc eertchd
eertcdh eertdch eertdhc eerdhtc eerdhct eerdthc eerdtch eerdcth eerdcht eedchrt eedchtr
eedcrht eedcrth eedctrh eedcthr eedhcrt eedhctr eedhrct eedhrtc eedhtrc eedhtcr eedrhct
eedrhtc eedrcht eedrcth eedrtch eedrthc eedthrc eedthcr eedtrhc eedtrch eedtcrh eedtchr
edtcher edtchre edtcehr edtcerh edtcreh edtcrhe edthcer edthcre edthecr edtherc edthrec
edthrce edtehcr edtehrc edtechr edtecrh edterch edterhc edtrhec edtrhce edtrehc edtrech
edtrceh edtrche edcther edcthre edctehr edcterh edctreh edctrhe edchter edchtre edchetr
edchert edchret edchrte edcehtr edcehrt edcethr edcetrh edcerth edcerht edcrhet edcrhte
edcreht edcreth edcrteh edcrthe edhcter edhctre edhcetr edhcert edhcret edhcrte edhtcer
edhtcre edhtecr edhterc edhtrec edhtrce edhetcr edhetrc edhectr edhecrt edherct edhertc
edhrtec edhrtce edhretc edhrect edhrcet edhrcte edechtr edechrt edecthr edectrh edecrth
edecrht edehctr edehcrt edehtcr edehtrc edehrtc edehrct edethcr edethrc edetchr edetcrh
edetrch edetrhc ederhtc ederhct ederthc edertch edercth edercht edrchet edrchte edrceht
edrceth edrcteh edrcthe edrhcet edrhcte edrhect edrhetc edrhtec edrhtce edrehct edrehtc
edrecht edrecth edretch edrethc edrthec edrthce edrtehc edrtech edrtceh edrtche terched
terchde tercehd tercedh tercdeh tercdhe terhced terhcde terhecd terhedc terhdec terhdce
terehcd terehdc terechd terecdh teredch teredhc terdhec terdhce terdehc terdech terdceh
terdche tecrhed tecrhde tecrehd tecredh tecrdeh tecrdhe techred techrde techerd techedr
techder techdre tecehrd tecehdr tecerhd tecerdh tecedrh tecedhr tecdher tecdhre tecdehr
tecderh tecdreh tecdrhe tehcred tehcrde tehcerd tehcedr tehcder tehcdre tehrced tehrcde
tehrecd tehredc tehrdec tehrdce tehercd teherdc tehecrd tehecdr tehedcr tehedrc tehdrec
tehdrce tehderc tehdecr tehdcer tehdcre teechrd teechdr teecrhd teecrdh teecdrh teecdhr
teehcrd teehcdr teehrcd teehrdc teehdrc teehdcr teerhcd teerhdc teerchd teercdh teerdch
teerdhc teedhrc teedhcr teedrhc teedrch teedcrh teedchr tedcher tedchre tedcehr tedcerh
tedcreh tedcrhe tedhcer tedhcre tedhecr tedherc tedhrec tedhrce tedehcr tedehrc tedechr
tedecrh tederch tederhc tedrhec tedrhce tedrehc tedrech tedrceh tedrche treched trechde
trecehd trecedh trecdeh trecdhe trehced trehcde trehecd trehedc trehdec trehdce treehcd
treehdc treechd treecdh treedch treedhc tredhec tredhce tredehc tredech tredceh tredche
trcehed trcehde trceehd trceedh trcedeh trcedhe trcheed trchede trcheed trchede trchdee
trchdee trcehed trcehde trceehd trceedh trcedeh trcedhe trcdhee trcdhee trcdehe trcdeeh
trcdeeh trcdehe trhceed trhcede trhceed trhcede trhcdee trhcdee trheced trhecde trheecd
trheedc trhedec trhedce trheecd trheedc trheced trhecde trhedce trhedec trhdeec trhdece
trhdeec trhdece trhdcee trhdcee treched trechde trecehd trecedh trecdeh trecdhe trehced
trehcde trehecd trehedc trehdec trehdce treehcd treehdc treechd treecdh treedch treedhc
tredhec tredhce tredehc tredech tredceh tredche trdchee trdchee trdcehe trdceeh trdceeh
trdcehe trdhcee trdhcee trdhece trdheec trdheec trdhece trdehce trdehec trdeche trdeceh
trdeech trdeehc trdehec trdehce trdeehc trdeech trdeceh trdeche tcrehed tcrehde tcreehd
tcreedh tcredeh tcredhe tcrheed tcrhede tcrheed tcrhede tcrhdee tcrhdee tcrehed tcrehde
tcreehd tcreedh tcredeh tcredhe tcrdhee tcrdhee tcrdehe tcrdeeh tcrdeeh tcrdehe tcerhed
tcerhde tcerehd tceredh tcerdeh tcerdhe tcehred tcehrde tceherd tcehedr tcehder tcehdre
tceehrd tceehdr tceerhd tceerdh tceedrh tceedhr tcedher tcedhre tcedehr tcederh tcedreh
tcedrhe tchered tcherde tcheerd tcheedr tcheder tchedre tchreed tchrede tchreed tchrede
tchrdee tchrdee tchered tcherde tcheerd tcheedr tcheder tchedre tchdree tchdree tchdere
tchdeer tchdeer tchdere tceehrd tceehdr tceerhd tceerdh tceedrh tceedhr tceherd tcehedr
