easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

ultrarapid

infrarenal

persolvant

armourers

gwynn

beathbdp

wasteproof

klostermann

tsunoense

uncriticised

santarosabeach

interfacial

effeminandorum

omphalophlebitis

maurader

nomismata

cashmere

unsnaffled


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: refunded
cipher variations:
sfgvoefe tghwpfgf uhixqghg vijyrhih wjkzsiji
xklatjkj ylmbuklk zmncvlml anodwmnm bopexnon
cpqfyopo dqrgzpqp ershaqrq fstibrsr gtujcsts
huvkdtut ivwleuvu jwxmfvwv kxyngwxw lyzohxyx
mzapiyzy nabqjzaz obcrkaba pcdslbcb qdetmcdc

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: refunded
Cipher: ivufmwvw

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: refunded
Cipher: BAAAA AABAA AABAB BAABB ABBAA AAABB AABAA AAABB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: refunded
cipher variations:
sfgvoefeanqjoknkivaxoqvqqdklowdwyluzoclcgtenoitiwjypoujueridoara
mzsrogzguhcfomhmcpmtospskxwhoyxytghwpfgfborkploljwbyprwrrelmpxex
zmvapdmdhufopjujxkzqpvkvfsjepbsbnatsphahvidgpnindqnuptqtlyxipzyz
uhixqghgcpslqmpmkxczqsxssfmnqyfyanwbqeneivgpqkvkylarqwlwgtkfqctc
obutqibiwjehqojoerovqurumzyjqazavijyrhihdqtmrnqnlydartyttgnorzgz
boxcrfofjwhqrlwlzmbsrxmxhulgrdudpcvurjcjxkfirpkpfspwrvsvnazkrbab
wjkzsijierunsoromzebsuzuuhopsahacpydsgpgkxirsmxmanctsynyivmhseve
qdwvskdkylgjsqlqgtqxswtwobalscbcxklatjkjfsvotpspnafctvavvipqtbib
dqzethqhlyjstnynbodutzozjwnitfwfrexwtlelzmhktrmrhurytxuxpcbmtdcd
ylmbuklkgtwpuqtqobgduwbwwjqrucjcerafuirimzktuozocpevuapakxojugxg
sfyxumfmanilusnsivszuyvyqdcnuedezmncvlmlhuxqvrurpchevxcxxkrsvdkd
fsbgvjsjnaluvpapdqfwvbqblypkvhyhtgzyvngnbojmvtotjwtavzwzredovfef
anodwmnmivyrwsvsqdifwydyylstwelegtchwktkobmvwqbqergxwcrcmzqlwizi
uhazwohocpknwupukxubwaxasfepwgfgbopexnonjwzsxtwtrejgxzezzmtuxfmf
hudixlulpcnwxrcrfshyxdsdnarmxjajvibaxpipdqloxvqvlyvcxbybtgfqxhgh
cpqfyopokxatyuxusfkhyafaanuvygngivejymvmqdoxysdsgtizyeteobsnykbk
wjcbyqjqermpywrwmzwdyczcuhgryihidqrgzpqplybuzvyvtglizbgbbovwzhoh
jwfkznwnrepyztethujazfufpctozlclxkdczrkrfsnqzxsxnaxezdadvihszjij
ershaqrqmzcvawzwuhmjachccpwxaipikxglaoxosfqzaufuivkbagvgqdupamdm
yledaslsgtoraytyobyfaebewjitakjkfstibrsrnadwbxaxvinkbdiddqxybjqj
lyhmbpyptgrabvgvjwlcbhwhrevqbnenzmfebtmthupsbzuzpczgbfcfxkjublkl
gtujcstsobexcybywjolcejeeryzckrkmzincqzquhsbcwhwkxmdcixisfwrcofo
angfcunuivqtcavaqdahcgdgylkvcmlmhuvkdtutpcfydzczxkpmdfkffszadlsl
najodrarvitcdxixlynedjyjtgxsdpgpbohgdvovjwrudbwbrebidhehzmlwdnmn
ivwleuvuqdgzeadaylqneglggtabemtmobkpesbswjudeyjymzofekzkuhyteqhq
cpihewpwkxsvecxcsfcjeifianmxeonojwxmfvwvrehafbebzmrofhmhhubcfnun
pclqftctxkvefzkznapgflalvizufrirdqjifxqxlytwfdydtgdkfjgjbonyfpop
kxyngwxwsfibgcfcanspginiivcdgovoqdmrguduylwfgalaobqhgmbmwjavgsjs
erkjgyrymzuxgezeuhelgkhkcpozgqpqlyzohxyxtgjchdgdbotqhjojjwdehpwp
renshvevzmxghbmbpcrihncnxkbwhtktfslkhzsznavyhfafvifmhlildqpahrqr
mzapiyzyuhkdiehecpurikpkkxefiqxqsfotiwfwanyhicncqdsjiodoylcxiulu
gtmliataobwzigbgwjgnimjmerqbisrsnabqjzazvilejfifdqvsjlqllyfgjryr
tgpujxgxbozijdodretkjpepzmdyjvmvhunmjbubpcxajhchxkhojnknfsrcjtst
obcrkabawjmfkgjgerwtkmrmmzghkszsuhqvkyhycpajkepesfulkqfqanezkwnw
ivonkcvcqdybkidiylipkologtsdkutupcdslbcbxknglhkhfsxulnsnnahiltat
virwlzizdqbklfqftgvmlrgrbofalxoxjwpoldwdrezcljejzmjqlpmphutelvuv
qdetmcdcylohmiligtyvmotoobijmubuwjsxmajaerclmgrguhwnmshscpgbmypy
kxqpmexesfadmkfkankrmqnqivufmwvwrefundedzmpinjmjhuzwnpuppcjknvcv
xktynbkbfsdmnhshvixontitdqhcnzqzlyrqnfyftgbenlglbolsnrorjwvgnxwx

