easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

hamletmaschin

glossers

manoeuvred

paravistique

orthostyle

eripuerintque

jtinkler

contortionistic

surgeproof

exaggeratedly

molahlehi

coolheadedly

portusve

accetta

presencia

khedas

unaccompanie

sequebar


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: resurgentumque
cipher variations:
sftvshfouvnrvf tguwtigpvwoswg uhvxujhqwxptxh viwyvkirxyquyi wjxzwljsyzrvzj
xkyaxmktzaswak ylzbynluabtxbl zmaczomvbcuycm anbdapnwcdvzdn bocebqoxdewaeo
cpdfcrpyefxbfp dqegdsqzfgycgq erfhetraghzdhr fsgifusbhiaeis gthjgvtcijbfjt
huikhwudjkcgku ivjlixvekldhlv jwkmjywflmeimw kxlnkzxgmnfjnx lymolayhnogkoy
mznpmbziophlpz naoqncajpqimqa obprodbkqrjnrb pcqspeclrskosc qdrtqfdmstlptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: resurgentumque
Cipher: ivhfitvmgfnjfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: resurgentumque
Cipher: BAAAA AABAA BAAAB BAABB BAAAA AABBA AABAA ABBAA BAABA BAABB ABABB ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: resurgentumque
cipher variations:
sftvshfouvnrvfandjatnogjlxjnivnxifvosxjdxvqdxlqrdoelhjldylhzydloqzfpzlgtrngptocndvntwjlpwnjoapzhpjervdezromdxndr
mzfrmlzoyrvtrzuhpfuxhokftzfhcpztcjpowtrftpkxjhkvxoihplhxtguwtigpvwoswgboekbuophkmykojwoyjgwptykeywreymrsepfmikme
zmiazempragqamhusohqupdoewouxkmqxokpbqaiqkfswefaspneyoesnagsnmapzswusaviqgvyiplguagidqaudkqpxusguqlykilwypjiqmiy
uhvxujhqwxptxhcpflcvpqilnzlpkxpzkhxquzlfzxsfznstfqgnjlnfanjbafnqsbhrbnivtpirvqepfxpvylnryplqcrbjrlgtxfgbtqofzpft
obhtonbqatxvtbwjrhwzjqmhvbhjerbvelrqyvthvrmzljmxzqkjrnjzviwyvkirxyquyidqgmdwqrjmoamqlyqaliyrvamgaytgaotugrhokmog
bokcbgortciscojwuqjswrfqgyqwzmoszqmrdscksmhuyghcurpgaqgupciupocrbuywucxksixakrniwcikfscwfmsrzwuiwsnamknyarlksoka
wjxzwljsyzrvzjerhnexrsknpbnrmzrbmjzswbnhbzuhbpuvhsiplnphcpldchpsudjtdpkxvrktxsgrhzrxanptarnsetdltnivzhidvsqhbrhv
qdjvqpdscvzxvdyltjyblsojxdjlgtdxgntsaxvjxtobnlozbsmltplbxkyaxmktzaswakfsiofystloqcosnascnkatxcoicavicqvwitjqmoqi
dqmediqtvekueqlywsluythsiasyboqubsotfuemuojwaijewtricsiwrekwrqetdwaywezmukzcmtpkyekmhueyhoutbywkyupcompactnmuqmc
ylzbynluabtxblgtjpgztumprdptobtdolbuydpjdbwjdrwxjukrnprjernfejruwflvfrmzxtmvzuitjbtzcprvctpugvfnvpkxbjkfxusjdtjx
sflxsrfuexbzxfanvladnuqlzflnivfzipvuczxlzvqdpnqbduonvrndzmaczomvbcuycmhukqhauvnqsequpcuepmcvzeqkecxkesxykvlsoqsk
fsogfksvxgmwgsnayunwavjukcuadqswduqvhwgowqlycklgyvtkeukytgmytsgvfycaygbowmbeovrmagmojwgajqwvdaymawreqorcevpowsoe
anbdapnwcdvzdnivlribvwortfrvqdvfqndwafrlfdylftyzlwmtprtlgtphgltwyhnxhtobzvoxbwkvldvbertxevrwixhpxrmzdlmhzwulfvlz
uhnzuthwgzdbzhcpxncfpwsnbhnpkxhbkrxwebznbxsfrpsdfwqpxtpfbocebqoxdewaeojwmsjcwxpsugswrewgroexbgsmgezmguzamxnuqsum
huqihmuxzioyiupcawpycxlwmewcfsuyfwsxjyiqysnaemniaxvmgwmavioavuixhaecaidqyodgqxtocioqlyiclsyxfcaocytgsqtegxrqyuqg
cpdfcrpyefxbfpkxntkdxyqtvhtxsfxhspfychtnhfanhvabnyovrtvnivrjinvyajpzjvqdbxqzdymxnfxdgtvzgxtykzjrztobfnojbywnhxnb
wjpbwvjyibfdbjerzpehryupdjprmzjdmtzygdbpdzuhtrufhysrzvrhdqegdsqzfgycgqlyouleyzruwiuytgyitqgzdiuoigboiwbcozpwsuwo
jwskjowzbkqakwrecyraeznyogyehuwahyuzlaksaupcgopkczxoiyocxkqcxwkzjcgeckfsaqfiszvqekqsnakenuazhecqeaviusvgiztsawsi
erfhetraghzdhrmzpvmfzasvxjvzuhzjurhaejvpjhcpjxcdpaqxtvxpkxtlkpxaclrblxsfdzsbfaozphzfivxbizvambltbvqdhpqldaypjzpd
ylrdyxlakdhfdlgtbrgjtawrflrtoblfovbaifdrfbwjvtwhjautbxtjfsgifusbhiaeisnaqwngabtwykwaviakvsibfkwqkidqkydeqbryuwyq
lyumlqybdmscmytgeatcgbpaqiagjwycjawbncmucwreiqrmebzqkaqezmsezymbleigemhucshkubxsgmsupcmgpwcbjgesgcxkwuxikbvucyuk
gthjgvtcijbfjtobrxohbcuxzlxbwjblwtjcglxrljerlzefrcszvxzrmzvnmrzcentdnzuhfbudhcqbrjbhkxzdkbxcodnvdxsfjrsnfcarlbrf
antfazncmfjhfnivdtilvcythntvqdnhqxdckhfthdylxvyjlcwvdzvlhuikhwudjkcgkupcsypicdvyamycxkcmxukdhmysmkfsmafgsdtawyas
nawonsadfoueoavigcveidrcskcilyaelcydpeoweytgkstogdbsmcsgbougbaodngkigojweujmwdzuiouwreoiryedliguiezmywzkmdxweawm
ivjlixvekldhlvqdtzqjdewzbnzdyldnyvleinztnlgtnbghteubxzbtobxpotbegpvfpbwjhdwfjesdtldjmzbfmdzeqfpxfzuhltuphectndth
cpvhcbpeohljhpkxfvknxeavjpvxsfpjszfemjhvjfanzxalneyxfbxnjwkmjywflmeimwreuarkefxacoaezmeozwmfjoauomhuochiufvcyacu
pcyqpucfhqwgqcxkiexgkfteumeknacgneafrgqygavimuvqifduoeuidqwidcqfpimkiqlygwloyfbwkqwytgqktagfnkiwkgboaybmofzygcyo
kxlnkzxgmnfjnxsfvbslfgybdpbfanfpaxngkpbvpnivpdijvgwdzbdvqdzrqvdgirxhrdyljfyhlgufvnflobdhofbgshrzhbwjnvwrjgevpfvj
erxjedrgqjnljrmzhxmpzgcxlrxzuhrlubhgoljxlhcpbzcnpgazhdzplymolayhnogkoytgwctmghzceqcgbogqbyohlqcwqojwqejkwhxeacew
reasrwehjsyisezmkgzimhvgwogmpceipgchtisaicxkowxskhfwqgwkfsykfeshrkomksnaiynqahdymsyavismvcihpmkymidqcadoqhbaieaq
mznpmbziophlpzuhxdunhiadfrdhcphrczpimrdxrpkxrfklxiyfbdfxsfbtsxfiktzjtfanlhajniwhxphnqdfjqhdiujtbjdylpxytligxrhxl
gtzlgftislpnltobjzorbiezntzbwjtnwdjiqnlznjerdbepricbjfbrnaoqncajpqimqaviyevoijbegseidqisdaqjnseysqlysglmyjzgcegy
tgcutygjluakugbomibkojxiyqioregkriejvkuckezmqyzumjhysiymhuamhgujtmqomupckapscjfaouacxkuoxekjromaokfsecfqsjdckgcs
obprodbkqrjnrbwjzfwpjkcfhtfjerjtebrkotfztrmzthmnzkahdfhzuhdvuzhkmvblvhcpnjclpkyjzrjpsfhlsjfkwlvdlfanrzavnkiztjzn
ivbnihvkunrpnvqdlbqtdkgbpvbdylvpyflkspnbplgtfdgrtkedlhdtpcqspeclrskoscxkagxqkldgiugkfskufcslpugausnauinoalbiegia
viewvailnwcmwidqokdmqlzkaskqtgimtkglxmwemgbosabwoljaukaojwcojiwlvosqowremcruelhcqwcezmwqzgmltqocqmhugehsulfemieu
qdrtqfdmstlptdylbhyrlmehjvhlgtlvgdtmqvhbvtobvjopbmcjfhjbwjfxwbjmoxdnxjerplenrmalbtlruhjnulhmynxfnhcptbcxpmkbvlbp
kxdpkjxmwptrpxsfndsvfmidrxdfanxrahnmurpdrnivhfitvmgfnjfvresurgentumquezmcizsmnfikwimhumwheunrwicwupcwkpqcndkgikc
xkgyxcknpyeoykfsqmfosnbmcumsvikovminzoygoidqucdyqnlcwmcqlyeqlkynxqusqytgoetwgnjesyegboysbionvsqesojwigjuwnhgokgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: resurgentumque
Cipher: erfhetraghzdhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: resurgentumque
Cipher: 2451345424225133445423145451

Extended Methods:
Method #1

Plaintext: resurgentumque
method variations:
wkxzwmksyzrvzkbpcebrpxdewaepguhkgwucikbfkumznpmbzhopglpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
r e s u r g e n t u m q u e 
2 5 3 5 2 2 5 3 4 5 2 1 5 5 
4 1 4 4 4 2 1 3 4 4 3 4 4 1 
They are then read out in rows:
2535225345215541444213443441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: resurgentumque
Cipher: wxgpybzdtiltsd

Read more ...
Method #3

Plaintext: resurgentumque
method variations:
ylyiiwlsyicyyf lyiiwlsyicyyfy yiiwlsyicyyfyl
iiwlsyicyyfyly iwlsyicyyfylyi wlsyicyyfylyii
lsyicyyfylyiiw syicyyfylyiiwl yicyyfylyiiwls
icyyfylyiiwlsy cyyfylyiiwlsyi yyfylyiiwlsyic
yfylyiiwlsyicy fylyiiwlsyicyy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: resurgentumque