tcehred tcehrde tcehdre tcehder tcerhed tcerhde tcerehd tceredh tcerdeh tcerdhe tcedhre
tcedher tcedrhe tcedreh tcederh tcedehr tcdeher tcdehre tcdeehr tcdeerh tcdereh tcderhe
tcdheer tcdhere tcdheer tcdhere tcdhree tcdhree tcdeher tcdehre tcdeehr tcdeerh tcdereh
tcderhe tcdrhee tcdrhee tcdrehe tcdreeh tcdreeh tcdrehe thrceed thrcede thrceed thrcede
thrcdee thrcdee threced threcde threecd threedc thredec thredce threecd threedc threced
threcde thredce thredec thrdeec thrdece thrdeec thrdece thrdcee thrdcee thcreed thcrede
thcreed thcrede thcrdee thcrdee thcered thcerde thceerd thceedr thceder thcedre thceerd
thceedr thcered thcerde thcedre thceder thcdeer thcdere thcdeer thcdere thcdree thcdree
thecred thecrde thecerd thecedr thecder thecdre therced thercde therecd theredc therdec
therdce theercd theerdc theecrd theecdr theedcr theedrc thedrec thedrce thederc thedecr
thedcer thedcre thecerd thecedr thecred thecrde thecdre thecder theecrd theecdr theercd
theerdc theedrc theedcr therecd theredc therced thercde therdce therdec thederc thedecr
thedrec thedrce thedcre thedcer thdceer thdcere thdceer thdcere thdcree thdcree thdecer
thdecre thdeecr thdeerc thderec thderce thdeecr thdeerc thdecer thdecre thderce thderec
thdreec thdrece thdreec thdrece thdrcee thdrcee terched terchde tercehd tercedh tercdeh
tercdhe terhced terhcde terhecd terhedc terhdec terhdce terehcd terehdc terechd terecdh
teredch teredhc terdhec terdhce terdehc terdech terdceh terdche tecrhed tecrhde tecrehd
tecredh tecrdeh tecrdhe techred techrde techerd techedr techder techdre tecehrd tecehdr
tecerhd tecerdh tecedrh tecedhr tecdher tecdhre tecdehr tecderh tecdreh tecdrhe tehcred
tehcrde tehcerd tehcedr tehcder tehcdre tehrced tehrcde tehrecd tehredc tehrdec tehrdce
tehercd teherdc tehecrd tehecdr tehedcr tehedrc tehdrec tehdrce tehderc tehdecr tehdcer
tehdcre teechrd teechdr teecrhd teecrdh teecdrh teecdhr teehcrd teehcdr teehrcd teehrdc
teehdrc teehdcr teerhcd teerhdc teerchd teercdh teerdch teerdhc teedhrc teedhcr teedrhc
teedrch teedcrh teedchr tedcher tedchre tedcehr tedcerh tedcreh tedcrhe tedhcer tedhcre
tedhecr tedherc tedhrec tedhrce tedehcr tedehrc tedechr tedecrh tederch tederhc tedrhec
tedrhce tedrehc tedrech tedrceh tedrche tdrchee tdrchee tdrcehe tdrceeh tdrceeh tdrcehe
tdrhcee tdrhcee tdrhece tdrheec tdrheec tdrhece tdrehce tdrehec tdreche tdreceh tdreech
tdreehc tdrehec tdrehce tdreehc tdreech tdreceh tdreche tdcrhee tdcrhee tdcrehe tdcreeh
tdcreeh tdcrehe tdchree tdchree tdchere tdcheer tdcheer tdchere tdcehre tdceher tdcerhe
tdcereh tdceerh tdceehr tdceher tdcehre tdceehr tdceerh tdcereh tdcerhe tdhcree tdhcree
tdhcere tdhceer tdhceer tdhcere tdhrcee tdhrcee tdhrece tdhreec tdhreec tdhrece tdherce
tdherec tdhecre tdhecer tdheecr tdheerc tdherec tdherce tdheerc tdheecr tdhecer tdhecre
tdechre tdecher tdecrhe tdecreh tdecerh tdecehr tdehcre tdehcer tdehrce tdehrec tdeherc
tdehecr tderhce tderhec tderche tderceh tderech tderehc tdeehrc tdeehcr tdeerhc tdeerch
tdeecrh tdeechr tdecher tdechre tdecehr tdecerh tdecreh tdecrhe tdehcer tdehcre tdehecr
tdeherc tdehrec tdehrce tdeehcr tdeehrc tdeechr tdeecrh tdeerch tdeerhc tderhec tderhce
tderehc tderech tderceh tderche cetrhed cetrhde cetrehd cetredh cetrdeh cetrdhe cethred
cethrde cetherd cethedr cethder cethdre cetehrd cetehdr ceterhd ceterdh cetedrh cetedhr
cetdher cetdhre cetdehr cetderh cetdreh cetdrhe certhed certhde certehd certedh certdeh
certdhe cerhted cerhtde cerhetd cerhedt cerhdet cerhdte cerehtd cerehdt cerethd ceretdh
ceredth ceredht cerdhet cerdhte cerdeht cerdeth cerdteh cerdthe cehrted cehrtde cehretd
cehredt cehrdet cehrdte cehtred cehtrde cehterd cehtedr cehtder cehtdre cehetrd cehetdr