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: refunded
Cipher: ershaqrq

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: refunded
Cipher: 2451125433415141

Extended Methods:
Method #1

Plaintext: refunded
method variations:
wklzsikibpqexopoguvkctutmzaphyzy

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
r e f u n d e d 
2 5 1 5 3 4 5 4 
4 1 2 4 3 1 1 1 
They are then read out in rows:
2515345441243111
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: refunded
Cipher: wvsudrca

Read more ...
Method #3

Plaintext: refunded
method variations:
yawosvqf awosvqfy wosvqfya
osvqfyaw svqfyawo vqfyawos
qfyawosv fyawosvq

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: refunded

first 5040 cipher variations(40320 total)
refunded refundde refunedd refunedd refunded refundde refudned refudnde refudend refudedn refudden
refuddne refuednd refueddn refuendd refuendd refuednd refueddn refudden refuddne refudedn refudend
refudned refudnde refnuded refnudde refnuedd refnuedd refnuded refnudde refndued refndude refndeud
refndedu refnddeu refnddue refnedud refneddu refneudd refneudd refnedud refneddu refnddeu refnddue
refndedu refndeud refndued refndude refdnued refdnude refdneud refdnedu refdndeu refdndue refduned
refdunde refduend refduedn refduden refdudne refdeund refdeudn refdenud refdendu refdednu refdedun
refdduen refddune refddeun refddenu refddneu refddnue refendud refenddu refenudd refenudd refendud
refenddu refednud refedndu refedund refedudn refeddun refeddnu refeudnd refeuddn refeundd refeundd
refeudnd refeuddn refeddun refeddnu refedudn refedund refednud refedndu refdndeu refdndue refdnedu
refdneud refdnued refdnude refddneu refddnue refddenu refddeun refdduen refddune refdednu refdedun
refdendu refdenud refdeund refdeudn refduden refdudne refduedn refduend refduned refdunde reufnded
reufndde reufnedd reufnedd reufnded reufndde reufdned reufdnde reufdend reufdedn reufdden reufddne
reufednd reufeddn reufendd reufendd reufednd reufeddn reufdden reufddne reufdedn reufdend reufdned
reufdnde reunfded reunfdde reunfedd reunfedd reunfded reunfdde reundfed reundfde reundefd reundedf
reunddef reunddfe reunedfd reuneddf reunefdd reunefdd reunedfd reuneddf reunddef reunddfe reundedf
reundefd reundfed reundfde reudnfed reudnfde reudnefd reudnedf reudndef reudndfe reudfned reudfnde
reudfend reudfedn reudfden reudfdne reudefnd reudefdn reudenfd reudendf reudednf reudedfn reuddfen
reuddfne reuddefn reuddenf reuddnef reuddnfe reuendfd reuenddf reuenfdd reuenfdd reuendfd reuenddf
reuednfd reuedndf reuedfnd reuedfdn reueddfn reueddnf reuefdnd reuefddn reuefndd reuefndd reuefdnd