first 5040 cipher variations(86661001946 total)
resurgentumque resurgentumqeu resurgentumuqe resurgentumueq resurgentumeuq resurgentumequ resurgentuqmue resurgentuqmeu
resurgentuqume resurgentuquem resurgentuqeum resurgentuqemu resurgentuuqme resurgentuuqem resurgentuumqe resurgentuumeq
resurgentuuemq resurgentuueqm resurgentuequm resurgentueqmu resurgentueuqm resurgentueumq resurgentuemuq resurgentuemqu
resurgentmuque resurgentmuqeu resurgentmuuqe resurgentmuueq resurgentmueuq resurgentmuequ resurgentmquue resurgentmqueu
resurgentmquue resurgentmqueu resurgentmqeuu resurgentmqeuu resurgentmuque resurgentmuqeu resurgentmuuqe resurgentmuueq
resurgentmueuq resurgentmuequ resurgentmequu resurgentmequu resurgentmeuqu resurgentmeuuq resurgentmeuuq resurgentmeuqu
resurgentqmuue resurgentqmueu resurgentqmuue resurgentqmueu resurgentqmeuu resurgentqmeuu resurgentqumue resurgentqumeu
resurgentquume resurgentquuem resurgentqueum resurgentquemu resurgentquume resurgentquuem resurgentqumue resurgentqumeu
resurgentquemu resurgentqueum resurgentqeuum resurgentqeumu resurgentqeuum resurgentqeumu resurgentqemuu resurgentqemuu
resurgentumque resurgentumqeu resurgentumuqe resurgentumueq resurgentumeuq resurgentumequ resurgentuqmue resurgentuqmeu
resurgentuqume resurgentuquem resurgentuqeum resurgentuqemu resurgentuuqme resurgentuuqem resurgentuumqe resurgentuumeq
resurgentuuemq resurgentuueqm resurgentuequm resurgentueqmu resurgentueuqm resurgentueumq resurgentuemuq resurgentuemqu
resurgentemquu resurgentemquu resurgentemuqu resurgentemuuq resurgentemuuq resurgentemuqu resurgenteqmuu resurgenteqmuu
resurgentequmu resurgentequum resurgentequum resurgentequmu resurgenteuqmu resurgenteuqum resurgenteumqu resurgenteumuq
resurgenteuumq resurgenteuuqm resurgenteuqum resurgenteuqmu resurgenteuuqm resurgenteuumq resurgenteumuq resurgenteumqu
resurgenutmque resurgenutmqeu resurgenutmuqe resurgenutmueq resurgenutmeuq resurgenutmequ resurgenutqmue resurgenutqmeu
resurgenutqume resurgenutquem resurgenutqeum resurgenutqemu resurgenutuqme resurgenutuqem resurgenutumqe resurgenutumeq
resurgenutuemq resurgenutueqm resurgenutequm resurgenuteqmu resurgenuteuqm resurgenuteumq resurgenutemuq resurgenutemqu
resurgenumtque resurgenumtqeu resurgenumtuqe resurgenumtueq resurgenumteuq resurgenumtequ resurgenumqtue resurgenumqteu
resurgenumqute resurgenumquet resurgenumqeut resurgenumqetu resurgenumuqte resurgenumuqet resurgenumutqe resurgenumuteq
resurgenumuetq resurgenumueqt resurgenumequt resurgenumeqtu resurgenumeuqt resurgenumeutq resurgenumetuq resurgenumetqu
resurgenuqmtue resurgenuqmteu resurgenuqmute resurgenuqmuet resurgenuqmeut resurgenuqmetu resurgenuqtmue resurgenuqtmeu
resurgenuqtume resurgenuqtuem resurgenuqteum resurgenuqtemu resurgenuqutme resurgenuqutem resurgenuqumte resurgenuqumet
resurgenuquemt resurgenuquetm resurgenuqetum resurgenuqetmu resurgenuqeutm resurgenuqeumt resurgenuqemut resurgenuqemtu
resurgenuumqte resurgenuumqet resurgenuumtqe resurgenuumteq resurgenuumetq resurgenuumeqt resurgenuuqmte resurgenuuqmet
resurgenuuqtme resurgenuuqtem resurgenuuqetm resurgenuuqemt resurgenuutqme resurgenuutqem resurgenuutmqe resurgenuutmeq
resurgenuutemq resurgenuuteqm resurgenuueqtm resurgenuueqmt resurgenuuetqm resurgenuuetmq resurgenuuemtq resurgenuuemqt
resurgenuemqut resurgenuemqtu resurgenuemuqt resurgenuemutq resurgenuemtuq resurgenuemtqu resurgenueqmut resurgenueqmtu
resurgenuequmt resurgenuequtm resurgenueqtum resurgenueqtmu resurgenueuqmt resurgenueuqtm resurgenueumqt resurgenueumtq
resurgenueutmq resurgenueutqm resurgenuetqum resurgenuetqmu resurgenuetuqm resurgenuetumq resurgenuetmuq resurgenuetmqu
resurgenmutque resurgenmutqeu resurgenmutuqe resurgenmutueq resurgenmuteuq resurgenmutequ resurgenmuqtue resurgenmuqteu
resurgenmuqute resurgenmuquet resurgenmuqeut resurgenmuqetu resurgenmuuqte resurgenmuuqet resurgenmuutqe resurgenmuuteq
resurgenmuuetq resurgenmuueqt resurgenmuequt resurgenmueqtu resurgenmueuqt resurgenmueutq resurgenmuetuq resurgenmuetqu
resurgenmtuque resurgenmtuqeu resurgenmtuuqe resurgenmtuueq resurgenmtueuq resurgenmtuequ resurgenmtquue resurgenmtqueu
resurgenmtquue resurgenmtqueu resurgenmtqeuu resurgenmtqeuu resurgenmtuque resurgenmtuqeu resurgenmtuuqe resurgenmtuueq
resurgenmtueuq resurgenmtuequ resurgenmtequu resurgenmtequu resurgenmteuqu resurgenmteuuq resurgenmteuuq resurgenmteuqu
resurgenmqtuue resurgenmqtueu resurgenmqtuue resurgenmqtueu resurgenmqteuu resurgenmqteuu resurgenmqutue resurgenmquteu
resurgenmquute resurgenmquuet resurgenmqueut resurgenmquetu resurgenmquute resurgenmquuet resurgenmqutue resurgenmquteu
resurgenmquetu resurgenmqueut resurgenmqeuut resurgenmqeutu resurgenmqeuut resurgenmqeutu resurgenmqetuu resurgenmqetuu
resurgenmutque resurgenmutqeu resurgenmutuqe resurgenmutueq resurgenmuteuq resurgenmutequ resurgenmuqtue resurgenmuqteu
resurgenmuqute resurgenmuquet resurgenmuqeut resurgenmuqetu resurgenmuuqte resurgenmuuqet resurgenmuutqe resurgenmuuteq
resurgenmuuetq resurgenmuueqt resurgenmuequt resurgenmueqtu resurgenmueuqt resurgenmueutq resurgenmuetuq resurgenmuetqu
resurgenmetquu resurgenmetquu resurgenmetuqu resurgenmetuuq resurgenmetuuq resurgenmetuqu resurgenmeqtuu resurgenmeqtuu
resurgenmequtu resurgenmequut resurgenmequut resurgenmequtu resurgenmeuqtu resurgenmeuqut resurgenmeutqu resurgenmeutuq
resurgenmeuutq resurgenmeuuqt resurgenmeuqut resurgenmeuqtu resurgenmeuuqt resurgenmeuutq resurgenmeutuq resurgenmeutqu
resurgenqumtue resurgenqumteu resurgenqumute resurgenqumuet resurgenqumeut resurgenqumetu resurgenqutmue resurgenqutmeu
resurgenqutume resurgenqutuem resurgenquteum resurgenqutemu resurgenquutme resurgenquutem resurgenquumte resurgenquumet
resurgenquuemt resurgenquuetm resurgenquetum resurgenquetmu resurgenqueutm resurgenqueumt resurgenquemut resurgenquemtu
resurgenqmutue resurgenqmuteu resurgenqmuute resurgenqmuuet resurgenqmueut resurgenqmuetu resurgenqmtuue resurgenqmtueu
resurgenqmtuue resurgenqmtueu resurgenqmteuu resurgenqmteuu resurgenqmutue resurgenqmuteu resurgenqmuute resurgenqmuuet
resurgenqmueut resurgenqmuetu resurgenqmetuu resurgenqmetuu resurgenqmeutu resurgenqmeuut resurgenqmeuut resurgenqmeutu
resurgenqtmuue resurgenqtmueu resurgenqtmuue resurgenqtmueu resurgenqtmeuu resurgenqtmeuu resurgenqtumue resurgenqtumeu
resurgenqtuume resurgenqtuuem resurgenqtueum resurgenqtuemu resurgenqtuume resurgenqtuuem resurgenqtumue resurgenqtumeu
resurgenqtuemu resurgenqtueum resurgenqteuum resurgenqteumu resurgenqteuum resurgenqteumu resurgenqtemuu resurgenqtemuu
resurgenqumtue resurgenqumteu resurgenqumute resurgenqumuet resurgenqumeut resurgenqumetu resurgenqutmue resurgenqutmeu
resurgenqutume resurgenqutuem resurgenquteum resurgenqutemu resurgenquutme resurgenquutem resurgenquumte resurgenquumet
resurgenquuemt resurgenquuetm resurgenquetum resurgenquetmu resurgenqueutm resurgenqueumt resurgenquemut resurgenquemtu
resurgenqemtuu resurgenqemtuu resurgenqemutu resurgenqemuut resurgenqemuut resurgenqemutu resurgenqetmuu resurgenqetmuu
resurgenqetumu resurgenqetuum resurgenqetuum resurgenqetumu resurgenqeutmu resurgenqeutum resurgenqeumtu resurgenqeumut
resurgenqeuumt resurgenqeuutm resurgenqeutum resurgenqeutmu resurgenqeuutm resurgenqeuumt resurgenqeumut resurgenqeumtu
resurgenuumqte resurgenuumqet resurgenuumtqe resurgenuumteq resurgenuumetq resurgenuumeqt resurgenuuqmte resurgenuuqmet
resurgenuuqtme resurgenuuqtem resurgenuuqetm resurgenuuqemt resurgenuutqme resurgenuutqem resurgenuutmqe resurgenuutmeq
resurgenuutemq resurgenuuteqm resurgenuueqtm resurgenuueqmt resurgenuuetqm resurgenuuetmq resurgenuuemtq resurgenuuemqt
resurgenumuqte resurgenumuqet resurgenumutqe resurgenumuteq resurgenumuetq resurgenumueqt resurgenumqute resurgenumquet
resurgenumqtue resurgenumqteu resurgenumqetu resurgenumqeut resurgenumtque resurgenumtqeu resurgenumtuqe resurgenumtueq
resurgenumteuq resurgenumtequ resurgenumeqtu resurgenumequt resurgenumetqu resurgenumetuq resurgenumeutq resurgenumeuqt
resurgenuqmute resurgenuqmuet resurgenuqmtue resurgenuqmteu resurgenuqmetu resurgenuqmeut resurgenuqumte resurgenuqumet
resurgenuqutme resurgenuqutem resurgenuquetm resurgenuquemt resurgenuqtume resurgenuqtuem resurgenuqtmue resurgenuqtmeu
resurgenuqtemu resurgenuqteum resurgenuqeutm resurgenuqeumt resurgenuqetum resurgenuqetmu resurgenuqemtu resurgenuqemut
resurgenutmque resurgenutmqeu resurgenutmuqe resurgenutmueq resurgenutmeuq resurgenutmequ resurgenutqmue resurgenutqmeu
resurgenutqume resurgenutquem resurgenutqeum resurgenutqemu resurgenutuqme resurgenutuqem resurgenutumqe resurgenutumeq
resurgenutuemq resurgenutueqm resurgenutequm resurgenuteqmu resurgenuteuqm resurgenuteumq resurgenutemuq resurgenutemqu
resurgenuemqtu resurgenuemqut resurgenuemtqu resurgenuemtuq resurgenuemutq resurgenuemuqt resurgenueqmtu resurgenueqmut
resurgenueqtmu resurgenueqtum resurgenuequtm resurgenuequmt resurgenuetqmu resurgenuetqum resurgenuetmqu resurgenuetmuq
resurgenuetumq resurgenuetuqm resurgenueuqtm resurgenueuqmt resurgenueutqm resurgenueutmq resurgenueumtq resurgenueumqt
resurgeneumqut resurgeneumqtu resurgeneumuqt resurgeneumutq resurgeneumtuq resurgeneumtqu resurgeneuqmut resurgeneuqmtu
resurgeneuqumt resurgeneuqutm resurgeneuqtum resurgeneuqtmu resurgeneuuqmt resurgeneuuqtm resurgeneuumqt resurgeneuumtq
resurgeneuutmq resurgeneuutqm resurgeneutqum resurgeneutqmu resurgeneutuqm resurgeneutumq resurgeneutmuq resurgeneutmqu
resurgenemuqut resurgenemuqtu resurgenemuuqt resurgenemuutq resurgenemutuq resurgenemutqu resurgenemquut resurgenemqutu
resurgenemquut resurgenemqutu resurgenemqtuu resurgenemqtuu resurgenemuqut resurgenemuqtu resurgenemuuqt resurgenemuutq
resurgenemutuq resurgenemutqu resurgenemtquu resurgenemtquu resurgenemtuqu resurgenemtuuq resurgenemtuuq resurgenemtuqu
resurgeneqmuut resurgeneqmutu resurgeneqmuut resurgeneqmutu resurgeneqmtuu resurgeneqmtuu resurgenequmut resurgenequmtu
resurgenequumt resurgenequutm resurgenequtum resurgenequtmu resurgenequumt resurgenequutm resurgenequmut resurgenequmtu
resurgenequtmu resurgenequtum resurgeneqtuum resurgeneqtumu resurgeneqtuum resurgeneqtumu resurgeneqtmuu resurgeneqtmuu
resurgeneumqut resurgeneumqtu resurgeneumuqt resurgeneumutq resurgeneumtuq resurgeneumtqu resurgeneuqmut resurgeneuqmtu
resurgeneuqumt resurgeneuqutm resurgeneuqtum resurgeneuqtmu resurgeneuuqmt resurgeneuuqtm resurgeneuumqt resurgeneuumtq
resurgeneuutmq resurgeneuutqm resurgeneutqum resurgeneutqmu resurgeneutuqm resurgeneutumq resurgeneutmuq resurgeneutmqu
resurgenetmquu resurgenetmquu resurgenetmuqu resurgenetmuuq resurgenetmuuq resurgenetmuqu resurgenetqmuu resurgenetqmuu
resurgenetqumu resurgenetquum resurgenetquum resurgenetqumu resurgenetuqmu resurgenetuqum resurgenetumqu resurgenetumuq
resurgenetuumq resurgenetuuqm resurgenetuqum resurgenetuqmu resurgenetuuqm resurgenetuumq resurgenetumuq resurgenetumqu