cehertd ceherdt cehedrt cehedtr cehdter cehdtre cehdetr cehdert cehdret cehdrte ceerhtd
ceerhdt ceerthd ceertdh ceerdth ceerdht ceehrtd ceehrdt ceehtrd ceehtdr ceehdtr ceehdrt
ceethrd ceethdr ceetrhd ceetrdh ceetdrh ceetdhr ceedhtr ceedhrt ceedthr ceedtrh ceedrth
ceedrht cedrhet cedrhte cedreht cedreth cedrteh cedrthe cedhret cedhrte cedhert cedhetr
cedhter cedhtre cedehrt cedehtr cederht cederth cedetrh cedethr cedther cedthre cedtehr
cedterh cedtreh cedtrhe cterhed cterhde cterehd cteredh cterdeh cterdhe ctehred ctehrde
cteherd ctehedr ctehder ctehdre cteehrd cteehdr cteerhd cteerdh cteedrh cteedhr ctedher
ctedhre ctedehr ctederh ctedreh ctedrhe ctrehed ctrehde ctreehd ctreedh ctredeh ctredhe
ctrheed ctrhede ctrheed ctrhede ctrhdee ctrhdee ctrehed ctrehde ctreehd ctreedh ctredeh
ctredhe ctrdhee ctrdhee ctrdehe ctrdeeh ctrdeeh ctrdehe cthreed cthrede cthreed cthrede
cthrdee cthrdee cthered ctherde ctheerd ctheedr ctheder cthedre ctheerd ctheedr cthered
ctherde cthedre ctheder cthdeer cthdere cthdeer cthdere cthdree cthdree cterhed cterhde
cterehd cteredh cterdeh cterdhe ctehred ctehrde cteherd ctehedr ctehder ctehdre cteehrd
cteehdr cteerhd cteerdh cteedrh cteedhr ctedher ctedhre ctedehr ctederh ctedreh ctedrhe
ctdrhee ctdrhee ctdrehe ctdreeh ctdreeh ctdrehe ctdhree ctdhree ctdhere ctdheer ctdheer
ctdhere ctdehre ctdeher ctderhe ctdereh ctdeerh ctdeehr ctdeher ctdehre ctdeehr ctdeerh
ctdereh ctderhe crtehed crtehde crteehd crteedh crtedeh crtedhe crtheed crthede crtheed
crthede crthdee crthdee crtehed crtehde crteehd crteedh crtedeh crtedhe crtdhee crtdhee
crtdehe crtdeeh crtdeeh crtdehe crethed crethde cretehd cretedh cretdeh cretdhe crehted
crehtde crehetd crehedt crehdet crehdte creehtd creehdt creethd creetdh creedth creedht
credhet credhte credeht credeth credteh credthe crheted crhetde crheetd crheedt crhedet
crhedte crhteed crhtede crhteed crhtede crhtdee crhtdee crheted crhetde crheetd crheedt
crhedet crhedte crhdtee crhdtee crhdete crhdeet crhdeet crhdete creehtd creehdt creethd
creetdh creedth creedht crehetd crehedt crehted crehtde crehdte crehdet crethed crethde
cretehd cretedh cretdeh cretdhe credhte credhet credthe credteh credeth credeht crdehet
crdehte crdeeht crdeeth crdeteh crdethe crdheet crdhete crdheet crdhete crdhtee crdhtee
crdehet crdehte crdeeht crdeeth crdeteh crdethe crdthee crdthee crdtehe crdteeh crdteeh
crdtehe chtreed chtrede chtreed chtrede chtrdee chtrdee chtered chterde chteerd chteedr
chteder chtedre chteerd chteedr chtered chterde chtedre chteder chtdeer chtdere chtdeer
chtdere chtdree chtdree chrteed chrtede chrteed chrtede chrtdee chrtdee chreted chretde
chreetd chreedt chredet chredte chreetd chreedt chreted chretde chredte chredet chrdeet
chrdete chrdeet chrdete chrdtee chrdtee cherted chertde cheretd cheredt cherdet cherdte
chetred chetrde cheterd chetedr chetder chetdre cheetrd cheetdr cheertd cheerdt cheedrt
cheedtr chedter chedtre chedetr chedert chedret chedrte cheretd cheredt cherted chertde
cherdte cherdet cheertd cheerdt cheetrd cheetdr cheedtr cheedrt cheterd chetedr chetred
chetrde chetdre chetder chedetr chedert chedter chedtre chedrte chedret chdreet chdrete
chdreet chdrete chdrtee chdrtee chderet chderte chdeert chdeetr chdeter chdetre chdeert
chdeetr chderet chderte chdetre chdeter chdteer chdtere chdteer chdtere chdtree chdtree
cetrhed cetrhde cetrehd cetredh cetrdeh cetrdhe cethred cethrde cetherd cethedr cethder
cethdre cetehrd cetehdr ceterhd ceterdh cetedrh cetedhr cetdher cetdhre cetdehr cetderh
cetdreh cetdrhe certhed certhde certehd certedh certdeh certdhe cerhted cerhtde cerhetd
cerhedt cerhdet cerhdte cerehtd cerehdt cerethd ceretdh ceredth ceredht cerdhet cerdhte
cerdeht cerdeth cerdteh cerdthe cehrted cehrtde cehretd cehredt cehrdet cehrdte cehtred