reuefddn reueddfn reueddnf reuedfdn reuedfnd reuednfd reuedndf reudndef reudndfe reudnedf reudnefd
reudnfed reudnfde reuddnef reuddnfe reuddenf reuddefn reuddfen reuddfne reudednf reudedfn reudendf
reudenfd reudefnd reudefdn reudfden reudfdne reudfedn reudfend reudfned reudfnde renufded renufdde
renufedd renufedd renufded renufdde renudfed renudfde renudefd renudedf renuddef renuddfe renuedfd
renueddf renuefdd renuefdd renuedfd renueddf renuddef renuddfe renudedf renudefd renudfed renudfde
renfuded renfudde renfuedd renfuedd renfuded renfudde renfdued renfdude renfdeud renfdedu renfddeu
renfddue renfedud renfeddu renfeudd renfeudd renfedud renfeddu renfddeu renfddue renfdedu renfdeud
renfdued renfdude rendfued rendfude rendfeud rendfedu rendfdeu rendfdue rendufed rendufde renduefd
renduedf rendudef rendudfe rendeufd rendeudf rendefud rendefdu rendedfu rendeduf rendduef renddufe
renddeuf renddefu renddfeu renddfue renefdud renefddu renefudd renefudd renefdud renefddu renedfud
renedfdu renedufd renedudf renedduf reneddfu reneudfd reneuddf reneufdd reneufdd reneudfd reneuddf
renedduf reneddfu renedudf renedufd renedfud renedfdu rendfdeu rendfdue rendfedu rendfeud rendfued
rendfude renddfeu renddfue renddefu renddeuf rendduef renddufe rendedfu rendeduf rendefdu rendefud
rendeufd rendeudf rendudef rendudfe renduedf renduefd rendufed rendufde redunfed redunfde redunefd
redunedf redundef redundfe redufned redufnde redufend redufedn redufden redufdne reduefnd reduefdn
reduenfd reduendf reduednf reduedfn redudfen redudfne redudefn redudenf redudnef redudnfe rednufed
rednufde rednuefd rednuedf rednudef rednudfe rednfued rednfude rednfeud rednfedu rednfdeu rednfdue
rednefud rednefdu redneufd redneudf redneduf rednedfu redndfeu redndfue redndefu redndeuf rednduef
redndufe redfnued redfnude redfneud redfnedu redfndeu redfndue redfuned redfunde redfuend redfuedn
redfuden redfudne redfeund redfeudn redfenud redfendu redfednu redfedun redfduen redfdune redfdeun
redfdenu redfdneu redfdnue redenfud redenfdu redenufd redenudf redenduf redendfu redefnud redefndu
redefund redefudn redefdun redefdnu redeufnd redeufdn redeunfd redeundf redeudnf redeudfn rededfun
rededfnu rededufn rededunf redednuf redednfu reddnfeu reddnfue reddnefu reddneuf reddnuef reddnufe
reddfneu reddfnue reddfenu reddfeun reddfuen reddfune reddefnu reddefun reddenfu reddenuf reddeunf
reddeufn reddufen reddufne redduefn redduenf reddunef reddunfe reeundfd reeunddf reeunfdd reeunfdd
reeundfd reeunddf reeudnfd reeudndf reeudfnd reeudfdn reeuddfn reeuddnf reeufdnd reeufddn reeufndd
reeufndd reeufdnd reeufddn reeuddfn reeuddnf reeudfdn reeudfnd reeudnfd reeudndf reenudfd reenuddf