resurgetnumque resurgetnumqeu resurgetnumuqe resurgetnumueq resurgetnumeuq resurgetnumequ resurgetnuqmue resurgetnuqmeu
resurgetnuqume resurgetnuquem resurgetnuqeum resurgetnuqemu resurgetnuuqme resurgetnuuqem resurgetnuumqe resurgetnuumeq
resurgetnuuemq resurgetnuueqm resurgetnuequm resurgetnueqmu resurgetnueuqm resurgetnueumq resurgetnuemuq resurgetnuemqu
resurgetnmuque resurgetnmuqeu resurgetnmuuqe resurgetnmuueq resurgetnmueuq resurgetnmuequ resurgetnmquue resurgetnmqueu
resurgetnmquue resurgetnmqueu resurgetnmqeuu resurgetnmqeuu resurgetnmuque resurgetnmuqeu resurgetnmuuqe resurgetnmuueq
resurgetnmueuq resurgetnmuequ resurgetnmequu resurgetnmequu resurgetnmeuqu resurgetnmeuuq resurgetnmeuuq resurgetnmeuqu
resurgetnqmuue resurgetnqmueu resurgetnqmuue resurgetnqmueu resurgetnqmeuu resurgetnqmeuu resurgetnqumue resurgetnqumeu
resurgetnquume resurgetnquuem resurgetnqueum resurgetnquemu resurgetnquume resurgetnquuem resurgetnqumue resurgetnqumeu
resurgetnquemu resurgetnqueum resurgetnqeuum resurgetnqeumu resurgetnqeuum resurgetnqeumu resurgetnqemuu resurgetnqemuu
resurgetnumque resurgetnumqeu resurgetnumuqe resurgetnumueq resurgetnumeuq resurgetnumequ resurgetnuqmue resurgetnuqmeu
resurgetnuqume resurgetnuquem resurgetnuqeum resurgetnuqemu resurgetnuuqme resurgetnuuqem resurgetnuumqe resurgetnuumeq
resurgetnuuemq resurgetnuueqm resurgetnuequm resurgetnueqmu resurgetnueuqm resurgetnueumq resurgetnuemuq resurgetnuemqu
resurgetnemquu resurgetnemquu resurgetnemuqu resurgetnemuuq resurgetnemuuq resurgetnemuqu resurgetneqmuu resurgetneqmuu
resurgetnequmu resurgetnequum resurgetnequum resurgetnequmu resurgetneuqmu resurgetneuqum resurgetneumqu resurgetneumuq
resurgetneuumq resurgetneuuqm resurgetneuqum resurgetneuqmu resurgetneuuqm resurgetneuumq resurgetneumuq resurgetneumqu
resurgetunmque resurgetunmqeu resurgetunmuqe resurgetunmueq resurgetunmeuq resurgetunmequ resurgetunqmue resurgetunqmeu
resurgetunqume resurgetunquem resurgetunqeum resurgetunqemu resurgetunuqme resurgetunuqem resurgetunumqe resurgetunumeq
resurgetunuemq resurgetunueqm resurgetunequm resurgetuneqmu resurgetuneuqm resurgetuneumq resurgetunemuq resurgetunemqu
resurgetumnque resurgetumnqeu resurgetumnuqe resurgetumnueq resurgetumneuq resurgetumnequ resurgetumqnue resurgetumqneu
resurgetumqune resurgetumquen resurgetumqeun resurgetumqenu resurgetumuqne resurgetumuqen resurgetumunqe resurgetumuneq
resurgetumuenq resurgetumueqn resurgetumequn resurgetumeqnu resurgetumeuqn resurgetumeunq resurgetumenuq resurgetumenqu
resurgetuqmnue resurgetuqmneu resurgetuqmune resurgetuqmuen resurgetuqmeun resurgetuqmenu resurgetuqnmue resurgetuqnmeu
resurgetuqnume resurgetuqnuem resurgetuqneum resurgetuqnemu resurgetuqunme resurgetuqunem resurgetuqumne resurgetuqumen
resurgetuquemn resurgetuquenm resurgetuqenum resurgetuqenmu resurgetuqeunm resurgetuqeumn resurgetuqemun resurgetuqemnu
resurgetuumqne resurgetuumqen resurgetuumnqe resurgetuumneq resurgetuumenq resurgetuumeqn resurgetuuqmne resurgetuuqmen
resurgetuuqnme resurgetuuqnem resurgetuuqenm resurgetuuqemn resurgetuunqme resurgetuunqem resurgetuunmqe resurgetuunmeq
resurgetuunemq resurgetuuneqm resurgetuueqnm resurgetuueqmn resurgetuuenqm resurgetuuenmq resurgetuuemnq resurgetuuemqn
resurgetuemqun resurgetuemqnu resurgetuemuqn resurgetuemunq resurgetuemnuq resurgetuemnqu resurgetueqmun resurgetueqmnu
resurgetuequmn resurgetuequnm resurgetueqnum resurgetueqnmu resurgetueuqmn resurgetueuqnm resurgetueumqn resurgetueumnq
resurgetueunmq resurgetueunqm resurgetuenqum resurgetuenqmu resurgetuenuqm resurgetuenumq resurgetuenmuq resurgetuenmqu
resurgetmunque resurgetmunqeu resurgetmunuqe resurgetmunueq resurgetmuneuq resurgetmunequ resurgetmuqnue resurgetmuqneu
resurgetmuqune resurgetmuquen resurgetmuqeun resurgetmuqenu resurgetmuuqne resurgetmuuqen resurgetmuunqe resurgetmuuneq
resurgetmuuenq resurgetmuueqn resurgetmuequn resurgetmueqnu resurgetmueuqn resurgetmueunq resurgetmuenuq resurgetmuenqu
resurgetmnuque resurgetmnuqeu resurgetmnuuqe resurgetmnuueq resurgetmnueuq resurgetmnuequ resurgetmnquue resurgetmnqueu
resurgetmnquue resurgetmnqueu resurgetmnqeuu resurgetmnqeuu resurgetmnuque resurgetmnuqeu resurgetmnuuqe resurgetmnuueq
resurgetmnueuq resurgetmnuequ resurgetmnequu resurgetmnequu resurgetmneuqu resurgetmneuuq resurgetmneuuq resurgetmneuqu
resurgetmqnuue resurgetmqnueu resurgetmqnuue resurgetmqnueu resurgetmqneuu resurgetmqneuu resurgetmqunue resurgetmquneu
resurgetmquune resurgetmquuen resurgetmqueun resurgetmquenu resurgetmquune resurgetmquuen resurgetmqunue resurgetmquneu
resurgetmquenu resurgetmqueun resurgetmqeuun resurgetmqeunu resurgetmqeuun resurgetmqeunu resurgetmqenuu resurgetmqenuu
resurgetmunque resurgetmunqeu resurgetmunuqe resurgetmunueq resurgetmuneuq resurgetmunequ resurgetmuqnue resurgetmuqneu
resurgetmuqune resurgetmuquen resurgetmuqeun resurgetmuqenu resurgetmuuqne resurgetmuuqen resurgetmuunqe resurgetmuuneq
resurgetmuuenq resurgetmuueqn resurgetmuequn resurgetmueqnu resurgetmueuqn resurgetmueunq resurgetmuenuq resurgetmuenqu
resurgetmenquu resurgetmenquu resurgetmenuqu resurgetmenuuq resurgetmenuuq resurgetmenuqu resurgetmeqnuu resurgetmeqnuu
resurgetmequnu resurgetmequun resurgetmequun resurgetmequnu resurgetmeuqnu resurgetmeuqun resurgetmeunqu resurgetmeunuq
resurgetmeuunq resurgetmeuuqn resurgetmeuqun resurgetmeuqnu resurgetmeuuqn resurgetmeuunq resurgetmeunuq resurgetmeunqu
resurgetqumnue resurgetqumneu resurgetqumune resurgetqumuen resurgetqumeun resurgetqumenu resurgetqunmue resurgetqunmeu
resurgetqunume resurgetqunuem resurgetquneum resurgetqunemu resurgetquunme resurgetquunem resurgetquumne resurgetquumen
resurgetquuemn resurgetquuenm resurgetquenum resurgetquenmu resurgetqueunm resurgetqueumn resurgetquemun resurgetquemnu
resurgetqmunue resurgetqmuneu resurgetqmuune resurgetqmuuen resurgetqmueun resurgetqmuenu resurgetqmnuue resurgetqmnueu
resurgetqmnuue resurgetqmnueu resurgetqmneuu resurgetqmneuu resurgetqmunue resurgetqmuneu resurgetqmuune resurgetqmuuen
resurgetqmueun resurgetqmuenu resurgetqmenuu resurgetqmenuu resurgetqmeunu resurgetqmeuun resurgetqmeuun resurgetqmeunu
resurgetqnmuue resurgetqnmueu resurgetqnmuue resurgetqnmueu resurgetqnmeuu resurgetqnmeuu resurgetqnumue resurgetqnumeu
resurgetqnuume resurgetqnuuem resurgetqnueum resurgetqnuemu resurgetqnuume resurgetqnuuem resurgetqnumue resurgetqnumeu
resurgetqnuemu resurgetqnueum resurgetqneuum resurgetqneumu resurgetqneuum resurgetqneumu resurgetqnemuu resurgetqnemuu
resurgetqumnue resurgetqumneu resurgetqumune resurgetqumuen resurgetqumeun resurgetqumenu resurgetqunmue resurgetqunmeu
resurgetqunume resurgetqunuem resurgetquneum resurgetqunemu resurgetquunme resurgetquunem resurgetquumne resurgetquumen
resurgetquuemn resurgetquuenm resurgetquenum resurgetquenmu resurgetqueunm resurgetqueumn resurgetquemun resurgetquemnu
resurgetqemnuu resurgetqemnuu resurgetqemunu resurgetqemuun resurgetqemuun resurgetqemunu resurgetqenmuu resurgetqenmuu
resurgetqenumu resurgetqenuum resurgetqenuum resurgetqenumu resurgetqeunmu resurgetqeunum resurgetqeumnu resurgetqeumun
resurgetqeuumn resurgetqeuunm resurgetqeunum resurgetqeunmu resurgetqeuunm resurgetqeuumn resurgetqeumun resurgetqeumnu
resurgetuumqne resurgetuumqen resurgetuumnqe resurgetuumneq resurgetuumenq resurgetuumeqn resurgetuuqmne resurgetuuqmen
resurgetuuqnme resurgetuuqnem resurgetuuqenm resurgetuuqemn resurgetuunqme resurgetuunqem resurgetuunmqe resurgetuunmeq
resurgetuunemq resurgetuuneqm resurgetuueqnm resurgetuueqmn resurgetuuenqm resurgetuuenmq resurgetuuemnq resurgetuuemqn
resurgetumuqne resurgetumuqen resurgetumunqe resurgetumuneq resurgetumuenq resurgetumueqn resurgetumqune resurgetumquen
resurgetumqnue resurgetumqneu resurgetumqenu resurgetumqeun resurgetumnque resurgetumnqeu resurgetumnuqe resurgetumnueq
resurgetumneuq resurgetumnequ resurgetumeqnu resurgetumequn resurgetumenqu resurgetumenuq resurgetumeunq resurgetumeuqn
resurgetuqmune resurgetuqmuen resurgetuqmnue resurgetuqmneu resurgetuqmenu resurgetuqmeun resurgetuqumne resurgetuqumen
resurgetuqunme resurgetuqunem resurgetuquenm resurgetuquemn resurgetuqnume resurgetuqnuem resurgetuqnmue resurgetuqnmeu
resurgetuqnemu resurgetuqneum resurgetuqeunm resurgetuqeumn resurgetuqenum resurgetuqenmu resurgetuqemnu resurgetuqemun
resurgetunmque resurgetunmqeu resurgetunmuqe resurgetunmueq resurgetunmeuq resurgetunmequ resurgetunqmue resurgetunqmeu
resurgetunqume resurgetunquem resurgetunqeum resurgetunqemu resurgetunuqme resurgetunuqem resurgetunumqe resurgetunumeq
resurgetunuemq resurgetunueqm resurgetunequm resurgetuneqmu resurgetuneuqm resurgetuneumq resurgetunemuq resurgetunemqu
resurgetuemqnu resurgetuemqun resurgetuemnqu resurgetuemnuq resurgetuemunq resurgetuemuqn resurgetueqmnu resurgetueqmun
resurgetueqnmu resurgetueqnum resurgetuequnm resurgetuequmn resurgetuenqmu resurgetuenqum resurgetuenmqu resurgetuenmuq
resurgetuenumq resurgetuenuqm resurgetueuqnm resurgetueuqmn resurgetueunqm resurgetueunmq resurgetueumnq resurgetueumqn
resurgeteumqun resurgeteumqnu resurgeteumuqn resurgeteumunq resurgeteumnuq resurgeteumnqu resurgeteuqmun resurgeteuqmnu
resurgeteuqumn resurgeteuqunm resurgeteuqnum resurgeteuqnmu resurgeteuuqmn resurgeteuuqnm resurgeteuumqn resurgeteuumnq
resurgeteuunmq resurgeteuunqm resurgeteunqum resurgeteunqmu resurgeteunuqm resurgeteunumq resurgeteunmuq resurgeteunmqu
resurgetemuqun resurgetemuqnu resurgetemuuqn resurgetemuunq resurgetemunuq resurgetemunqu resurgetemquun resurgetemqunu
resurgetemquun resurgetemqunu resurgetemqnuu resurgetemqnuu resurgetemuqun resurgetemuqnu resurgetemuuqn resurgetemuunq
resurgetemunuq resurgetemunqu resurgetemnquu resurgetemnquu resurgetemnuqu resurgetemnuuq resurgetemnuuq resurgetemnuqu
resurgeteqmuun resurgeteqmunu resurgeteqmuun resurgeteqmunu resurgeteqmnuu resurgeteqmnuu resurgetequmun resurgetequmnu
resurgetequumn resurgetequunm resurgetequnum resurgetequnmu resurgetequumn resurgetequunm resurgetequmun resurgetequmnu
resurgetequnmu resurgetequnum resurgeteqnuum resurgeteqnumu resurgeteqnuum resurgeteqnumu resurgeteqnmuu resurgeteqnmuu
resurgeteumqun resurgeteumqnu resurgeteumuqn resurgeteumunq resurgeteumnuq resurgeteumnqu resurgeteuqmun resurgeteuqmnu
resurgeteuqumn resurgeteuqunm resurgeteuqnum resurgeteuqnmu resurgeteuuqmn resurgeteuuqnm resurgeteuumqn resurgeteuumnq
resurgeteuunmq resurgeteuunqm resurgeteunqum resurgeteunqmu resurgeteunuqm resurgeteunumq resurgeteunmuq resurgeteunmqu
resurgetenmquu resurgetenmquu resurgetenmuqu resurgetenmuuq resurgetenmuuq resurgetenmuqu resurgetenqmuu resurgetenqmuu
resurgetenqumu resurgetenquum resurgetenquum resurgetenqumu resurgetenuqmu resurgetenuqum resurgetenumqu resurgetenumuq
resurgetenuumq resurgetenuuqm resurgetenuqum resurgetenuqmu resurgetenuuqm resurgetenuumq resurgetenumuq resurgetenumqu