cehtrde cehterd cehtedr cehtder cehtdre cehetrd cehetdr cehertd ceherdt cehedrt cehedtr
cehdter cehdtre cehdetr cehdert cehdret cehdrte ceerhtd ceerhdt ceerthd ceertdh ceerdth
ceerdht ceehrtd ceehrdt ceehtrd ceehtdr ceehdtr ceehdrt ceethrd ceethdr ceetrhd ceetrdh
ceetdrh ceetdhr ceedhtr ceedhrt ceedthr ceedtrh ceedrth ceedrht cedrhet cedrhte cedreht
cedreth cedrteh cedrthe cedhret cedhrte cedhert cedhetr cedhter cedhtre cedehrt cedehtr
cederht cederth cedetrh cedethr cedther cedthre cedtehr cedterh cedtreh cedtrhe cdtrhee
cdtrhee cdtrehe cdtreeh cdtreeh cdtrehe cdthree cdthree cdthere cdtheer cdtheer cdthere
cdtehre cdteher cdterhe cdtereh cdteerh cdteehr cdteher cdtehre cdteehr cdteerh cdtereh
cdterhe cdrthee cdrthee cdrtehe cdrteeh cdrteeh cdrtehe cdrhtee cdrhtee cdrhete cdrheet
cdrheet cdrhete cdrehte cdrehet cdrethe cdreteh cdreeth cdreeht cdrehet cdrehte cdreeht
cdreeth cdreteh cdrethe cdhrtee cdhrtee cdhrete cdhreet cdhreet cdhrete cdhtree cdhtree
cdhtere cdhteer cdhteer cdhtere cdhetre cdheter cdherte cdheret cdheert cdheetr cdheter
cdhetre cdheetr cdheert cdheret cdherte cderhte cderhet cderthe cderteh cdereth cdereht
cdehrte cdehret cdehtre cdehter cdehetr cdehert cdethre cdether cdetrhe cdetreh cdeterh
cdetehr cdeehtr cdeehrt cdeethr cdeetrh cdeerth cdeerht cderhet cderhte cdereht cdereth
cderteh cderthe cdehret cdehrte cdehert cdehetr cdehter cdehtre cdeehrt cdeehtr cdeerht
cdeerth cdeetrh cdeethr cdether cdethre cdetehr cdeterh cdetreh cdetrhe hetcred hetcrde
hetcerd hetcedr hetcder hetcdre hetrced hetrcde hetrecd hetredc hetrdec hetrdce hetercd
heterdc hetecrd hetecdr hetedcr hetedrc hetdrec hetdrce hetderc hetdecr hetdcer hetdcre
hectred hectrde hecterd hectedr hectder hectdre hecrted hecrtde hecretd hecredt hecrdet
hecrdte hecertd hecerdt hecetrd hecetdr hecedtr hecedrt hecdret hecdrte hecdert hecdetr
hecdter hecdtre hercted herctde hercetd hercedt hercdet hercdte hertced hertcde hertecd
hertedc hertdec hertdce heretcd heretdc herectd herecdt heredct heredtc herdtec herdtce
herdetc herdect herdcet herdcte heecrtd heecrdt heectrd heectdr heecdtr heecdrt heerctd
heercdt heertcd heertdc heerdtc heerdct heetrcd heetrdc heetcrd heetcdr heetdcr heetdrc
heedrtc heedrct heedtrc heedtcr heedctr heedcrt hedcret hedcrte hedcert hedcetr hedcter
hedctre hedrcet hedrcte hedrect hedretc hedrtec hedrtce hederct hedertc hedecrt hedectr
hedetcr hedetrc hedtrec hedtrce hedterc hedtecr hedtcer hedtcre htecred htecrde htecerd
htecedr htecder htecdre hterced htercde hterecd hteredc hterdec hterdce hteercd hteerdc
hteecrd hteecdr hteedcr hteedrc htedrec htedrce htederc htedecr htedcer htedcre htcered
htcerde htceerd htceedr htceder htcedre htcreed htcrede htcreed htcrede htcrdee htcrdee
htcered htcerde htceerd htceedr htceder htcedre htcdree htcdree htcdere htcdeer htcdeer
htcdere htrceed htrcede htrceed htrcede htrcdee htrcdee htreced htrecde htreecd htreedc
htredec htredce htreecd htreedc htreced htrecde htredce htredec htrdeec htrdece htrdeec
htrdece htrdcee htrdcee htecred htecrde htecerd htecedr htecder htecdre hterced htercde
hterecd hteredc hterdec hterdce hteercd hteerdc hteecrd hteecdr hteedcr hteedrc htedrec
htedrce htederc htedecr htedcer htedcre htdcree htdcree htdcere htdceer htdceer htdcere
htdrcee htdrcee htdrece htdreec htdreec htdrece htderce htderec htdecre htdecer htdeecr
htdeerc htderec htderce htdeerc htdeecr htdecer htdecre hctered hcterde hcteerd hcteedr
hcteder hctedre hctreed hctrede hctreed hctrede hctrdee hctrdee hctered hcterde hcteerd
hcteedr hcteder hctedre hctdree hctdree hctdere hctdeer hctdeer hctdere hcetred hcetrde
hceterd hcetedr hcetder hcetdre hcerted hcertde hceretd hceredt hcerdet hcerdte hceertd
hceerdt hceetrd hceetdr hceedtr hceedrt hcedret hcedrte hcedert hcedetr hcedter hcedtre