reenufdd reenufdd reenudfd reenuddf reendufd reendudf reendfud reendfdu reenddfu reendduf reenfdud
reenfddu reenfudd reenfudd reenfdud reenfddu reenddfu reendduf reendfdu reendfud reendufd reendudf
reednufd reednudf reednfud reednfdu reedndfu reednduf reedunfd reedundf reedufnd reedufdn reedudfn
reedudnf reedfund reedfudn reedfnud reedfndu reedfdnu reedfdun reeddufn reeddunf reeddfun reeddfnu
reeddnfu reeddnuf reefndud reefnddu reefnudd reefnudd reefndud reefnddu reefdnud reefdndu reefdund
reefdudn reefddun reefddnu reefudnd reefuddn reefundd reefundd reefudnd reefuddn reefddun reefddnu
reefdudn reefdund reefdnud reefdndu reedndfu reednduf reednfdu reednfud reednufd reednudf reeddnfu
reeddnuf reeddfnu reeddfun reeddufn reeddunf reedfdnu reedfdun reedfndu reedfnud reedfund reedfudn
reedudfn reedudnf reedufdn reedufnd reedunfd reedundf redundef redundfe redunedf redunefd redunfed
redunfde redudnef redudnfe redudenf redudefn redudfen redudfne reduednf reduedfn reduendf reduenfd
reduefnd reduefdn redufden redufdne redufedn redufend redufned redufnde rednudef rednudfe rednuedf
rednuefd rednufed rednufde rednduef redndufe redndeuf redndefu redndfeu redndfue redneduf rednedfu
redneudf redneufd rednefud rednefdu rednfdeu rednfdue rednfedu rednfeud rednfued rednfude reddnuef
reddnufe reddneuf reddnefu reddnfeu reddnfue reddunef reddunfe redduenf redduefn reddufen reddufne
reddeunf reddeufn reddenuf reddenfu reddefnu reddefun reddfuen reddfune reddfeun reddfenu reddfneu
reddfnue redenduf redendfu redenudf redenufd redenfud redenfdu redednuf redednfu rededunf rededufn
rededfun rededfnu redeudnf redeudfn redeundf redeunfd redeufnd redeufdn redefdun redefdnu redefudn
redefund redefnud redefndu redfndeu redfndue redfnedu redfneud redfnued redfnude redfdneu redfdnue
redfdenu redfdeun redfduen redfdune redfednu redfedun redfendu redfenud redfeund redfeudn redfuden
redfudne redfuedn redfuend redfuned redfunde rfeunded rfeundde rfeunedd rfeunedd rfeunded rfeundde
rfeudned rfeudnde rfeudend rfeudedn rfeudden rfeuddne rfeuednd rfeueddn rfeuendd rfeuendd rfeuednd
rfeueddn rfeudden rfeuddne rfeudedn rfeudend rfeudned rfeudnde rfenuded rfenudde rfenuedd rfenuedd
rfenuded rfenudde rfendued rfendude rfendeud rfendedu rfenddeu rfenddue rfenedud rfeneddu rfeneudd
rfeneudd rfenedud rfeneddu rfenddeu rfenddue rfendedu rfendeud rfendued rfendude rfednued rfednude
rfedneud rfednedu rfedndeu rfedndue rfeduned rfedunde rfeduend rfeduedn rfeduden rfedudne rfedeund
rfedeudn rfedenud rfedendu rfedednu rfededun rfedduen rfeddune rfeddeun rfeddenu rfeddneu rfeddnue
rfeendud rfeenddu rfeenudd rfeenudd rfeendud rfeenddu rfeednud rfeedndu rfeedund rfeedudn rfeeddun