resurgeutnmque resurgeutnmqeu resurgeutnmuqe resurgeutnmueq resurgeutnmeuq resurgeutnmequ resurgeutnqmue resurgeutnqmeu
resurgeutnqume resurgeutnquem resurgeutnqeum resurgeutnqemu resurgeutnuqme resurgeutnuqem resurgeutnumqe resurgeutnumeq
resurgeutnuemq resurgeutnueqm resurgeutnequm resurgeutneqmu resurgeutneuqm resurgeutneumq resurgeutnemuq resurgeutnemqu
resurgeutmnque resurgeutmnqeu resurgeutmnuqe resurgeutmnueq resurgeutmneuq resurgeutmnequ resurgeutmqnue resurgeutmqneu
resurgeutmqune resurgeutmquen resurgeutmqeun resurgeutmqenu resurgeutmuqne resurgeutmuqen resurgeutmunqe resurgeutmuneq
resurgeutmuenq resurgeutmueqn resurgeutmequn resurgeutmeqnu resurgeutmeuqn resurgeutmeunq resurgeutmenuq resurgeutmenqu
resurgeutqmnue resurgeutqmneu resurgeutqmune resurgeutqmuen resurgeutqmeun resurgeutqmenu resurgeutqnmue resurgeutqnmeu
resurgeutqnume resurgeutqnuem resurgeutqneum resurgeutqnemu resurgeutqunme resurgeutqunem resurgeutqumne resurgeutqumen
resurgeutquemn resurgeutquenm resurgeutqenum resurgeutqenmu resurgeutqeunm resurgeutqeumn resurgeutqemun resurgeutqemnu
resurgeutumqne resurgeutumqen resurgeutumnqe resurgeutumneq resurgeutumenq resurgeutumeqn resurgeutuqmne resurgeutuqmen
resurgeutuqnme resurgeutuqnem resurgeutuqenm resurgeutuqemn resurgeutunqme resurgeutunqem resurgeutunmqe resurgeutunmeq
resurgeutunemq resurgeutuneqm resurgeutueqnm resurgeutueqmn resurgeutuenqm resurgeutuenmq resurgeutuemnq resurgeutuemqn
resurgeutemqun resurgeutemqnu resurgeutemuqn resurgeutemunq resurgeutemnuq resurgeutemnqu resurgeuteqmun resurgeuteqmnu
resurgeutequmn resurgeutequnm resurgeuteqnum resurgeuteqnmu resurgeuteuqmn resurgeuteuqnm resurgeuteumqn resurgeuteumnq
resurgeuteunmq resurgeuteunqm resurgeutenqum resurgeutenqmu resurgeutenuqm resurgeutenumq resurgeutenmuq resurgeutenmqu
resurgeuntmque resurgeuntmqeu resurgeuntmuqe resurgeuntmueq resurgeuntmeuq resurgeuntmequ resurgeuntqmue resurgeuntqmeu
resurgeuntqume resurgeuntquem resurgeuntqeum resurgeuntqemu resurgeuntuqme resurgeuntuqem resurgeuntumqe resurgeuntumeq
resurgeuntuemq resurgeuntueqm resurgeuntequm resurgeunteqmu resurgeunteuqm resurgeunteumq resurgeuntemuq resurgeuntemqu
resurgeunmtque resurgeunmtqeu resurgeunmtuqe resurgeunmtueq resurgeunmteuq resurgeunmtequ resurgeunmqtue resurgeunmqteu
resurgeunmqute resurgeunmquet resurgeunmqeut resurgeunmqetu resurgeunmuqte resurgeunmuqet resurgeunmutqe resurgeunmuteq
resurgeunmuetq resurgeunmueqt resurgeunmequt resurgeunmeqtu resurgeunmeuqt resurgeunmeutq resurgeunmetuq resurgeunmetqu
resurgeunqmtue resurgeunqmteu resurgeunqmute resurgeunqmuet resurgeunqmeut resurgeunqmetu resurgeunqtmue resurgeunqtmeu
resurgeunqtume resurgeunqtuem resurgeunqteum resurgeunqtemu resurgeunqutme resurgeunqutem resurgeunqumte resurgeunqumet
resurgeunquemt resurgeunquetm resurgeunqetum resurgeunqetmu resurgeunqeutm resurgeunqeumt resurgeunqemut resurgeunqemtu
resurgeunumqte resurgeunumqet resurgeunumtqe resurgeunumteq resurgeunumetq resurgeunumeqt resurgeunuqmte resurgeunuqmet
resurgeunuqtme resurgeunuqtem resurgeunuqetm resurgeunuqemt resurgeunutqme resurgeunutqem resurgeunutmqe resurgeunutmeq
resurgeunutemq resurgeunuteqm resurgeunueqtm resurgeunueqmt resurgeunuetqm resurgeunuetmq resurgeunuemtq resurgeunuemqt
resurgeunemqut resurgeunemqtu resurgeunemuqt resurgeunemutq resurgeunemtuq resurgeunemtqu resurgeuneqmut resurgeuneqmtu
resurgeunequmt resurgeunequtm resurgeuneqtum resurgeuneqtmu resurgeuneuqmt resurgeuneuqtm resurgeuneumqt resurgeuneumtq
resurgeuneutmq resurgeuneutqm resurgeunetqum resurgeunetqmu resurgeunetuqm resurgeunetumq resurgeunetmuq resurgeunetmqu
resurgeumntque resurgeumntqeu resurgeumntuqe resurgeumntueq resurgeumnteuq resurgeumntequ resurgeumnqtue resurgeumnqteu
resurgeumnqute resurgeumnquet resurgeumnqeut resurgeumnqetu resurgeumnuqte resurgeumnuqet resurgeumnutqe resurgeumnuteq
resurgeumnuetq resurgeumnueqt resurgeumnequt resurgeumneqtu resurgeumneuqt resurgeumneutq resurgeumnetuq resurgeumnetqu
resurgeumtnque resurgeumtnqeu resurgeumtnuqe resurgeumtnueq resurgeumtneuq resurgeumtnequ resurgeumtqnue resurgeumtqneu
resurgeumtqune resurgeumtquen resurgeumtqeun resurgeumtqenu resurgeumtuqne resurgeumtuqen resurgeumtunqe resurgeumtuneq
resurgeumtuenq resurgeumtueqn resurgeumtequn resurgeumteqnu resurgeumteuqn resurgeumteunq resurgeumtenuq resurgeumtenqu
resurgeumqtnue resurgeumqtneu resurgeumqtune resurgeumqtuen resurgeumqteun resurgeumqtenu resurgeumqntue resurgeumqnteu
resurgeumqnute resurgeumqnuet resurgeumqneut resurgeumqnetu resurgeumqunte resurgeumqunet resurgeumqutne resurgeumquten
resurgeumquetn resurgeumquent resurgeumqenut resurgeumqentu resurgeumqeunt resurgeumqeutn resurgeumqetun resurgeumqetnu
resurgeumutqne resurgeumutqen resurgeumutnqe resurgeumutneq resurgeumutenq resurgeumuteqn resurgeumuqtne resurgeumuqten
resurgeumuqnte resurgeumuqnet resurgeumuqent resurgeumuqetn resurgeumunqte resurgeumunqet resurgeumuntqe resurgeumunteq
resurgeumunetq resurgeumuneqt resurgeumueqnt resurgeumueqtn resurgeumuenqt resurgeumuentq resurgeumuetnq resurgeumuetqn
resurgeumetqun resurgeumetqnu resurgeumetuqn resurgeumetunq resurgeumetnuq resurgeumetnqu resurgeumeqtun resurgeumeqtnu
resurgeumequtn resurgeumequnt resurgeumeqnut resurgeumeqntu resurgeumeuqtn resurgeumeuqnt resurgeumeutqn resurgeumeutnq
resurgeumeuntq resurgeumeunqt resurgeumenqut resurgeumenqtu resurgeumenuqt resurgeumenutq resurgeumentuq resurgeumentqu
resurgeuqnmtue resurgeuqnmteu resurgeuqnmute resurgeuqnmuet resurgeuqnmeut resurgeuqnmetu resurgeuqntmue resurgeuqntmeu
resurgeuqntume resurgeuqntuem resurgeuqnteum resurgeuqntemu resurgeuqnutme resurgeuqnutem resurgeuqnumte resurgeuqnumet
resurgeuqnuemt resurgeuqnuetm resurgeuqnetum resurgeuqnetmu resurgeuqneutm resurgeuqneumt resurgeuqnemut resurgeuqnemtu
resurgeuqmntue resurgeuqmnteu resurgeuqmnute resurgeuqmnuet resurgeuqmneut resurgeuqmnetu resurgeuqmtnue resurgeuqmtneu
resurgeuqmtune resurgeuqmtuen resurgeuqmteun resurgeuqmtenu resurgeuqmutne resurgeuqmuten resurgeuqmunte resurgeuqmunet
resurgeuqmuent resurgeuqmuetn resurgeuqmetun resurgeuqmetnu resurgeuqmeutn resurgeuqmeunt resurgeuqmenut resurgeuqmentu
resurgeuqtmnue resurgeuqtmneu resurgeuqtmune resurgeuqtmuen resurgeuqtmeun resurgeuqtmenu resurgeuqtnmue resurgeuqtnmeu
resurgeuqtnume resurgeuqtnuem resurgeuqtneum resurgeuqtnemu resurgeuqtunme resurgeuqtunem resurgeuqtumne resurgeuqtumen
resurgeuqtuemn resurgeuqtuenm resurgeuqtenum resurgeuqtenmu resurgeuqteunm resurgeuqteumn resurgeuqtemun resurgeuqtemnu
resurgeuqumtne resurgeuqumten resurgeuqumnte resurgeuqumnet resurgeuqument resurgeuqumetn resurgeuqutmne resurgeuqutmen
resurgeuqutnme resurgeuqutnem resurgeuqutenm resurgeuqutemn resurgeuquntme resurgeuquntem resurgeuqunmte resurgeuqunmet
resurgeuqunemt resurgeuqunetm resurgeuquetnm resurgeuquetmn resurgeuquentm resurgeuquenmt resurgeuquemnt resurgeuquemtn
resurgeuqemtun resurgeuqemtnu resurgeuqemutn resurgeuqemunt resurgeuqemnut resurgeuqemntu resurgeuqetmun resurgeuqetmnu
resurgeuqetumn resurgeuqetunm resurgeuqetnum resurgeuqetnmu resurgeuqeutmn resurgeuqeutnm resurgeuqeumtn resurgeuqeumnt
resurgeuqeunmt resurgeuqeuntm resurgeuqentum resurgeuqentmu resurgeuqenutm resurgeuqenumt resurgeuqenmut resurgeuqenmtu
resurgeuunmqte resurgeuunmqet resurgeuunmtqe resurgeuunmteq resurgeuunmetq resurgeuunmeqt resurgeuunqmte resurgeuunqmet
resurgeuunqtme resurgeuunqtem resurgeuunqetm resurgeuunqemt resurgeuuntqme resurgeuuntqem resurgeuuntmqe resurgeuuntmeq
resurgeuuntemq resurgeuunteqm resurgeuuneqtm resurgeuuneqmt resurgeuunetqm resurgeuunetmq resurgeuunemtq resurgeuunemqt
resurgeuumnqte resurgeuumnqet resurgeuumntqe resurgeuumnteq resurgeuumnetq resurgeuumneqt resurgeuumqnte resurgeuumqnet
resurgeuumqtne resurgeuumqten resurgeuumqetn resurgeuumqent resurgeuumtqne resurgeuumtqen resurgeuumtnqe resurgeuumtneq
resurgeuumtenq resurgeuumteqn resurgeuumeqtn resurgeuumeqnt resurgeuumetqn resurgeuumetnq resurgeuumentq resurgeuumenqt
resurgeuuqmnte resurgeuuqmnet resurgeuuqmtne resurgeuuqmten resurgeuuqmetn resurgeuuqment resurgeuuqnmte resurgeuuqnmet
resurgeuuqntme resurgeuuqntem resurgeuuqnetm resurgeuuqnemt resurgeuuqtnme resurgeuuqtnem resurgeuuqtmne resurgeuuqtmen
resurgeuuqtemn resurgeuuqtenm resurgeuuqentm resurgeuuqenmt resurgeuuqetnm resurgeuuqetmn resurgeuuqemtn resurgeuuqemnt
resurgeuutmqne resurgeuutmqen resurgeuutmnqe resurgeuutmneq resurgeuutmenq resurgeuutmeqn resurgeuutqmne resurgeuutqmen
resurgeuutqnme resurgeuutqnem resurgeuutqenm resurgeuutqemn resurgeuutnqme resurgeuutnqem resurgeuutnmqe resurgeuutnmeq
resurgeuutnemq resurgeuutneqm resurgeuuteqnm resurgeuuteqmn resurgeuutenqm resurgeuutenmq resurgeuutemnq resurgeuutemqn
resurgeuuemqtn resurgeuuemqnt resurgeuuemtqn resurgeuuemtnq resurgeuuemntq resurgeuuemnqt resurgeuueqmtn resurgeuueqmnt
resurgeuueqtmn resurgeuueqtnm resurgeuueqntm resurgeuueqnmt resurgeuuetqmn resurgeuuetqnm resurgeuuetmqn resurgeuuetmnq
resurgeuuetnmq resurgeuuetnqm resurgeuuenqtm resurgeuuenqmt resurgeuuentqm resurgeuuentmq resurgeuuenmtq resurgeuuenmqt
resurgeuenmqut resurgeuenmqtu resurgeuenmuqt resurgeuenmutq resurgeuenmtuq resurgeuenmtqu resurgeuenqmut resurgeuenqmtu
resurgeuenqumt resurgeuenqutm resurgeuenqtum resurgeuenqtmu resurgeuenuqmt resurgeuenuqtm resurgeuenumqt resurgeuenumtq
resurgeuenutmq resurgeuenutqm resurgeuentqum resurgeuentqmu resurgeuentuqm resurgeuentumq resurgeuentmuq resurgeuentmqu
resurgeuemnqut resurgeuemnqtu resurgeuemnuqt resurgeuemnutq resurgeuemntuq resurgeuemntqu resurgeuemqnut resurgeuemqntu
resurgeuemqunt resurgeuemqutn resurgeuemqtun resurgeuemqtnu resurgeuemuqnt resurgeuemuqtn resurgeuemunqt resurgeuemuntq
resurgeuemutnq resurgeuemutqn resurgeuemtqun resurgeuemtqnu resurgeuemtuqn resurgeuemtunq resurgeuemtnuq resurgeuemtnqu
resurgeueqmnut resurgeueqmntu resurgeueqmunt resurgeueqmutn resurgeueqmtun resurgeueqmtnu resurgeueqnmut resurgeueqnmtu
resurgeueqnumt resurgeueqnutm resurgeueqntum resurgeueqntmu resurgeuequnmt resurgeuequntm resurgeuequmnt resurgeuequmtn
resurgeuequtmn resurgeuequtnm resurgeueqtnum resurgeueqtnmu resurgeueqtunm resurgeueqtumn resurgeueqtmun resurgeueqtmnu
resurgeueumqnt resurgeueumqtn resurgeueumnqt resurgeueumntq resurgeueumtnq resurgeueumtqn resurgeueuqmnt resurgeueuqmtn
resurgeueuqnmt resurgeueuqntm resurgeueuqtnm resurgeueuqtmn resurgeueunqmt resurgeueunqtm resurgeueunmqt resurgeueunmtq
resurgeueuntmq resurgeueuntqm resurgeueutqnm resurgeueutqmn resurgeueutnqm resurgeueutnmq resurgeueutmnq resurgeueutmqn
resurgeuetmqun resurgeuetmqnu resurgeuetmuqn resurgeuetmunq resurgeuetmnuq resurgeuetmnqu resurgeuetqmun resurgeuetqmnu
resurgeuetqumn resurgeuetqunm resurgeuetqnum resurgeuetqnmu resurgeuetuqmn resurgeuetuqnm resurgeuetumqn resurgeuetumnq
resurgeuetunmq resurgeuetunqm resurgeuetnqum resurgeuetnqmu resurgeuetnuqm resurgeuetnumq resurgeuetnmuq resurgeuetnmqu