hcreted hcretde hcreetd hcreedt hcredet hcredte hcrteed hcrtede hcrteed hcrtede hcrtdee
hcrtdee hcreted hcretde hcreetd hcreedt hcredet hcredte hcrdtee hcrdtee hcrdete hcrdeet
hcrdeet hcrdete hceertd hceerdt hceetrd hceetdr hceedtr hceedrt hceretd hceredt hcerted
hcertde hcerdte hcerdet hcetred hcetrde hceterd hcetedr hcetder hcetdre hcedrte hcedret
hcedtre hcedter hcedetr hcedert hcderet hcderte hcdeert hcdeetr hcdeter hcdetre hcdreet
hcdrete hcdreet hcdrete hcdrtee hcdrtee hcderet hcderte hcdeert hcdeetr hcdeter hcdetre
hcdtree hcdtree hcdtere hcdteer hcdteer hcdtere hrtceed hrtcede hrtceed hrtcede hrtcdee
hrtcdee hrteced hrtecde hrteecd hrteedc hrtedec hrtedce hrteecd hrteedc hrteced hrtecde
hrtedce hrtedec hrtdeec hrtdece hrtdeec hrtdece hrtdcee hrtdcee hrcteed hrctede hrcteed
hrctede hrctdee hrctdee hrceted hrcetde hrceetd hrceedt hrcedet hrcedte hrceetd hrceedt
hrceted hrcetde hrcedte hrcedet hrcdeet hrcdete hrcdeet hrcdete hrcdtee hrcdtee hrected
hrectde hrecetd hrecedt hrecdet hrecdte hretced hretcde hretecd hretedc hretdec hretdce
hreetcd hreetdc hreectd hreecdt hreedct hreedtc hredtec hredtce hredetc hredect hredcet
hredcte hrecetd hrecedt hrected hrectde hrecdte hrecdet hreectd hreecdt hreetcd hreetdc
hreedtc hreedct hretecd hretedc hretced hretcde hretdce hretdec hredetc hredect hredtec
hredtce hredcte hredcet hrdceet hrdcete hrdceet hrdcete hrdctee hrdctee hrdecet hrdecte
hrdeect hrdeetc hrdetec hrdetce hrdeect hrdeetc hrdecet hrdecte hrdetce hrdetec hrdteec
hrdtece hrdteec hrdtece hrdtcee hrdtcee hetcred hetcrde hetcerd hetcedr hetcder hetcdre
hetrced hetrcde hetrecd hetredc hetrdec hetrdce hetercd heterdc hetecrd hetecdr hetedcr
hetedrc hetdrec hetdrce hetderc hetdecr hetdcer hetdcre hectred hectrde hecterd hectedr
hectder hectdre hecrted hecrtde hecretd hecredt hecrdet hecrdte hecertd hecerdt hecetrd
hecetdr hecedtr hecedrt hecdret hecdrte hecdert hecdetr hecdter hecdtre hercted herctde
hercetd hercedt hercdet hercdte hertced hertcde hertecd hertedc hertdec hertdce heretcd
heretdc herectd herecdt heredct heredtc herdtec herdtce herdetc herdect herdcet herdcte
heecrtd heecrdt heectrd heectdr heecdtr heecdrt heerctd heercdt heertcd heertdc heerdtc
heerdct heetrcd heetrdc heetcrd heetcdr heetdcr heetdrc heedrtc heedrct heedtrc heedtcr
heedctr heedcrt hedcret hedcrte hedcert hedcetr hedcter hedctre hedrcet hedrcte hedrect
hedretc hedrtec hedrtce hederct hedertc hedecrt hedectr hedetcr hedetrc hedtrec hedtrce
hedterc hedtecr hedtcer hedtcre hdtcree hdtcree hdtcere hdtceer hdtceer hdtcere hdtrcee
hdtrcee hdtrece hdtreec hdtreec hdtrece hdterce hdterec hdtecre hdtecer hdteecr hdteerc
hdterec hdterce hdteerc hdteecr hdtecer hdtecre hdctree hdctree hdctere hdcteer hdcteer
hdctere hdcrtee hdcrtee hdcrete hdcreet hdcreet hdcrete hdcerte hdceret hdcetre hdceter
hdceetr hdceert hdceret hdcerte hdceert hdceetr hdceter hdcetre hdrctee hdrctee hdrcete
hdrceet hdrceet hdrcete hdrtcee hdrtcee hdrtece hdrteec hdrteec hdrtece hdretce hdretec
hdrecte hdrecet hdreect hdreetc hdretec hdretce hdreetc hdreect hdrecet hdrecte hdecrte
hdecret hdectre hdecter hdecetr hdecert hdercte hdercet hdertce hdertec hderetc hderect
hdetrce hdetrec hdetcre hdetcer hdetecr hdeterc hdeertc hdeerct hdeetrc hdeetcr hdeectr
hdeecrt hdecret hdecrte hdecert hdecetr hdecter hdectre hdercet hdercte hderect hderetc
hdertec hdertce hdeerct hdeertc hdeecrt hdeectr hdeetcr hdeetrc hdetrec hdetrce hdeterc
hdetecr hdetcer hdetcre eetchrd eetchdr eetcrhd eetcrdh eetcdrh eetcdhr eethcrd eethcdr
eethrcd eethrdc eethdrc eethdcr eetrhcd eetrhdc eetrchd eetrcdh eetrdch eetrdhc eetdhrc
eetdhcr eetdrhc eetdrch eetdcrh eetdchr eecthrd eecthdr eectrhd eectrdh eectdrh eectdhr
eechtrd eechtdr eechrtd eechrdt eechdrt eechdtr eecrhtd eecrhdt eecrthd eecrtdh eecrdth