rfeeddnu rfeeudnd rfeeuddn rfeeundd rfeeundd rfeeudnd rfeeuddn rfeeddun rfeeddnu rfeedudn rfeedund
rfeednud rfeedndu rfedndeu rfedndue rfednedu rfedneud rfednued rfednude rfeddneu rfeddnue rfeddenu
rfeddeun rfedduen rfeddune rfedednu rfededun rfedendu rfedenud rfedeund rfedeudn rfeduden rfedudne
rfeduedn rfeduend rfeduned rfedunde rfuended rfuendde rfuenedd rfuenedd rfuended rfuendde rfuedned
rfuednde rfuedend rfuededn rfuedden rfueddne rfueednd rfueeddn rfueendd rfueendd rfueednd rfueeddn
rfuedden rfueddne rfuededn rfuedend rfuedned rfuednde rfuneded rfunedde rfuneedd rfuneedd rfuneded
rfunedde rfundeed rfundede rfundeed rfundede rfunddee rfunddee rfuneded rfunedde rfuneedd rfuneedd
rfuneded rfunedde rfunddee rfunddee rfundede rfundeed rfundeed rfundede rfudneed rfudnede rfudneed
rfudnede rfudndee rfudndee rfudened rfudende rfudeend rfudeedn rfudeden rfudedne rfudeend rfudeedn
rfudened rfudende rfudedne rfudeden rfuddeen rfuddene rfuddeen rfuddene rfuddnee rfuddnee rfuended
rfuendde rfuenedd rfuenedd rfuended rfuendde rfuedned rfuednde rfuedend rfuededn rfuedden rfueddne
rfueednd rfueeddn rfueendd rfueendd rfueednd rfueeddn rfuedden rfueddne rfuededn rfuedend rfuedned
rfuednde rfudndee rfudndee rfudnede rfudneed rfudneed rfudnede rfuddnee rfuddnee rfuddene rfuddeen
rfuddeen rfuddene rfudedne rfudeden rfudende rfudened rfudeend rfudeedn rfudeden rfudedne rfudeedn
rfudeend rfudened rfudende rfnueded rfnuedde rfnueedd rfnueedd rfnueded rfnuedde rfnudeed rfnudede
rfnudeed rfnudede rfnuddee rfnuddee rfnueded rfnuedde rfnueedd rfnueedd rfnueded rfnuedde rfnuddee
rfnuddee rfnudede rfnudeed rfnudeed rfnudede rfneuded rfneudde rfneuedd rfneuedd rfneuded rfneudde
rfnedued rfnedude rfnedeud rfnededu rfneddeu rfneddue rfneedud rfneeddu rfneeudd rfneeudd rfneedud
rfneeddu rfneddeu rfneddue rfnededu rfnedeud rfnedued rfnedude rfndeued rfndeude rfndeeud rfndeedu
rfndedeu rfndedue rfndueed rfnduede rfndueed rfnduede rfndudee rfndudee rfndeued rfndeude rfndeeud
rfndeedu rfndedeu rfndedue rfndduee rfndduee rfnddeue rfnddeeu rfnddeeu rfnddeue rfneedud rfneeddu
rfneeudd rfneeudd rfneedud rfneeddu rfnedeud rfnededu rfnedued rfnedude rfneddue rfneddeu rfneuded
rfneudde rfneuedd rfneuedd rfneuded rfneudde rfneddue rfneddeu rfnedude rfnedued rfnedeud rfnededu
rfndedeu rfndedue rfndeedu rfndeeud rfndeued rfndeude rfnddeeu rfnddeue rfnddeeu rfnddeue rfndduee
rfndduee rfndedeu rfndedue rfndeedu rfndeeud rfndeued rfndeude rfndudee rfndudee rfnduede rfndueed
rfndueed rfnduede rfduneed rfdunede rfduneed rfdunede rfdundee rfdundee rfduened rfduende rfdueend
rfdueedn rfdueden rfduedne rfdueend rfdueedn rfduened rfduende rfduedne rfdueden rfdudeen rfdudene