resurgemtunque resurgemtunqeu resurgemtunuqe resurgemtunueq resurgemtuneuq resurgemtunequ resurgemtuqnue resurgemtuqneu
resurgemtuqune resurgemtuquen resurgemtuqeun resurgemtuqenu resurgemtuuqne resurgemtuuqen resurgemtuunqe resurgemtuuneq
resurgemtuuenq resurgemtuueqn resurgemtuequn resurgemtueqnu resurgemtueuqn resurgemtueunq resurgemtuenuq resurgemtuenqu
resurgemtnuque resurgemtnuqeu resurgemtnuuqe resurgemtnuueq resurgemtnueuq resurgemtnuequ resurgemtnquue resurgemtnqueu
resurgemtnquue resurgemtnqueu resurgemtnqeuu resurgemtnqeuu resurgemtnuque resurgemtnuqeu resurgemtnuuqe resurgemtnuueq
resurgemtnueuq resurgemtnuequ resurgemtnequu resurgemtnequu resurgemtneuqu resurgemtneuuq resurgemtneuuq resurgemtneuqu
resurgemtqnuue resurgemtqnueu resurgemtqnuue resurgemtqnueu resurgemtqneuu resurgemtqneuu resurgemtqunue resurgemtquneu
resurgemtquune resurgemtquuen resurgemtqueun resurgemtquenu resurgemtquune resurgemtquuen resurgemtqunue resurgemtquneu
resurgemtquenu resurgemtqueun resurgemtqeuun resurgemtqeunu resurgemtqeuun resurgemtqeunu resurgemtqenuu resurgemtqenuu
resurgemtunque resurgemtunqeu resurgemtunuqe resurgemtunueq resurgemtuneuq resurgemtunequ resurgemtuqnue resurgemtuqneu
resurgemtuqune resurgemtuquen resurgemtuqeun resurgemtuqenu resurgemtuuqne resurgemtuuqen resurgemtuunqe resurgemtuuneq
resurgemtuuenq resurgemtuueqn resurgemtuequn resurgemtueqnu resurgemtueuqn resurgemtueunq resurgemtuenuq resurgemtuenqu
resurgemtenquu resurgemtenquu resurgemtenuqu resurgemtenuuq resurgemtenuuq resurgemtenuqu resurgemteqnuu resurgemteqnuu
resurgemtequnu resurgemtequun resurgemtequun resurgemtequnu resurgemteuqnu resurgemteuqun resurgemteunqu resurgemteunuq
resurgemteuunq resurgemteuuqn resurgemteuqun resurgemteuqnu resurgemteuuqn resurgemteuunq resurgemteunuq resurgemteunqu
resurgemutnque resurgemutnqeu resurgemutnuqe resurgemutnueq resurgemutneuq resurgemutnequ resurgemutqnue resurgemutqneu
resurgemutqune resurgemutquen resurgemutqeun resurgemutqenu resurgemutuqne resurgemutuqen resurgemutunqe resurgemutuneq
resurgemutuenq resurgemutueqn resurgemutequn resurgemuteqnu resurgemuteuqn resurgemuteunq resurgemutenuq resurgemutenqu
resurgemuntque resurgemuntqeu resurgemuntuqe resurgemuntueq resurgemunteuq resurgemuntequ resurgemunqtue resurgemunqteu
resurgemunqute resurgemunquet resurgemunqeut resurgemunqetu resurgemunuqte resurgemunuqet resurgemunutqe resurgemunuteq
resurgemunuetq resurgemunueqt resurgemunequt resurgemuneqtu resurgemuneuqt resurgemuneutq resurgemunetuq resurgemunetqu
resurgemuqntue resurgemuqnteu resurgemuqnute resurgemuqnuet resurgemuqneut resurgemuqnetu resurgemuqtnue resurgemuqtneu
resurgemuqtune resurgemuqtuen resurgemuqteun resurgemuqtenu resurgemuqutne resurgemuquten resurgemuqunte resurgemuqunet
resurgemuquent resurgemuquetn resurgemuqetun resurgemuqetnu resurgemuqeutn resurgemuqeunt resurgemuqenut resurgemuqentu
resurgemuunqte resurgemuunqet resurgemuuntqe resurgemuunteq resurgemuunetq resurgemuuneqt resurgemuuqnte resurgemuuqnet
resurgemuuqtne resurgemuuqten resurgemuuqetn resurgemuuqent resurgemuutqne resurgemuutqen resurgemuutnqe resurgemuutneq
resurgemuutenq resurgemuuteqn resurgemuueqtn resurgemuueqnt resurgemuuetqn resurgemuuetnq resurgemuuentq resurgemuuenqt
resurgemuenqut resurgemuenqtu resurgemuenuqt resurgemuenutq resurgemuentuq resurgemuentqu resurgemueqnut resurgemueqntu
resurgemuequnt resurgemuequtn resurgemueqtun resurgemueqtnu resurgemueuqnt resurgemueuqtn resurgemueunqt resurgemueuntq
resurgemueutnq resurgemueutqn resurgemuetqun resurgemuetqnu resurgemuetuqn resurgemuetunq resurgemuetnuq resurgemuetnqu
resurgemnutque resurgemnutqeu resurgemnutuqe resurgemnutueq resurgemnuteuq resurgemnutequ resurgemnuqtue resurgemnuqteu
resurgemnuqute resurgemnuquet resurgemnuqeut resurgemnuqetu resurgemnuuqte resurgemnuuqet resurgemnuutqe resurgemnuuteq
resurgemnuuetq resurgemnuueqt resurgemnuequt resurgemnueqtu resurgemnueuqt resurgemnueutq resurgemnuetuq resurgemnuetqu
resurgemntuque resurgemntuqeu resurgemntuuqe resurgemntuueq resurgemntueuq resurgemntuequ resurgemntquue resurgemntqueu
resurgemntquue resurgemntqueu resurgemntqeuu resurgemntqeuu resurgemntuque resurgemntuqeu resurgemntuuqe resurgemntuueq
resurgemntueuq resurgemntuequ resurgemntequu resurgemntequu resurgemnteuqu resurgemnteuuq resurgemnteuuq resurgemnteuqu
resurgemnqtuue resurgemnqtueu resurgemnqtuue resurgemnqtueu resurgemnqteuu resurgemnqteuu resurgemnqutue resurgemnquteu
resurgemnquute resurgemnquuet resurgemnqueut resurgemnquetu resurgemnquute resurgemnquuet resurgemnqutue resurgemnquteu
resurgemnquetu resurgemnqueut resurgemnqeuut resurgemnqeutu resurgemnqeuut resurgemnqeutu resurgemnqetuu resurgemnqetuu
resurgemnutque resurgemnutqeu resurgemnutuqe resurgemnutueq resurgemnuteuq resurgemnutequ resurgemnuqtue resurgemnuqteu
resurgemnuqute resurgemnuquet resurgemnuqeut resurgemnuqetu resurgemnuuqte resurgemnuuqet resurgemnuutqe resurgemnuuteq
resurgemnuuetq resurgemnuueqt resurgemnuequt resurgemnueqtu resurgemnueuqt resurgemnueutq resurgemnuetuq resurgemnuetqu
resurgemnetquu resurgemnetquu resurgemnetuqu resurgemnetuuq resurgemnetuuq resurgemnetuqu resurgemneqtuu resurgemneqtuu
resurgemnequtu resurgemnequut resurgemnequut resurgemnequtu resurgemneuqtu resurgemneuqut resurgemneutqu resurgemneutuq
resurgemneuutq resurgemneuuqt resurgemneuqut resurgemneuqtu resurgemneuuqt resurgemneuutq resurgemneutuq resurgemneutqu
resurgemquntue resurgemqunteu resurgemqunute resurgemqunuet resurgemquneut resurgemqunetu resurgemqutnue resurgemqutneu
resurgemqutune resurgemqutuen resurgemquteun resurgemqutenu resurgemquutne resurgemquuten resurgemquunte resurgemquunet
resurgemquuent resurgemquuetn resurgemquetun resurgemquetnu resurgemqueutn resurgemqueunt resurgemquenut resurgemquentu
resurgemqnutue resurgemqnuteu resurgemqnuute resurgemqnuuet resurgemqnueut resurgemqnuetu resurgemqntuue resurgemqntueu
resurgemqntuue resurgemqntueu resurgemqnteuu resurgemqnteuu resurgemqnutue resurgemqnuteu resurgemqnuute resurgemqnuuet
resurgemqnueut resurgemqnuetu resurgemqnetuu resurgemqnetuu resurgemqneutu resurgemqneuut resurgemqneuut resurgemqneutu
resurgemqtnuue resurgemqtnueu resurgemqtnuue resurgemqtnueu resurgemqtneuu resurgemqtneuu resurgemqtunue resurgemqtuneu
resurgemqtuune resurgemqtuuen resurgemqtueun resurgemqtuenu resurgemqtuune resurgemqtuuen resurgemqtunue resurgemqtuneu
resurgemqtuenu resurgemqtueun resurgemqteuun resurgemqteunu resurgemqteuun resurgemqteunu resurgemqtenuu resurgemqtenuu
resurgemquntue resurgemqunteu resurgemqunute resurgemqunuet resurgemquneut resurgemqunetu resurgemqutnue resurgemqutneu
resurgemqutune resurgemqutuen resurgemquteun resurgemqutenu resurgemquutne resurgemquuten resurgemquunte resurgemquunet
resurgemquuent resurgemquuetn resurgemquetun resurgemquetnu resurgemqueutn resurgemqueunt resurgemquenut resurgemquentu
resurgemqentuu resurgemqentuu resurgemqenutu resurgemqenuut resurgemqenuut resurgemqenutu resurgemqetnuu resurgemqetnuu
resurgemqetunu resurgemqetuun resurgemqetuun resurgemqetunu resurgemqeutnu resurgemqeutun resurgemqeuntu resurgemqeunut
resurgemqeuunt resurgemqeuutn resurgemqeutun resurgemqeutnu resurgemqeuutn resurgemqeuunt resurgemqeunut resurgemqeuntu
resurgemuunqte resurgemuunqet resurgemuuntqe resurgemuunteq resurgemuunetq resurgemuuneqt resurgemuuqnte resurgemuuqnet
resurgemuuqtne resurgemuuqten resurgemuuqetn resurgemuuqent resurgemuutqne resurgemuutqen resurgemuutnqe resurgemuutneq
resurgemuutenq resurgemuuteqn resurgemuueqtn resurgemuueqnt resurgemuuetqn resurgemuuetnq resurgemuuentq resurgemuuenqt
resurgemunuqte resurgemunuqet resurgemunutqe resurgemunuteq resurgemunuetq resurgemunueqt resurgemunqute resurgemunquet
resurgemunqtue resurgemunqteu resurgemunqetu resurgemunqeut resurgemuntque resurgemuntqeu resurgemuntuqe resurgemuntueq
resurgemunteuq resurgemuntequ resurgemuneqtu resurgemunequt resurgemunetqu resurgemunetuq resurgemuneutq resurgemuneuqt
resurgemuqnute resurgemuqnuet resurgemuqntue resurgemuqnteu resurgemuqnetu resurgemuqneut resurgemuqunte resurgemuqunet
resurgemuqutne resurgemuquten resurgemuquetn resurgemuquent resurgemuqtune resurgemuqtuen resurgemuqtnue resurgemuqtneu
resurgemuqtenu resurgemuqteun resurgemuqeutn resurgemuqeunt resurgemuqetun resurgemuqetnu resurgemuqentu resurgemuqenut
resurgemutnque resurgemutnqeu resurgemutnuqe resurgemutnueq resurgemutneuq resurgemutnequ resurgemutqnue resurgemutqneu
resurgemutqune resurgemutquen resurgemutqeun resurgemutqenu resurgemutuqne resurgemutuqen resurgemutunqe resurgemutuneq
resurgemutuenq resurgemutueqn resurgemutequn resurgemuteqnu resurgemuteuqn resurgemuteunq resurgemutenuq resurgemutenqu
resurgemuenqtu resurgemuenqut resurgemuentqu resurgemuentuq resurgemuenutq resurgemuenuqt resurgemueqntu resurgemueqnut
resurgemueqtnu resurgemueqtun resurgemuequtn resurgemuequnt resurgemuetqnu resurgemuetqun resurgemuetnqu resurgemuetnuq
resurgemuetunq resurgemuetuqn resurgemueuqtn resurgemueuqnt resurgemueutqn resurgemueutnq resurgemueuntq resurgemueunqt
resurgemeunqut resurgemeunqtu resurgemeunuqt resurgemeunutq resurgemeuntuq resurgemeuntqu resurgemeuqnut resurgemeuqntu
resurgemeuqunt resurgemeuqutn resurgemeuqtun resurgemeuqtnu resurgemeuuqnt resurgemeuuqtn resurgemeuunqt resurgemeuuntq
resurgemeuutnq resurgemeuutqn resurgemeutqun resurgemeutqnu resurgemeutuqn resurgemeutunq resurgemeutnuq resurgemeutnqu
resurgemenuqut resurgemenuqtu resurgemenuuqt resurgemenuutq resurgemenutuq resurgemenutqu resurgemenquut resurgemenqutu
resurgemenquut resurgemenqutu resurgemenqtuu resurgemenqtuu resurgemenuqut resurgemenuqtu resurgemenuuqt resurgemenuutq
resurgemenutuq resurgemenutqu resurgementquu resurgementquu resurgementuqu resurgementuuq resurgementuuq resurgementuqu
resurgemeqnuut resurgemeqnutu resurgemeqnuut resurgemeqnutu resurgemeqntuu resurgemeqntuu resurgemequnut resurgemequntu
resurgemequunt resurgemequutn resurgemequtun resurgemequtnu resurgemequunt resurgemequutn resurgemequnut resurgemequntu
resurgemequtnu resurgemequtun resurgemeqtuun resurgemeqtunu resurgemeqtuun resurgemeqtunu resurgemeqtnuu resurgemeqtnuu
resurgemeunqut resurgemeunqtu resurgemeunuqt resurgemeunutq resurgemeuntuq resurgemeuntqu resurgemeuqnut resurgemeuqntu
resurgemeuqunt resurgemeuqutn resurgemeuqtun resurgemeuqtnu resurgemeuuqnt resurgemeuuqtn resurgemeuunqt resurgemeuuntq
resurgemeuutnq resurgemeuutqn resurgemeutqun resurgemeutqnu resurgemeutuqn resurgemeutunq resurgemeutnuq resurgemeutnqu
resurgemetnquu resurgemetnquu resurgemetnuqu resurgemetnuuq resurgemetnuuq resurgemetnuqu resurgemetqnuu resurgemetqnuu
resurgemetqunu resurgemetquun resurgemetquun resurgemetqunu resurgemetuqnu resurgemetuqun resurgemetunqu resurgemetunuq
resurgemetuunq resurgemetuuqn resurgemetuqun resurgemetuqnu resurgemetuuqn resurgemetuunq resurgemetunuq resurgemetunqu