eecrdht eecdhrt eecdhtr eecdrht eecdrth eecdtrh eecdthr eehctrd eehctdr eehcrtd eehcrdt
eehcdrt eehcdtr eehtcrd eehtcdr eehtrcd eehtrdc eehtdrc eehtdcr eehrtcd eehrtdc eehrctd
eehrcdt eehrdct eehrdtc eehdtrc eehdtcr eehdrtc eehdrct eehdcrt eehdctr eerchtd eerchdt
eercthd eerctdh eercdth eercdht eerhctd eerhcdt eerhtcd eerhtdc eerhdtc eerhdct eerthcd
eerthdc eertchd eertcdh eertdch eertdhc eerdhtc eerdhct eerdthc eerdtch eerdcth eerdcht
eedchrt eedchtr eedcrht eedcrth eedctrh eedcthr eedhcrt eedhctr eedhrct eedhrtc eedhtrc
eedhtcr eedrhct eedrhtc eedrcht eedrcth eedrtch eedrthc eedthrc eedthcr eedtrhc eedtrch
eedtcrh eedtchr etechrd etechdr etecrhd etecrdh etecdrh etecdhr etehcrd etehcdr etehrcd
etehrdc etehdrc etehdcr eterhcd eterhdc eterchd etercdh eterdch eterdhc etedhrc etedhcr
etedrhc etedrch etedcrh etedchr etcehrd etcehdr etcerhd etcerdh etcedrh etcedhr etcherd
etchedr etchred etchrde etchdre etchder etcrhed etcrhde etcrehd etcredh etcrdeh etcrdhe
etcdhre etcdher etcdrhe etcdreh etcderh etcdehr ethcerd ethcedr ethcred ethcrde ethcdre
ethcder ethecrd ethecdr ethercd etherdc ethedrc ethedcr ethrecd ethredc ethrced ethrcde
ethrdce ethrdec ethderc ethdecr ethdrec ethdrce ethdcre ethdcer etrched etrchde etrcehd
etrcedh etrcdeh etrcdhe etrhced etrhcde etrhecd etrhedc etrhdec etrhdce etrehcd etrehdc
etrechd etrecdh etredch etredhc etrdhec etrdhce etrdehc etrdech etrdceh etrdche etdchre
etdcher etdcrhe etdcreh etdcerh etdcehr etdhcre etdhcer etdhrce etdhrec etdherc etdhecr
etdrhce etdrhec etdrche etdrceh etdrech etdrehc etdehrc etdehcr etderhc etderch etdecrh
etdechr ectehrd ectehdr ecterhd ecterdh ectedrh ectedhr ectherd ecthedr ecthred ecthrde
ecthdre ecthder ectrhed ectrhde ectrehd ectredh ectrdeh ectrdhe ectdhre ectdher ectdrhe
ectdreh ectderh ectdehr ecethrd ecethdr ecetrhd ecetrdh ecetdrh ecetdhr ecehtrd ecehtdr
ecehrtd ecehrdt ecehdrt ecehdtr ecerhtd ecerhdt ecerthd ecertdh ecerdth ecerdht ecedhrt
ecedhtr ecedrht ecedrth ecedtrh ecedthr echetrd echetdr echertd echerdt echedrt echedtr
echterd echtedr echtred echtrde echtdre echtder echrted echrtde echretd echredt echrdet
echrdte echdtre echdter echdrte echdret echdert echdetr ecrehtd ecrehdt ecrethd ecretdh
ecredth ecredht ecrhetd ecrhedt ecrhted ecrhtde ecrhdte ecrhdet ecrthed ecrthde ecrtehd
ecrtedh ecrtdeh ecrtdhe ecrdhte ecrdhet ecrdthe ecrdteh ecrdeth ecrdeht ecdehrt ecdehtr
ecderht ecderth ecdetrh ecdethr ecdhert ecdhetr ecdhret ecdhrte ecdhtre ecdhter ecdrhet
ecdrhte ecdreht ecdreth ecdrteh ecdrthe ecdthre ecdther ecdtrhe ecdtreh ecdterh ecdtehr
ehtcerd ehtcedr ehtcred ehtcrde ehtcdre ehtcder ehtecrd ehtecdr ehtercd ehterdc ehtedrc
ehtedcr ehtrecd ehtredc ehtrced ehtrcde ehtrdce ehtrdec ehtderc ehtdecr ehtdrec ehtdrce
ehtdcre ehtdcer ehcterd ehctedr ehctred ehctrde ehctdre ehctder ehcetrd ehcetdr ehcertd
ehcerdt ehcedrt ehcedtr ehcretd ehcredt ehcrted ehcrtde ehcrdte ehcrdet ehcdert ehcdetr
ehcdret ehcdrte ehcdtre ehcdter ehectrd ehectdr ehecrtd ehecrdt ehecdrt ehecdtr ehetcrd
ehetcdr ehetrcd ehetrdc ehetdrc ehetdcr ehertcd ehertdc eherctd ehercdt eherdct eherdtc
ehedtrc ehedtcr ehedrtc ehedrct ehedcrt ehedctr ehrcetd ehrcedt ehrcted ehrctde ehrcdte
ehrcdet ehrectd ehrecdt ehretcd ehretdc ehredtc ehredct ehrtecd ehrtedc ehrtced ehrtcde
ehrtdce ehrtdec ehrdetc ehrdect ehrdtec ehrdtce ehrdcte ehrdcet ehdcert ehdcetr ehdcret
ehdcrte ehdctre ehdcter ehdecrt ehdectr ehderct ehdertc ehdetrc ehdetcr ehdrect ehdretc
ehdrcet ehdrcte ehdrtce ehdrtec ehdterc ehdtecr ehdtrec ehdtrce ehdtcre ehdtcer ertched
ertchde ertcehd ertcedh ertcdeh ertcdhe erthced erthcde erthecd erthedc erthdec erthdce
ertehcd ertehdc ertechd ertecdh ertedch ertedhc ertdhec ertdhce ertdehc ertdech ertdceh