rfdudeen rfdudene rfdudnee rfdudnee rfdnueed rfdnuede rfdnueed rfdnuede rfdnudee rfdnudee rfdneued
rfdneude rfdneeud rfdneedu rfdnedeu rfdnedue rfdneeud rfdneedu rfdneued rfdneude rfdnedue rfdnedeu
rfdndeeu rfdndeue rfdndeeu rfdndeue rfdnduee rfdnduee rfdenued rfdenude rfdeneud rfdenedu rfdendeu
rfdendue rfdeuned rfdeunde rfdeuend rfdeuedn rfdeuden rfdeudne rfdeeund rfdeeudn rfdeenud rfdeendu
rfdeednu rfdeedun rfdeduen rfdedune rfdedeun rfdedenu rfdedneu rfdednue rfdeneud rfdenedu rfdenued
rfdenude rfdendue rfdendeu rfdeenud rfdeendu rfdeeund rfdeeudn rfdeedun rfdeednu rfdeuend rfdeuedn
rfdeuned rfdeunde rfdeudne rfdeuden rfdedeun rfdedenu rfdeduen rfdedune rfdednue rfdedneu rfddneeu
rfddneue rfddneeu rfddneue rfddnuee rfddnuee rfddeneu rfddenue rfddeenu rfddeeun rfddeuen rfddeune
rfddeenu rfddeeun rfddeneu rfddenue rfddeune rfddeuen rfddueen rfdduene rfddueen rfdduene rfddunee
rfddunee rfeunded rfeundde rfeunedd rfeunedd rfeunded rfeundde rfeudned rfeudnde rfeudend rfeudedn
rfeudden rfeuddne rfeuednd rfeueddn rfeuendd rfeuendd rfeuednd rfeueddn rfeudden rfeuddne rfeudedn
rfeudend rfeudned rfeudnde rfenuded rfenudde rfenuedd rfenuedd rfenuded rfenudde rfendued rfendude
rfendeud rfendedu rfenddeu rfenddue rfenedud rfeneddu rfeneudd rfeneudd rfenedud rfeneddu rfenddeu
rfenddue rfendedu rfendeud rfendued rfendude rfednued rfednude rfedneud rfednedu rfedndeu rfedndue
rfeduned rfedunde rfeduend rfeduedn rfeduden rfedudne rfedeund rfedeudn rfedenud rfedendu rfedednu
rfededun rfedduen rfeddune rfeddeun rfeddenu rfeddneu rfeddnue rfeendud rfeenddu rfeenudd rfeenudd
rfeendud rfeenddu rfeednud rfeedndu rfeedund rfeedudn rfeeddun rfeeddnu rfeeudnd rfeeuddn rfeeundd
rfeeundd rfeeudnd rfeeuddn rfeeddun rfeeddnu rfeedudn rfeedund rfeednud rfeedndu rfedndeu rfedndue
rfednedu rfedneud rfednued rfednude rfeddneu rfeddnue rfeddenu rfeddeun rfedduen rfeddune rfedednu
rfededun rfedendu rfedenud rfedeund rfedeudn rfeduden rfedudne rfeduedn rfeduend rfeduned rfedunde
rfdundee rfdundee rfdunede rfduneed rfduneed rfdunede rfdudnee rfdudnee rfdudene rfdudeen rfdudeen
rfdudene rfduedne rfdueden rfduende rfduened rfdueend rfdueedn rfdueden rfduedne rfdueedn rfdueend
rfduened rfduende rfdnudee rfdnudee rfdnuede rfdnueed rfdnueed rfdnuede rfdnduee rfdnduee rfdndeue
rfdndeeu rfdndeeu rfdndeue rfdnedue rfdnedeu rfdneude rfdneued rfdneeud rfdneedu rfdnedeu rfdnedue
rfdneedu rfdneeud rfdneued rfdneude rfddnuee rfddnuee rfddneue rfddneeu rfddneeu rfddneue rfddunee
rfddunee rfdduene rfddueen rfddueen rfdduene rfddeune rfddeuen rfddenue rfddeneu rfddeenu rfddeeun
rfddeuen rfddeune rfddeeun rfddeenu rfddeneu rfddenue rfdendue rfdendeu rfdenude rfdenued rfdeneud