resurgeqtumnue resurgeqtumneu resurgeqtumune resurgeqtumuen resurgeqtumeun resurgeqtumenu resurgeqtunmue resurgeqtunmeu
resurgeqtunume resurgeqtunuem resurgeqtuneum resurgeqtunemu resurgeqtuunme resurgeqtuunem resurgeqtuumne resurgeqtuumen
resurgeqtuuemn resurgeqtuuenm resurgeqtuenum resurgeqtuenmu resurgeqtueunm resurgeqtueumn resurgeqtuemun resurgeqtuemnu
resurgeqtmunue resurgeqtmuneu resurgeqtmuune resurgeqtmuuen resurgeqtmueun resurgeqtmuenu resurgeqtmnuue resurgeqtmnueu
resurgeqtmnuue resurgeqtmnueu resurgeqtmneuu resurgeqtmneuu resurgeqtmunue resurgeqtmuneu resurgeqtmuune resurgeqtmuuen
resurgeqtmueun resurgeqtmuenu resurgeqtmenuu resurgeqtmenuu resurgeqtmeunu resurgeqtmeuun resurgeqtmeuun resurgeqtmeunu
resurgeqtnmuue resurgeqtnmueu resurgeqtnmuue resurgeqtnmueu resurgeqtnmeuu resurgeqtnmeuu resurgeqtnumue resurgeqtnumeu
resurgeqtnuume resurgeqtnuuem resurgeqtnueum resurgeqtnuemu resurgeqtnuume resurgeqtnuuem resurgeqtnumue resurgeqtnumeu
resurgeqtnuemu resurgeqtnueum resurgeqtneuum resurgeqtneumu resurgeqtneuum resurgeqtneumu resurgeqtnemuu resurgeqtnemuu
resurgeqtumnue resurgeqtumneu resurgeqtumune resurgeqtumuen resurgeqtumeun resurgeqtumenu resurgeqtunmue resurgeqtunmeu
resurgeqtunume resurgeqtunuem resurgeqtuneum resurgeqtunemu resurgeqtuunme resurgeqtuunem resurgeqtuumne resurgeqtuumen
resurgeqtuuemn resurgeqtuuenm resurgeqtuenum resurgeqtuenmu resurgeqtueunm resurgeqtueumn resurgeqtuemun resurgeqtuemnu
resurgeqtemnuu resurgeqtemnuu resurgeqtemunu resurgeqtemuun resurgeqtemuun resurgeqtemunu resurgeqtenmuu resurgeqtenmuu
resurgeqtenumu resurgeqtenuum resurgeqtenuum resurgeqtenumu resurgeqteunmu resurgeqteunum resurgeqteumnu resurgeqteumun
resurgeqteuumn resurgeqteuunm resurgeqteunum resurgeqteunmu resurgeqteuunm resurgeqteuumn resurgeqteumun resurgeqteumnu
resurgequtmnue resurgequtmneu resurgequtmune resurgequtmuen resurgequtmeun resurgequtmenu resurgequtnmue resurgequtnmeu
resurgequtnume resurgequtnuem resurgequtneum resurgequtnemu resurgequtunme resurgequtunem resurgequtumne resurgequtumen
resurgequtuemn resurgequtuenm resurgequtenum resurgequtenmu resurgequteunm resurgequteumn resurgequtemun resurgequtemnu
resurgequmtnue resurgequmtneu resurgequmtune resurgequmtuen resurgequmteun resurgequmtenu resurgequmntue resurgequmnteu
resurgequmnute resurgequmnuet resurgequmneut resurgequmnetu resurgequmunte resurgequmunet resurgequmutne resurgequmuten
resurgequmuetn resurgequmuent resurgequmenut resurgequmentu resurgequmeunt resurgequmeutn resurgequmetun resurgequmetnu
resurgequnmtue resurgequnmteu resurgequnmute resurgequnmuet resurgequnmeut resurgequnmetu resurgequntmue resurgequntmeu
resurgequntume resurgequntuem resurgequnteum resurgequntemu resurgequnutme resurgequnutem resurgequnumte resurgequnumet
resurgequnuemt resurgequnuetm resurgequnetum resurgequnetmu resurgequneutm resurgequneumt resurgequnemut resurgequnemtu
resurgequumnte resurgequumnet resurgequumtne resurgequumten resurgequumetn resurgequument resurgequunmte resurgequunmet
resurgequuntme resurgequuntem resurgequunetm resurgequunemt resurgequutnme resurgequutnem resurgequutmne resurgequutmen
resurgequutemn resurgequutenm resurgequuentm resurgequuenmt resurgequuetnm resurgequuetmn resurgequuemtn resurgequuemnt
resurgequemnut resurgequemntu resurgequemunt resurgequemutn resurgequemtun resurgequemtnu resurgequenmut resurgequenmtu
resurgequenumt resurgequenutm resurgequentum resurgequentmu resurgequeunmt resurgequeuntm resurgequeumnt resurgequeumtn
resurgequeutmn resurgequeutnm resurgequetnum resurgequetnmu resurgequetunm resurgequetumn resurgequetmun resurgequetmnu
resurgeqmutnue resurgeqmutneu resurgeqmutune resurgeqmutuen resurgeqmuteun resurgeqmutenu resurgeqmuntue resurgeqmunteu
resurgeqmunute resurgeqmunuet resurgeqmuneut resurgeqmunetu resurgeqmuunte resurgeqmuunet resurgeqmuutne resurgeqmuuten
resurgeqmuuetn resurgeqmuuent resurgeqmuenut resurgeqmuentu resurgeqmueunt resurgeqmueutn resurgeqmuetun resurgeqmuetnu
resurgeqmtunue resurgeqmtuneu resurgeqmtuune resurgeqmtuuen resurgeqmtueun resurgeqmtuenu resurgeqmtnuue resurgeqmtnueu
resurgeqmtnuue resurgeqmtnueu resurgeqmtneuu resurgeqmtneuu resurgeqmtunue resurgeqmtuneu resurgeqmtuune resurgeqmtuuen
resurgeqmtueun resurgeqmtuenu resurgeqmtenuu resurgeqmtenuu resurgeqmteunu resurgeqmteuun resurgeqmteuun resurgeqmteunu
resurgeqmntuue resurgeqmntueu resurgeqmntuue resurgeqmntueu resurgeqmnteuu resurgeqmnteuu resurgeqmnutue resurgeqmnuteu
resurgeqmnuute resurgeqmnuuet resurgeqmnueut resurgeqmnuetu resurgeqmnuute resurgeqmnuuet resurgeqmnutue resurgeqmnuteu
resurgeqmnuetu resurgeqmnueut resurgeqmneuut resurgeqmneutu resurgeqmneuut resurgeqmneutu resurgeqmnetuu resurgeqmnetuu
resurgeqmutnue resurgeqmutneu resurgeqmutune resurgeqmutuen resurgeqmuteun resurgeqmutenu resurgeqmuntue resurgeqmunteu
resurgeqmunute resurgeqmunuet resurgeqmuneut resurgeqmunetu resurgeqmuunte resurgeqmuunet resurgeqmuutne resurgeqmuuten
resurgeqmuuetn resurgeqmuuent resurgeqmuenut resurgeqmuentu resurgeqmueunt resurgeqmueutn resurgeqmuetun resurgeqmuetnu
resurgeqmetnuu resurgeqmetnuu resurgeqmetunu resurgeqmetuun resurgeqmetuun resurgeqmetunu resurgeqmentuu resurgeqmentuu
resurgeqmenutu resurgeqmenuut resurgeqmenuut resurgeqmenutu resurgeqmeuntu resurgeqmeunut resurgeqmeutnu resurgeqmeutun
resurgeqmeuutn resurgeqmeuunt resurgeqmeunut resurgeqmeuntu resurgeqmeuunt resurgeqmeuutn resurgeqmeutun resurgeqmeutnu
resurgeqnumtue resurgeqnumteu resurgeqnumute resurgeqnumuet resurgeqnumeut resurgeqnumetu resurgeqnutmue resurgeqnutmeu
resurgeqnutume resurgeqnutuem resurgeqnuteum resurgeqnutemu resurgeqnuutme resurgeqnuutem resurgeqnuumte resurgeqnuumet
resurgeqnuuemt resurgeqnuuetm resurgeqnuetum resurgeqnuetmu resurgeqnueutm resurgeqnueumt resurgeqnuemut resurgeqnuemtu
resurgeqnmutue resurgeqnmuteu resurgeqnmuute resurgeqnmuuet resurgeqnmueut resurgeqnmuetu resurgeqnmtuue resurgeqnmtueu
resurgeqnmtuue resurgeqnmtueu resurgeqnmteuu resurgeqnmteuu resurgeqnmutue resurgeqnmuteu resurgeqnmuute resurgeqnmuuet
resurgeqnmueut resurgeqnmuetu resurgeqnmetuu resurgeqnmetuu resurgeqnmeutu resurgeqnmeuut resurgeqnmeuut resurgeqnmeutu
resurgeqntmuue resurgeqntmueu resurgeqntmuue resurgeqntmueu resurgeqntmeuu resurgeqntmeuu resurgeqntumue resurgeqntumeu
resurgeqntuume resurgeqntuuem resurgeqntueum resurgeqntuemu resurgeqntuume resurgeqntuuem resurgeqntumue resurgeqntumeu
resurgeqntuemu resurgeqntueum resurgeqnteuum resurgeqnteumu resurgeqnteuum resurgeqnteumu resurgeqntemuu resurgeqntemuu
resurgeqnumtue resurgeqnumteu resurgeqnumute resurgeqnumuet resurgeqnumeut resurgeqnumetu resurgeqnutmue resurgeqnutmeu
resurgeqnutume resurgeqnutuem resurgeqnuteum resurgeqnutemu resurgeqnuutme resurgeqnuutem resurgeqnuumte resurgeqnuumet
resurgeqnuuemt resurgeqnuuetm resurgeqnuetum resurgeqnuetmu resurgeqnueutm resurgeqnueumt resurgeqnuemut resurgeqnuemtu
resurgeqnemtuu resurgeqnemtuu resurgeqnemutu resurgeqnemuut resurgeqnemuut resurgeqnemutu resurgeqnetmuu resurgeqnetmuu
resurgeqnetumu resurgeqnetuum resurgeqnetuum resurgeqnetumu resurgeqneutmu resurgeqneutum resurgeqneumtu resurgeqneumut
resurgeqneuumt resurgeqneuutm resurgeqneutum resurgeqneutmu resurgeqneuutm resurgeqneuumt resurgeqneumut resurgeqneumtu
resurgequumnte resurgequumnet resurgequumtne resurgequumten resurgequumetn resurgequument resurgequunmte resurgequunmet
resurgequuntme resurgequuntem resurgequunetm resurgequunemt resurgequutnme resurgequutnem resurgequutmne resurgequutmen
resurgequutemn resurgequutenm resurgequuentm resurgequuenmt resurgequuetnm resurgequuetmn resurgequuemtn resurgequuemnt
resurgequmunte resurgequmunet resurgequmutne resurgequmuten resurgequmuetn resurgequmuent resurgequmnute resurgequmnuet
resurgequmntue resurgequmnteu resurgequmnetu resurgequmneut resurgequmtnue resurgequmtneu resurgequmtune resurgequmtuen
resurgequmteun resurgequmtenu resurgequmentu resurgequmenut resurgequmetnu resurgequmetun resurgequmeutn resurgequmeunt
resurgequnmute resurgequnmuet resurgequnmtue resurgequnmteu resurgequnmetu resurgequnmeut resurgequnumte resurgequnumet
resurgequnutme resurgequnutem resurgequnuetm resurgequnuemt resurgequntume resurgequntuem resurgequntmue resurgequntmeu
resurgequntemu resurgequnteum resurgequneutm resurgequneumt resurgequnetum resurgequnetmu resurgequnemtu resurgequnemut
resurgequtmnue resurgequtmneu resurgequtmune resurgequtmuen resurgequtmeun resurgequtmenu resurgequtnmue resurgequtnmeu
resurgequtnume resurgequtnuem resurgequtneum resurgequtnemu resurgequtunme resurgequtunem resurgequtumne resurgequtumen
resurgequtuemn resurgequtuenm resurgequtenum resurgequtenmu resurgequteunm resurgequteumn resurgequtemun resurgequtemnu
resurgequemntu resurgequemnut resurgequemtnu resurgequemtun resurgequemutn resurgequemunt resurgequenmtu resurgequenmut
resurgequentmu resurgequentum resurgequenutm resurgequenumt resurgequetnmu resurgequetnum resurgequetmnu resurgequetmun
resurgequetumn resurgequetunm resurgequeuntm resurgequeunmt resurgequeutnm resurgequeutmn resurgequeumtn resurgequeumnt
resurgeqeumnut resurgeqeumntu resurgeqeumunt resurgeqeumutn resurgeqeumtun resurgeqeumtnu resurgeqeunmut resurgeqeunmtu
resurgeqeunumt resurgeqeunutm resurgeqeuntum resurgeqeuntmu resurgeqeuunmt resurgeqeuuntm resurgeqeuumnt resurgeqeuumtn
resurgeqeuutmn resurgeqeuutnm resurgeqeutnum resurgeqeutnmu resurgeqeutunm resurgeqeutumn resurgeqeutmun resurgeqeutmnu
resurgeqemunut resurgeqemuntu resurgeqemuunt resurgeqemuutn resurgeqemutun resurgeqemutnu resurgeqemnuut resurgeqemnutu
resurgeqemnuut resurgeqemnutu resurgeqemntuu resurgeqemntuu resurgeqemunut resurgeqemuntu resurgeqemuunt resurgeqemuutn
resurgeqemutun resurgeqemutnu resurgeqemtnuu resurgeqemtnuu resurgeqemtunu resurgeqemtuun resurgeqemtuun resurgeqemtunu
resurgeqenmuut resurgeqenmutu resurgeqenmuut resurgeqenmutu resurgeqenmtuu resurgeqenmtuu resurgeqenumut resurgeqenumtu
resurgeqenuumt resurgeqenuutm resurgeqenutum resurgeqenutmu resurgeqenuumt resurgeqenuutm resurgeqenumut resurgeqenumtu
resurgeqenutmu resurgeqenutum resurgeqentuum resurgeqentumu resurgeqentuum resurgeqentumu resurgeqentmuu resurgeqentmuu
resurgeqeumnut resurgeqeumntu resurgeqeumunt resurgeqeumutn resurgeqeumtun resurgeqeumtnu resurgeqeunmut resurgeqeunmtu
resurgeqeunumt resurgeqeunutm resurgeqeuntum resurgeqeuntmu resurgeqeuunmt resurgeqeuuntm resurgeqeuumnt resurgeqeuumtn
resurgeqeuutmn resurgeqeuutnm resurgeqeutnum resurgeqeutnmu resurgeqeutunm resurgeqeutumn resurgeqeutmun resurgeqeutmnu
resurgeqetmnuu resurgeqetmnuu resurgeqetmunu resurgeqetmuun resurgeqetmuun resurgeqetmunu resurgeqetnmuu resurgeqetnmuu
resurgeqetnumu resurgeqetnuum resurgeqetnuum resurgeqetnumu resurgeqetunmu resurgeqetunum resurgeqetumnu resurgeqetumun
resurgeqetuumn resurgeqetuunm resurgeqetunum resurgeqetunmu resurgeqetuunm resurgeqetuumn resurgeqetumun resurgeqetumnu