ertdche ercthed ercthde erctehd erctedh erctdeh erctdhe erchted erchtde erchetd erchedt
erchdet erchdte ercehtd ercehdt ercethd ercetdh ercedth ercedht ercdhet ercdhte ercdeht
ercdeth ercdteh ercdthe erhcted erhctde erhcetd erhcedt erhcdet erhcdte erhtced erhtcde
erhtecd erhtedc erhtdec erhtdce erhetcd erhetdc erhectd erhecdt erhedct erhedtc erhdtec
erhdtce erhdetc erhdect erhdcet erhdcte erechtd erechdt erecthd erectdh erecdth erecdht
erehctd erehcdt erehtcd erehtdc erehdtc erehdct erethcd erethdc eretchd eretcdh eretdch
eretdhc eredhtc eredhct eredthc eredtch eredcth eredcht erdchet erdchte erdceht erdceth
erdcteh erdcthe erdhcet erdhcte erdhect erdhetc erdhtec erdhtce erdehct erdehtc erdecht
erdecth erdetch erdethc erdthec erdthce erdtehc erdtech erdtceh erdtche edtchre edtcher
edtcrhe edtcreh edtcerh edtcehr edthcre edthcer edthrce edthrec edtherc edthecr edtrhce
edtrhec edtrche edtrceh edtrech edtrehc edtehrc edtehcr edterhc edterch edtecrh edtechr
edcthre edcther edctrhe edctreh edcterh edctehr edchtre edchter edchrte edchret edchert
edchetr edcrhte edcrhet edcrthe edcrteh edcreth edcreht edcehrt edcehtr edcerht edcerth
edcetrh edcethr edhctre edhcter edhcrte edhcret edhcert edhcetr edhtcre edhtcer edhtrce
edhtrec edhterc edhtecr edhrtce edhrtec edhrcte edhrcet edhrect edhretc edhetrc edhetcr
edhertc edherct edhecrt edhectr edrchte edrchet edrcthe edrcteh edrceth edrceht edrhcte
edrhcet edrhtce edrhtec edrhetc edrhect edrthce edrthec edrtche edrtceh edrtech edrtehc
edrehtc edrehct edrethc edretch edrecth edrecht edechrt edechtr edecrht edecrth edectrh
edecthr edehcrt edehctr edehrct edehrtc edehtrc edehtcr ederhct ederhtc edercht edercth
edertch ederthc edethrc edethcr edetrhc edetrch edetcrh edetchr detcher detchre detcehr
detcerh detcreh detcrhe dethcer dethcre dethecr detherc dethrec dethrce detehcr detehrc
detechr detecrh deterch deterhc detrhec detrhce detrehc detrech detrceh detrche decther
decthre dectehr decterh dectreh dectrhe dechter dechtre dechetr dechert dechret dechrte
decehtr decehrt decethr decetrh decerth decerht decrhet decrhte decreht decreth decrteh
decrthe dehcter dehctre dehcetr dehcert dehcret dehcrte dehtcer dehtcre dehtecr dehterc
dehtrec dehtrce dehetcr dehetrc dehectr dehecrt deherct dehertc dehrtec dehrtce dehretc
dehrect dehrcet dehrcte deechtr deechrt deecthr deectrh deecrth deecrht deehctr deehcrt
deehtcr deehtrc deehrtc deehrct deethcr deethrc deetchr deetcrh deetrch deetrhc deerhtc
deerhct deerthc deertch deercth deercht derchet derchte derceht derceth dercteh dercthe
derhcet derhcte derhect derhetc derhtec derhtce derehct derehtc derecht derecth deretch
derethc derthec derthce dertehc dertech dertceh dertche dtecher dtechre dtecehr dtecerh
dtecreh dtecrhe dtehcer dtehcre dtehecr dteherc dtehrec dtehrce dteehcr dteehrc dteechr
dteecrh dteerch dteerhc dterhec dterhce dterehc dterech dterceh dterche dtceher dtcehre
dtceehr dtceerh dtcereh dtcerhe dtcheer dtchere dtcheer dtchere dtchree dtchree dtceher
dtcehre dtceehr dtceerh dtcereh dtcerhe dtcrhee dtcrhee dtcrehe dtcreeh dtcreeh dtcrehe
dthceer dthcere dthceer dthcere dthcree dthcree dthecer dthecre dtheecr dtheerc dtherec
dtherce dtheecr dtheerc dthecer dthecre dtherce dtherec dthreec dthrece dthreec dthrece
dthrcee dthrcee dtecher dtechre dtecehr dtecerh dtecreh dtecrhe dtehcer dtehcre dtehecr
dteherc dtehrec dtehrce dteehcr dteehrc dteechr dteecrh dteerch dteerhc dterhec dterhce
dterehc dterech dterceh dterche dtrchee dtrchee dtrcehe dtrceeh dtrceeh dtrcehe dtrhcee
dtrhcee dtrhece dtrheec dtrheec dtrhece dtrehce dtrehec dtreche dtreceh dtreech dtreehc
dtrehec dtrehce dtreehc dtreech dtreceh dtreche dcteher dctehre dcteehr dcteerh dctereh
dcterhe dctheer dcthere dctheer dcthere dcthree dcthree dcteher dctehre dcteehr dcteerh