rfdenedu rfdednue rfdedneu rfdedune rfdeduen rfdedeun rfdedenu rfdeudne rfdeuden rfdeunde rfdeuned
rfdeuend rfdeuedn rfdeedun rfdeednu rfdeeudn rfdeeund rfdeenud rfdeendu rfdendeu rfdendue rfdenedu
rfdeneud rfdenued rfdenude rfdedneu rfdednue rfdedenu rfdedeun rfdeduen rfdedune rfdeednu rfdeedun
rfdeendu rfdeenud rfdeeund rfdeeudn rfdeuden rfdeudne rfdeuedn rfdeuend rfdeuned rfdeunde rufended
rufendde rufenedd rufenedd rufended rufendde rufedned rufednde rufedend rufededn rufedden rufeddne
rufeednd rufeeddn rufeendd rufeendd rufeednd rufeeddn rufedden rufeddne rufededn rufedend rufedned
rufednde rufneded rufnedde rufneedd rufneedd rufneded rufnedde rufndeed rufndede rufndeed rufndede
rufnddee rufnddee rufneded rufnedde rufneedd rufneedd rufneded rufnedde rufnddee rufnddee rufndede
rufndeed rufndeed rufndede rufdneed rufdnede rufdneed rufdnede rufdndee rufdndee rufdened rufdende
rufdeend rufdeedn rufdeden rufdedne rufdeend rufdeedn rufdened rufdende rufdedne rufdeden rufddeen
rufddene rufddeen rufddene rufddnee rufddnee rufended rufendde rufenedd rufenedd rufended rufendde
rufedned rufednde rufedend rufededn rufedden rufeddne rufeednd rufeeddn rufeendd rufeendd rufeednd
rufeeddn rufedden rufeddne rufededn rufedend rufedned rufednde rufdndee rufdndee rufdnede rufdneed
rufdneed rufdnede rufddnee rufddnee rufddene rufddeen rufddeen rufddene rufdedne rufdeden rufdende
rufdened rufdeend rufdeedn rufdeden rufdedne rufdeedn rufdeend rufdened rufdende ruefnded ruefndde
ruefnedd ruefnedd ruefnded ruefndde ruefdned ruefdnde ruefdend ruefdedn ruefdden ruefddne ruefednd
ruefeddn ruefendd ruefendd ruefednd ruefeddn ruefdden ruefddne ruefdedn ruefdend ruefdned ruefdnde
ruenfded ruenfdde ruenfedd ruenfedd ruenfded ruenfdde ruendfed ruendfde ruendefd ruendedf ruenddef
ruenddfe ruenedfd rueneddf ruenefdd ruenefdd ruenedfd rueneddf ruenddef ruenddfe ruendedf ruendefd
ruendfed ruendfde ruednfed ruednfde ruednefd ruednedf ruedndef ruedndfe ruedfned ruedfnde ruedfend
ruedfedn ruedfden ruedfdne ruedefnd ruedefdn ruedenfd ruedendf ruedednf ruededfn rueddfen rueddfne
rueddefn rueddenf rueddnef rueddnfe rueendfd rueenddf rueenfdd rueenfdd rueendfd rueenddf rueednfd
rueedndf rueedfnd rueedfdn rueeddfn rueeddnf rueefdnd rueefddn rueefndd rueefndd rueefdnd rueefddn
rueeddfn rueeddnf rueedfdn rueedfnd rueednfd rueedndf ruedndef ruedndfe ruednedf ruednefd ruednfed
ruednfde rueddnef rueddnfe rueddenf rueddefn rueddfen rueddfne ruedednf ruededfn ruedendf ruedenfd
ruedefnd ruedefdn ruedfden ruedfdne ruedfedn ruedfend ruedfned ruedfnde runefded runefdde runefedd
runefedd runefded runefdde runedfed runedfde runedefd runededf runeddef runeddfe runeedfd runeeddf