resurgeutumqne resurgeutumqen resurgeutumnqe resurgeutumneq resurgeutumenq resurgeutumeqn resurgeutuqmne resurgeutuqmen
resurgeutuqnme resurgeutuqnem resurgeutuqenm resurgeutuqemn resurgeutunqme resurgeutunqem resurgeutunmqe resurgeutunmeq
resurgeutunemq resurgeutuneqm resurgeutueqnm resurgeutueqmn resurgeutuenqm resurgeutuenmq resurgeutuemnq resurgeutuemqn
resurgeutmuqne resurgeutmuqen resurgeutmunqe resurgeutmuneq resurgeutmuenq resurgeutmueqn resurgeutmqune resurgeutmquen
resurgeutmqnue resurgeutmqneu resurgeutmqenu resurgeutmqeun resurgeutmnque resurgeutmnqeu resurgeutmnuqe resurgeutmnueq
resurgeutmneuq resurgeutmnequ resurgeutmeqnu resurgeutmequn resurgeutmenqu resurgeutmenuq resurgeutmeunq resurgeutmeuqn
resurgeutqmune resurgeutqmuen resurgeutqmnue resurgeutqmneu resurgeutqmenu resurgeutqmeun resurgeutqumne resurgeutqumen
resurgeutqunme resurgeutqunem resurgeutquenm resurgeutquemn resurgeutqnume resurgeutqnuem resurgeutqnmue resurgeutqnmeu
resurgeutqnemu resurgeutqneum resurgeutqeunm resurgeutqeumn resurgeutqenum resurgeutqenmu resurgeutqemnu resurgeutqemun
resurgeutnmque resurgeutnmqeu resurgeutnmuqe resurgeutnmueq resurgeutnmeuq resurgeutnmequ resurgeutnqmue resurgeutnqmeu
resurgeutnqume resurgeutnquem resurgeutnqeum resurgeutnqemu resurgeutnuqme resurgeutnuqem resurgeutnumqe resurgeutnumeq
resurgeutnuemq resurgeutnueqm resurgeutnequm resurgeutneqmu resurgeutneuqm resurgeutneumq resurgeutnemuq resurgeutnemqu
resurgeutemqnu resurgeutemqun resurgeutemnqu resurgeutemnuq resurgeutemunq resurgeutemuqn resurgeuteqmnu resurgeuteqmun
resurgeuteqnmu resurgeuteqnum resurgeutequnm resurgeutequmn resurgeutenqmu resurgeutenqum resurgeutenmqu resurgeutenmuq
resurgeutenumq resurgeutenuqm resurgeuteuqnm resurgeuteuqmn resurgeuteunqm resurgeuteunmq resurgeuteumnq resurgeuteumqn
resurgeuutmqne resurgeuutmqen resurgeuutmnqe resurgeuutmneq resurgeuutmenq resurgeuutmeqn resurgeuutqmne resurgeuutqmen
resurgeuutqnme resurgeuutqnem resurgeuutqenm resurgeuutqemn resurgeuutnqme resurgeuutnqem resurgeuutnmqe resurgeuutnmeq
resurgeuutnemq resurgeuutneqm resurgeuuteqnm resurgeuuteqmn resurgeuutenqm resurgeuutenmq resurgeuutemnq resurgeuutemqn
resurgeuumtqne resurgeuumtqen resurgeuumtnqe resurgeuumtneq resurgeuumtenq resurgeuumteqn resurgeuumqtne resurgeuumqten
resurgeuumqnte resurgeuumqnet resurgeuumqent resurgeuumqetn resurgeuumnqte resurgeuumnqet resurgeuumntqe resurgeuumnteq
resurgeuumnetq resurgeuumneqt resurgeuumeqnt resurgeuumeqtn resurgeuumenqt resurgeuumentq resurgeuumetnq resurgeuumetqn
resurgeuuqmtne resurgeuuqmten resurgeuuqmnte resurgeuuqmnet resurgeuuqment resurgeuuqmetn resurgeuuqtmne resurgeuuqtmen
resurgeuuqtnme resurgeuuqtnem resurgeuuqtenm resurgeuuqtemn resurgeuuqntme resurgeuuqntem resurgeuuqnmte resurgeuuqnmet
resurgeuuqnemt resurgeuuqnetm resurgeuuqetnm resurgeuuqetmn resurgeuuqentm resurgeuuqenmt resurgeuuqemnt resurgeuuqemtn
resurgeuunmqte resurgeuunmqet resurgeuunmtqe resurgeuunmteq resurgeuunmetq resurgeuunmeqt resurgeuunqmte resurgeuunqmet
resurgeuunqtme resurgeuunqtem resurgeuunqetm resurgeuunqemt resurgeuuntqme resurgeuuntqem resurgeuuntmqe resurgeuuntmeq
resurgeuuntemq resurgeuunteqm resurgeuuneqtm resurgeuuneqmt resurgeuunetqm resurgeuunetmq resurgeuunemtq resurgeuunemqt
resurgeuuemqnt resurgeuuemqtn resurgeuuemnqt resurgeuuemntq resurgeuuemtnq resurgeuuemtqn resurgeuueqmnt resurgeuueqmtn
resurgeuueqnmt resurgeuueqntm resurgeuueqtnm resurgeuueqtmn resurgeuuenqmt resurgeuuenqtm resurgeuuenmqt resurgeuuenmtq
resurgeuuentmq resurgeuuentqm resurgeuuetqnm resurgeuuetqmn resurgeuuetnqm resurgeuuetnmq resurgeuuetmnq resurgeuuetmqn
resurgeumutqne resurgeumutqen resurgeumutnqe resurgeumutneq resurgeumutenq resurgeumuteqn resurgeumuqtne resurgeumuqten
resurgeumuqnte resurgeumuqnet resurgeumuqent resurgeumuqetn resurgeumunqte resurgeumunqet resurgeumuntqe resurgeumunteq
resurgeumunetq resurgeumuneqt resurgeumueqnt resurgeumueqtn resurgeumuenqt resurgeumuentq resurgeumuetnq resurgeumuetqn
resurgeumtuqne resurgeumtuqen resurgeumtunqe resurgeumtuneq resurgeumtuenq resurgeumtueqn resurgeumtqune resurgeumtquen
resurgeumtqnue resurgeumtqneu resurgeumtqenu resurgeumtqeun resurgeumtnque resurgeumtnqeu resurgeumtnuqe resurgeumtnueq
resurgeumtneuq resurgeumtnequ resurgeumteqnu resurgeumtequn resurgeumtenqu resurgeumtenuq resurgeumteunq resurgeumteuqn
resurgeumqtune resurgeumqtuen resurgeumqtnue resurgeumqtneu resurgeumqtenu resurgeumqteun resurgeumqutne resurgeumquten
resurgeumqunte resurgeumqunet resurgeumquent resurgeumquetn resurgeumqnute resurgeumqnuet resurgeumqntue resurgeumqnteu
resurgeumqnetu resurgeumqneut resurgeumqeunt resurgeumqeutn resurgeumqenut resurgeumqentu resurgeumqetnu resurgeumqetun
resurgeumntque resurgeumntqeu resurgeumntuqe resurgeumntueq resurgeumnteuq resurgeumntequ resurgeumnqtue resurgeumnqteu
resurgeumnqute resurgeumnquet resurgeumnqeut resurgeumnqetu resurgeumnuqte resurgeumnuqet resurgeumnutqe resurgeumnuteq
resurgeumnuetq resurgeumnueqt resurgeumnequt resurgeumneqtu resurgeumneuqt resurgeumneutq resurgeumnetuq resurgeumnetqu
resurgeumetqnu resurgeumetqun resurgeumetnqu resurgeumetnuq resurgeumetunq resurgeumetuqn resurgeumeqtnu resurgeumeqtun
resurgeumeqntu resurgeumeqnut resurgeumequnt resurgeumequtn resurgeumenqtu resurgeumenqut resurgeumentqu resurgeumentuq
resurgeumenutq resurgeumenuqt resurgeumeuqnt resurgeumeuqtn resurgeumeunqt resurgeumeuntq resurgeumeutnq resurgeumeutqn
resurgeuqumtne resurgeuqumten resurgeuqumnte resurgeuqumnet resurgeuqument resurgeuqumetn resurgeuqutmne resurgeuqutmen
resurgeuqutnme resurgeuqutnem resurgeuqutenm resurgeuqutemn resurgeuquntme resurgeuquntem resurgeuqunmte resurgeuqunmet
resurgeuqunemt resurgeuqunetm resurgeuquetnm resurgeuquetmn resurgeuquentm resurgeuquenmt resurgeuquemnt resurgeuquemtn
resurgeuqmutne resurgeuqmuten resurgeuqmunte resurgeuqmunet resurgeuqmuent resurgeuqmuetn resurgeuqmtune resurgeuqmtuen
resurgeuqmtnue resurgeuqmtneu resurgeuqmtenu resurgeuqmteun resurgeuqmntue resurgeuqmnteu resurgeuqmnute resurgeuqmnuet
resurgeuqmneut resurgeuqmnetu resurgeuqmetnu resurgeuqmetun resurgeuqmentu resurgeuqmenut resurgeuqmeunt resurgeuqmeutn
resurgeuqtmune resurgeuqtmuen resurgeuqtmnue resurgeuqtmneu resurgeuqtmenu resurgeuqtmeun resurgeuqtumne resurgeuqtumen
resurgeuqtunme resurgeuqtunem resurgeuqtuenm resurgeuqtuemn resurgeuqtnume resurgeuqtnuem resurgeuqtnmue resurgeuqtnmeu
resurgeuqtnemu resurgeuqtneum resurgeuqteunm resurgeuqteumn resurgeuqtenum resurgeuqtenmu resurgeuqtemnu resurgeuqtemun
resurgeuqnmtue resurgeuqnmteu resurgeuqnmute resurgeuqnmuet resurgeuqnmeut resurgeuqnmetu resurgeuqntmue resurgeuqntmeu
resurgeuqntume resurgeuqntuem resurgeuqnteum resurgeuqntemu resurgeuqnutme resurgeuqnutem resurgeuqnumte resurgeuqnumet
resurgeuqnuemt resurgeuqnuetm resurgeuqnetum resurgeuqnetmu resurgeuqneutm resurgeuqneumt resurgeuqnemut resurgeuqnemtu
resurgeuqemtnu resurgeuqemtun resurgeuqemntu resurgeuqemnut resurgeuqemunt resurgeuqemutn resurgeuqetmnu resurgeuqetmun
resurgeuqetnmu resurgeuqetnum resurgeuqetunm resurgeuqetumn resurgeuqentmu resurgeuqentum resurgeuqenmtu resurgeuqenmut
resurgeuqenumt resurgeuqenutm resurgeuqeutnm resurgeuqeutmn resurgeuqeuntm resurgeuqeunmt resurgeuqeumnt resurgeuqeumtn
resurgeunumqte resurgeunumqet resurgeunumtqe resurgeunumteq resurgeunumetq resurgeunumeqt resurgeunuqmte resurgeunuqmet
resurgeunuqtme resurgeunuqtem resurgeunuqetm resurgeunuqemt resurgeunutqme resurgeunutqem resurgeunutmqe resurgeunutmeq
resurgeunutemq resurgeunuteqm resurgeunueqtm resurgeunueqmt resurgeunuetqm resurgeunuetmq resurgeunuemtq resurgeunuemqt
resurgeunmuqte resurgeunmuqet resurgeunmutqe resurgeunmuteq resurgeunmuetq resurgeunmueqt resurgeunmqute resurgeunmquet
resurgeunmqtue resurgeunmqteu resurgeunmqetu resurgeunmqeut resurgeunmtque resurgeunmtqeu resurgeunmtuqe resurgeunmtueq
resurgeunmteuq resurgeunmtequ resurgeunmeqtu resurgeunmequt resurgeunmetqu resurgeunmetuq resurgeunmeutq resurgeunmeuqt
resurgeunqmute resurgeunqmuet resurgeunqmtue resurgeunqmteu resurgeunqmetu resurgeunqmeut resurgeunqumte resurgeunqumet
resurgeunqutme resurgeunqutem resurgeunquetm resurgeunquemt resurgeunqtume resurgeunqtuem resurgeunqtmue resurgeunqtmeu
resurgeunqtemu resurgeunqteum resurgeunqeutm resurgeunqeumt resurgeunqetum resurgeunqetmu resurgeunqemtu resurgeunqemut
resurgeuntmque resurgeuntmqeu resurgeuntmuqe resurgeuntmueq resurgeuntmeuq resurgeuntmequ resurgeuntqmue resurgeuntqmeu
resurgeuntqume resurgeuntquem resurgeuntqeum resurgeuntqemu resurgeuntuqme resurgeuntuqem resurgeuntumqe resurgeuntumeq
resurgeuntuemq resurgeuntueqm resurgeuntequm resurgeunteqmu resurgeunteuqm resurgeunteumq resurgeuntemuq resurgeuntemqu
resurgeunemqtu resurgeunemqut resurgeunemtqu resurgeunemtuq resurgeunemutq resurgeunemuqt resurgeuneqmtu resurgeuneqmut
resurgeuneqtmu resurgeuneqtum resurgeunequtm resurgeunequmt resurgeunetqmu resurgeunetqum resurgeunetmqu resurgeunetmuq
resurgeunetumq resurgeunetuqm resurgeuneuqtm resurgeuneuqmt resurgeuneutqm resurgeuneutmq resurgeuneumtq resurgeuneumqt
resurgeueumqnt resurgeueumqtn resurgeueumnqt resurgeueumntq resurgeueumtnq resurgeueumtqn resurgeueuqmnt resurgeueuqmtn
resurgeueuqnmt resurgeueuqntm resurgeueuqtnm resurgeueuqtmn resurgeueunqmt resurgeueunqtm resurgeueunmqt resurgeueunmtq
resurgeueuntmq resurgeueuntqm resurgeueutqnm resurgeueutqmn resurgeueutnqm resurgeueutnmq resurgeueutmnq resurgeueutmqn
resurgeuemuqnt resurgeuemuqtn resurgeuemunqt resurgeuemuntq resurgeuemutnq resurgeuemutqn resurgeuemqunt resurgeuemqutn
resurgeuemqnut resurgeuemqntu resurgeuemqtnu resurgeuemqtun resurgeuemnqut resurgeuemnqtu resurgeuemnuqt resurgeuemnutq
resurgeuemntuq resurgeuemntqu resurgeuemtqnu resurgeuemtqun resurgeuemtnqu resurgeuemtnuq resurgeuemtunq resurgeuemtuqn
resurgeueqmunt resurgeueqmutn resurgeueqmnut resurgeueqmntu resurgeueqmtnu resurgeueqmtun resurgeuequmnt resurgeuequmtn
resurgeuequnmt resurgeuequntm resurgeuequtnm resurgeuequtmn resurgeueqnumt resurgeueqnutm resurgeueqnmut resurgeueqnmtu
resurgeueqntmu resurgeueqntum resurgeueqtunm resurgeueqtumn resurgeueqtnum resurgeueqtnmu resurgeueqtmnu resurgeueqtmun
resurgeuenmqut resurgeuenmqtu resurgeuenmuqt resurgeuenmutq resurgeuenmtuq resurgeuenmtqu resurgeuenqmut resurgeuenqmtu
resurgeuenqumt resurgeuenqutm resurgeuenqtum resurgeuenqtmu resurgeuenuqmt resurgeuenuqtm resurgeuenumqt resurgeuenumtq
resurgeuenutmq resurgeuenutqm resurgeuentqum resurgeuentqmu resurgeuentuqm resurgeuentumq resurgeuentmuq resurgeuentmqu
resurgeuetmqnu resurgeuetmqun resurgeuetmnqu resurgeuetmnuq resurgeuetmunq resurgeuetmuqn resurgeuetqmnu resurgeuetqmun
resurgeuetqnmu resurgeuetqnum resurgeuetqunm resurgeuetqumn resurgeuetnqmu resurgeuetnqum resurgeuetnmqu resurgeuetnmuq
resurgeuetnumq resurgeuetnuqm resurgeuetuqnm resurgeuetuqmn resurgeuetunqm resurgeuetunmq resurgeuetumnq resurgeuetumqn