dctereh dcterhe dctrhee dctrhee dctrehe dctreeh dctreeh dctrehe dcether dcethre dcetehr
dceterh dcetreh dcetrhe dcehter dcehtre dcehetr dcehert dcehret dcehrte dceehtr dceehrt
dceethr dceetrh dceerth dceerht dcerhet dcerhte dcereht dcereth dcerteh dcerthe dcheter
dchetre dcheetr dcheert dcheret dcherte dchteer dchtere dchteer dchtere dchtree dchtree
dcheter dchetre dcheetr dcheert dcheret dcherte dchrtee dchrtee dchrete dchreet dchreet
dchrete dceehtr dceehrt dceethr dceetrh dceerth dceerht dcehetr dcehert dcehter dcehtre
dcehrte dcehret dcether dcethre dcetehr dceterh dcetreh dcetrhe dcerhte dcerhet dcerthe
dcerteh dcereth dcereht dcrehet dcrehte dcreeht dcreeth dcreteh dcrethe dcrheet dcrhete
dcrheet dcrhete dcrhtee dcrhtee dcrehet dcrehte dcreeht dcreeth dcreteh dcrethe dcrthee
dcrthee dcrtehe dcrteeh dcrteeh dcrtehe dhtceer dhtcere dhtceer dhtcere dhtcree dhtcree
dhtecer dhtecre dhteecr dhteerc dhterec dhterce dhteecr dhteerc dhtecer dhtecre dhterce
dhterec dhtreec dhtrece dhtreec dhtrece dhtrcee dhtrcee dhcteer dhctere dhcteer dhctere
dhctree dhctree dhceter dhcetre dhceetr dhceert dhceret dhcerte dhceetr dhceert dhceter
dhcetre dhcerte dhceret dhcreet dhcrete dhcreet dhcrete dhcrtee dhcrtee dhecter dhectre
dhecetr dhecert dhecret dhecrte dhetcer dhetcre dhetecr dheterc dhetrec dhetrce dheetcr
dheetrc dheectr dheecrt dheerct dheertc dhertec dhertce dheretc dherect dhercet dhercte
dhecetr dhecert dhecter dhectre dhecrte dhecret dheectr dheecrt dheetcr dheetrc dheertc
dheerct dhetecr dheterc dhetcer dhetcre dhetrce dhetrec dheretc dherect dhertec dhertce
dhercte dhercet dhrceet dhrcete dhrceet dhrcete dhrctee dhrctee dhrecet dhrecte dhreect
dhreetc dhretec dhretce dhreect dhreetc dhrecet dhrecte dhretce dhretec dhrteec dhrtece
dhrteec dhrtece dhrtcee dhrtcee detcher detchre detcehr detcerh detcreh detcrhe dethcer
dethcre dethecr detherc dethrec dethrce detehcr detehrc detechr detecrh deterch deterhc
detrhec detrhce detrehc detrech detrceh detrche decther decthre dectehr decterh dectreh
dectrhe dechter dechtre dechetr dechert dechret dechrte decehtr decehrt decethr decetrh
decerth decerht decrhet decrhte decreht decreth decrteh decrthe dehcter dehctre dehcetr
dehcert dehcret dehcrte dehtcer dehtcre dehtecr dehterc dehtrec dehtrce dehetcr dehetrc
dehectr dehecrt deherct dehertc dehrtec dehrtce dehretc dehrect dehrcet dehrcte deechtr
deechrt deecthr deectrh deecrth deecrht deehctr deehcrt deehtcr deehtrc deehrtc deehrct
deethcr deethrc deetchr deetcrh deetrch deetrhc deerhtc deerhct deerthc deertch deercth
deercht derchet derchte derceht derceth dercteh dercthe derhcet derhcte derhect derhetc
derhtec derhtce derehct derehtc derecht derecth deretch derethc derthec derthce dertehc
dertech dertceh dertche drtchee drtchee drtcehe drtceeh drtceeh drtcehe drthcee drthcee
drthece drtheec drtheec drthece drtehce drtehec drteche drteceh drteech drteehc drtehec
drtehce drteehc drteech drteceh drteche drcthee drcthee drctehe drcteeh drcteeh drctehe
drchtee drchtee drchete drcheet drcheet drchete drcehte drcehet drcethe drceteh drceeth
drceeht drcehet drcehte drceeht drceeth drceteh drcethe drhctee drhctee drhcete drhceet
drhceet drhcete drhtcee drhtcee drhtece drhteec drhteec drhtece drhetce drhetec drhecte
drhecet drheect drheetc drhetec drhetce drheetc drheect drhecet drhecte drechte drechet
drecthe drecteh dreceth dreceht drehcte drehcet drehtce drehtec drehetc drehect drethce
drethec dretche dretceh dretech dretehc dreehtc dreehct dreethc dreetch dreecth dreecht
drechet drechte dreceht dreceth drecteh drecthe drehcet drehcte drehect drehetc drehtec
drehtce dreehct dreehtc dreecht dreecth dreetch dreethc drethec drethce dretehc dretech
dretceh dretche

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us