resurgeetumqun resurgeetumqnu resurgeetumuqn resurgeetumunq resurgeetumnuq resurgeetumnqu resurgeetuqmun resurgeetuqmnu
resurgeetuqumn resurgeetuqunm resurgeetuqnum resurgeetuqnmu resurgeetuuqmn resurgeetuuqnm resurgeetuumqn resurgeetuumnq
resurgeetuunmq resurgeetuunqm resurgeetunqum resurgeetunqmu resurgeetunuqm resurgeetunumq resurgeetunmuq resurgeetunmqu
resurgeetmuqun resurgeetmuqnu resurgeetmuuqn resurgeetmuunq resurgeetmunuq resurgeetmunqu resurgeetmquun resurgeetmqunu
resurgeetmquun resurgeetmqunu resurgeetmqnuu resurgeetmqnuu resurgeetmuqun resurgeetmuqnu resurgeetmuuqn resurgeetmuunq
resurgeetmunuq resurgeetmunqu resurgeetmnquu resurgeetmnquu resurgeetmnuqu resurgeetmnuuq resurgeetmnuuq resurgeetmnuqu
resurgeetqmuun resurgeetqmunu resurgeetqmuun resurgeetqmunu resurgeetqmnuu resurgeetqmnuu resurgeetqumun resurgeetqumnu
resurgeetquumn resurgeetquunm resurgeetqunum resurgeetqunmu resurgeetquumn resurgeetquunm resurgeetqumun resurgeetqumnu
resurgeetqunmu resurgeetqunum resurgeetqnuum resurgeetqnumu resurgeetqnuum resurgeetqnumu resurgeetqnmuu resurgeetqnmuu
resurgeetumqun resurgeetumqnu resurgeetumuqn resurgeetumunq resurgeetumnuq resurgeetumnqu resurgeetuqmun resurgeetuqmnu
resurgeetuqumn resurgeetuqunm resurgeetuqnum resurgeetuqnmu resurgeetuuqmn resurgeetuuqnm resurgeetuumqn resurgeetuumnq
resurgeetuunmq resurgeetuunqm resurgeetunqum resurgeetunqmu resurgeetunuqm resurgeetunumq resurgeetunmuq resurgeetunmqu
resurgeetnmquu resurgeetnmquu resurgeetnmuqu resurgeetnmuuq resurgeetnmuuq resurgeetnmuqu resurgeetnqmuu resurgeetnqmuu
resurgeetnqumu resurgeetnquum resurgeetnquum resurgeetnqumu resurgeetnuqmu resurgeetnuqum resurgeetnumqu resurgeetnumuq
resurgeetnuumq resurgeetnuuqm resurgeetnuqum resurgeetnuqmu resurgeetnuuqm resurgeetnuumq resurgeetnumuq resurgeetnumqu
resurgeeutmqun resurgeeutmqnu resurgeeutmuqn resurgeeutmunq resurgeeutmnuq resurgeeutmnqu resurgeeutqmun resurgeeutqmnu
resurgeeutqumn resurgeeutqunm resurgeeutqnum resurgeeutqnmu resurgeeutuqmn resurgeeutuqnm resurgeeutumqn resurgeeutumnq
resurgeeutunmq resurgeeutunqm resurgeeutnqum resurgeeutnqmu resurgeeutnuqm resurgeeutnumq resurgeeutnmuq resurgeeutnmqu
resurgeeumtqun resurgeeumtqnu resurgeeumtuqn resurgeeumtunq resurgeeumtnuq resurgeeumtnqu resurgeeumqtun resurgeeumqtnu
resurgeeumqutn resurgeeumqunt resurgeeumqnut resurgeeumqntu resurgeeumuqtn resurgeeumuqnt resurgeeumutqn resurgeeumutnq
resurgeeumuntq resurgeeumunqt resurgeeumnqut resurgeeumnqtu resurgeeumnuqt resurgeeumnutq resurgeeumntuq resurgeeumntqu
resurgeeuqmtun resurgeeuqmtnu resurgeeuqmutn resurgeeuqmunt resurgeeuqmnut resurgeeuqmntu resurgeeuqtmun resurgeeuqtmnu
resurgeeuqtumn resurgeeuqtunm resurgeeuqtnum resurgeeuqtnmu resurgeeuqutmn resurgeeuqutnm resurgeeuqumtn resurgeeuqumnt
resurgeeuqunmt resurgeeuquntm resurgeeuqntum resurgeeuqntmu resurgeeuqnutm resurgeeuqnumt resurgeeuqnmut resurgeeuqnmtu
resurgeeuumqtn resurgeeuumqnt resurgeeuumtqn resurgeeuumtnq resurgeeuumntq resurgeeuumnqt resurgeeuuqmtn resurgeeuuqmnt
resurgeeuuqtmn resurgeeuuqtnm resurgeeuuqntm resurgeeuuqnmt resurgeeuutqmn resurgeeuutqnm resurgeeuutmqn resurgeeuutmnq
resurgeeuutnmq resurgeeuutnqm resurgeeuunqtm resurgeeuunqmt resurgeeuuntqm resurgeeuuntmq resurgeeuunmtq resurgeeuunmqt
resurgeeunmqut resurgeeunmqtu resurgeeunmuqt resurgeeunmutq resurgeeunmtuq resurgeeunmtqu resurgeeunqmut resurgeeunqmtu
resurgeeunqumt resurgeeunqutm resurgeeunqtum resurgeeunqtmu resurgeeunuqmt resurgeeunuqtm resurgeeunumqt resurgeeunumtq
resurgeeunutmq resurgeeunutqm resurgeeuntqum resurgeeuntqmu resurgeeuntuqm resurgeeuntumq resurgeeuntmuq resurgeeuntmqu
resurgeemutqun resurgeemutqnu resurgeemutuqn resurgeemutunq resurgeemutnuq resurgeemutnqu resurgeemuqtun resurgeemuqtnu
resurgeemuqutn resurgeemuqunt resurgeemuqnut resurgeemuqntu resurgeemuuqtn resurgeemuuqnt resurgeemuutqn resurgeemuutnq
resurgeemuuntq resurgeemuunqt resurgeemunqut resurgeemunqtu resurgeemunuqt resurgeemunutq resurgeemuntuq resurgeemuntqu
resurgeemtuqun resurgeemtuqnu resurgeemtuuqn resurgeemtuunq resurgeemtunuq resurgeemtunqu resurgeemtquun resurgeemtqunu
resurgeemtquun resurgeemtqunu resurgeemtqnuu resurgeemtqnuu resurgeemtuqun resurgeemtuqnu resurgeemtuuqn resurgeemtuunq
resurgeemtunuq resurgeemtunqu resurgeemtnquu resurgeemtnquu resurgeemtnuqu resurgeemtnuuq resurgeemtnuuq resurgeemtnuqu
resurgeemqtuun resurgeemqtunu resurgeemqtuun resurgeemqtunu resurgeemqtnuu resurgeemqtnuu resurgeemqutun resurgeemqutnu
resurgeemquutn resurgeemquunt resurgeemqunut resurgeemquntu resurgeemquutn resurgeemquunt resurgeemqutun resurgeemqutnu
resurgeemquntu resurgeemqunut resurgeemqnuut resurgeemqnutu resurgeemqnuut resurgeemqnutu resurgeemqntuu resurgeemqntuu
resurgeemutqun resurgeemutqnu resurgeemutuqn resurgeemutunq resurgeemutnuq resurgeemutnqu resurgeemuqtun resurgeemuqtnu
resurgeemuqutn resurgeemuqunt resurgeemuqnut resurgeemuqntu resurgeemuuqtn resurgeemuuqnt resurgeemuutqn resurgeemuutnq
resurgeemuuntq resurgeemuunqt resurgeemunqut resurgeemunqtu resurgeemunuqt resurgeemunutq resurgeemuntuq resurgeemuntqu
resurgeemntquu resurgeemntquu resurgeemntuqu resurgeemntuuq resurgeemntuuq resurgeemntuqu resurgeemnqtuu resurgeemnqtuu
resurgeemnqutu resurgeemnquut resurgeemnquut resurgeemnqutu resurgeemnuqtu resurgeemnuqut resurgeemnutqu resurgeemnutuq
resurgeemnuutq resurgeemnuuqt resurgeemnuqut resurgeemnuqtu resurgeemnuuqt resurgeemnuutq resurgeemnutuq resurgeemnutqu
resurgeequmtun resurgeequmtnu resurgeequmutn resurgeequmunt resurgeequmnut resurgeequmntu resurgeequtmun resurgeequtmnu
resurgeequtumn resurgeequtunm resurgeequtnum resurgeequtnmu resurgeequutmn resurgeequutnm resurgeequumtn resurgeequumnt
resurgeequunmt resurgeequuntm resurgeequntum resurgeequntmu resurgeequnutm resurgeequnumt resurgeequnmut resurgeequnmtu
resurgeeqmutun resurgeeqmutnu resurgeeqmuutn resurgeeqmuunt resurgeeqmunut resurgeeqmuntu resurgeeqmtuun resurgeeqmtunu
resurgeeqmtuun resurgeeqmtunu resurgeeqmtnuu resurgeeqmtnuu resurgeeqmutun resurgeeqmutnu resurgeeqmuutn resurgeeqmuunt
resurgeeqmunut resurgeeqmuntu resurgeeqmntuu resurgeeqmntuu resurgeeqmnutu resurgeeqmnuut resurgeeqmnuut resurgeeqmnutu
resurgeeqtmuun resurgeeqtmunu resurgeeqtmuun resurgeeqtmunu resurgeeqtmnuu resurgeeqtmnuu resurgeeqtumun resurgeeqtumnu
resurgeeqtuumn resurgeeqtuunm resurgeeqtunum resurgeeqtunmu resurgeeqtuumn resurgeeqtuunm resurgeeqtumun resurgeeqtumnu
resurgeeqtunmu resurgeeqtunum resurgeeqtnuum resurgeeqtnumu resurgeeqtnuum resurgeeqtnumu resurgeeqtnmuu resurgeeqtnmuu
resurgeequmtun resurgeequmtnu resurgeequmutn resurgeequmunt resurgeequmnut resurgeequmntu resurgeequtmun resurgeequtmnu
resurgeequtumn resurgeequtunm resurgeequtnum resurgeequtnmu resurgeequutmn resurgeequutnm resurgeequumtn resurgeequumnt
resurgeequunmt resurgeequuntm resurgeequntum resurgeequntmu resurgeequnutm resurgeequnumt resurgeequnmut resurgeequnmtu
resurgeeqnmtuu resurgeeqnmtuu resurgeeqnmutu resurgeeqnmuut resurgeeqnmuut resurgeeqnmutu resurgeeqntmuu resurgeeqntmuu
resurgeeqntumu resurgeeqntuum resurgeeqntuum resurgeeqntumu resurgeeqnutmu resurgeeqnutum resurgeeqnumtu resurgeeqnumut
resurgeeqnuumt resurgeeqnuutm resurgeeqnutum resurgeeqnutmu resurgeeqnuutm resurgeeqnuumt resurgeeqnumut resurgeeqnumtu
resurgeeuumqtn resurgeeuumqnt resurgeeuumtqn resurgeeuumtnq resurgeeuumntq resurgeeuumnqt resurgeeuuqmtn resurgeeuuqmnt
resurgeeuuqtmn resurgeeuuqtnm resurgeeuuqntm resurgeeuuqnmt resurgeeuutqmn resurgeeuutqnm resurgeeuutmqn resurgeeuutmnq
resurgeeuutnmq resurgeeuutnqm resurgeeuunqtm resurgeeuunqmt resurgeeuuntqm resurgeeuuntmq resurgeeuunmtq resurgeeuunmqt
resurgeeumuqtn resurgeeumuqnt resurgeeumutqn resurgeeumutnq resurgeeumuntq resurgeeumunqt resurgeeumqutn resurgeeumqunt
resurgeeumqtun resurgeeumqtnu resurgeeumqntu resurgeeumqnut resurgeeumtqun resurgeeumtqnu resurgeeumtuqn resurgeeumtunq
resurgeeumtnuq resurgeeumtnqu resurgeeumnqtu resurgeeumnqut resurgeeumntqu resurgeeumntuq resurgeeumnutq resurgeeumnuqt
resurgeeuqmutn resurgeeuqmunt resurgeeuqmtun resurgeeuqmtnu resurgeeuqmntu resurgeeuqmnut resurgeeuqumtn resurgeeuqumnt
resurgeeuqutmn resurgeeuqutnm resurgeeuquntm resurgeeuqunmt resurgeeuqtumn resurgeeuqtunm resurgeeuqtmun resurgeeuqtmnu
resurgeeuqtnmu resurgeeuqtnum resurgeeuqnutm resurgeeuqnumt resurgeeuqntum resurgeeuqntmu resurgeeuqnmtu resurgeeuqnmut
resurgeeutmqun resurgeeutmqnu resurgeeutmuqn resurgeeutmunq resurgeeutmnuq resurgeeutmnqu resurgeeutqmun resurgeeutqmnu
resurgeeutqumn resurgeeutqunm resurgeeutqnum resurgeeutqnmu resurgeeutuqmn resurgeeutuqnm resurgeeutumqn resurgeeutumnq
resurgeeutunmq resurgeeutunqm resurgeeutnqum resurgeeutnqmu resurgeeutnuqm resurgeeutnumq resurgeeutnmuq resurgeeutnmqu
resurgeeunmqtu resurgeeunmqut resurgeeunmtqu resurgeeunmtuq resurgeeunmutq resurgeeunmuqt resurgeeunqmtu resurgeeunqmut
resurgeeunqtmu resurgeeunqtum resurgeeunqutm resurgeeunqumt resurgeeuntqmu resurgeeuntqum resurgeeuntmqu resurgeeuntmuq
resurgeeuntumq resurgeeuntuqm resurgeeunuqtm resurgeeunuqmt resurgeeunutqm resurgeeunutmq resurgeeunumtq resurgeeunumqt
resurgeenumqut resurgeenumqtu resurgeenumuqt resurgeenumutq resurgeenumtuq resurgeenumtqu resurgeenuqmut resurgeenuqmtu
resurgeenuqumt resurgeenuqutm resurgeenuqtum resurgeenuqtmu resurgeenuuqmt resurgeenuuqtm resurgeenuumqt resurgeenuumtq
resurgeenuutmq resurgeenuutqm resurgeenutqum resurgeenutqmu resurgeenutuqm resurgeenutumq resurgeenutmuq resurgeenutmqu
resurgeenmuqut resurgeenmuqtu resurgeenmuuqt resurgeenmuutq resurgeenmutuq resurgeenmutqu resurgeenmquut resurgeenmqutu
resurgeenmquut resurgeenmqutu resurgeenmqtuu resurgeenmqtuu resurgeenmuqut resurgeenmuqtu resurgeenmuuqt resurgeenmuutq
resurgeenmutuq resurgeenmutqu resurgeenmtquu resurgeenmtquu resurgeenmtuqu resurgeenmtuuq resurgeenmtuuq resurgeenmtuqu
resurgeenqmuut resurgeenqmutu resurgeenqmuut resurgeenqmutu resurgeenqmtuu resurgeenqmtuu resurgeenqumut resurgeenqumtu
resurgeenquumt resurgeenquutm resurgeenqutum resurgeenqutmu resurgeenquumt resurgeenquutm resurgeenqumut resurgeenqumtu
resurgeenqutmu resurgeenqutum resurgeenqtuum resurgeenqtumu resurgeenqtuum resurgeenqtumu resurgeenqtmuu resurgeenqtmuu
resurgeenumqut resurgeenumqtu resurgeenumuqt resurgeenumutq resurgeenumtuq resurgeenumtqu resurgeenuqmut resurgeenuqmtu
resurgeenuqumt resurgeenuqutm resurgeenuqtum resurgeenuqtmu resurgeenuuqmt resurgeenuuqtm resurgeenuumqt resurgeenuumtq
resurgeenuutmq resurgeenuutqm resurgeenutqum resurgeenutqmu resurgeenutuqm resurgeenutumq resurgeenutmuq resurgeenutmqu
resurgeentmquu resurgeentmquu resurgeentmuqu resurgeentmuuq resurgeentmuuq resurgeentmuqu resurgeentqmuu resurgeentqmuu
resurgeentqumu resurgeentquum resurgeentquum resurgeentqumu resurgeentuqmu resurgeentuqum resurgeentumqu resurgeentumuq
resurgeentuumq resurgeentuuqm resurgeentuqum resurgeentuqmu resurgeentuuqm resurgeentuumq resurgeentumuq resurgeentumqu

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us