runeefdd runeefdd runeedfd runeeddf runeddef runeddfe runededf runedefd runedfed runedfde runfeded
runfedde runfeedd runfeedd runfeded runfedde runfdeed runfdede runfdeed runfdede runfddee runfddee
runfeded runfedde runfeedd runfeedd runfeded runfedde runfddee runfddee runfdede runfdeed runfdeed
runfdede rundfeed rundfede rundfeed rundfede rundfdee rundfdee rundefed rundefde rundeefd rundeedf
rundedef rundedfe rundeefd rundeedf rundefed rundefde rundedfe rundedef runddeef runddefe runddeef
runddefe runddfee runddfee runefded runefdde runefedd runefedd runefded runefdde runedfed runedfde
runedefd runededf runeddef runeddfe runeedfd runeeddf runeefdd runeefdd runeedfd runeeddf runeddef
runeddfe runededf runedefd runedfed runedfde rundfdee rundfdee rundfede rundfeed rundfeed rundfede
runddfee runddfee runddefe runddeef runddeef runddefe rundedfe rundedef rundefde rundefed rundeefd
rundeedf rundedef rundedfe rundeedf rundeefd rundefed rundefde rudenfed rudenfde rudenefd rudenedf
rudendef rudendfe rudefned rudefnde rudefend rudefedn rudefden rudefdne rudeefnd rudeefdn rudeenfd
rudeendf rudeednf rudeedfn rudedfen rudedfne rudedefn rudedenf rudednef rudednfe rudnefed rudnefde
rudneefd rudneedf rudnedef rudnedfe rudnfeed rudnfede rudnfeed rudnfede rudnfdee rudnfdee rudnefed
rudnefde rudneefd rudneedf rudnedef rudnedfe rudndfee rudndfee rudndefe rudndeef rudndeef rudndefe
rudfneed rudfnede rudfneed rudfnede rudfndee rudfndee rudfened rudfende rudfeend rudfeedn rudfeden
rudfedne rudfeend rudfeedn rudfened rudfende rudfedne rudfeden rudfdeen rudfdene rudfdeen rudfdene
rudfdnee rudfdnee rudenfed rudenfde rudenefd rudenedf rudendef rudendfe rudefned rudefnde rudefend
rudefedn rudefden rudefdne rudeefnd rudeefdn rudeenfd rudeendf rudeednf rudeedfn rudedfen rudedfne
rudedefn rudedenf rudednef rudednfe ruddnfee ruddnfee ruddnefe ruddneef ruddneef ruddnefe ruddfnee
ruddfnee ruddfene ruddfeen ruddfeen ruddfene ruddefne ruddefen ruddenfe ruddenef ruddeenf ruddeefn
ruddefen ruddefne ruddeefn ruddeenf ruddenef ruddenfe rueendfd rueenddf rueenfdd rueenfdd rueendfd
rueenddf rueednfd rueedndf rueedfnd rueedfdn rueeddfn rueeddnf rueefdnd rueefddn rueefndd rueefndd
rueefdnd rueefddn rueeddfn rueeddnf rueedfdn rueedfnd rueednfd rueedndf ruenedfd rueneddf ruenefdd
ruenefdd ruenedfd rueneddf ruendefd ruendedf ruendfed ruendfde ruenddfe ruenddef ruenfded ruenfdde
ruenfedd ruenfedd ruenfded ruenfdde ruenddfe ruenddef ruendfde ruendfed ruendefd ruendedf ruednefd
ruednedf ruednfed ruednfde ruedndfe ruedndef ruedenfd ruedendf ruedefnd ruedefdn ruededfn ruedednf
ruedfend ruedfedn ruedfned ruedfnde ruedfdne ruedfden rueddefn rueddenf rueddfen rueddfne rueddnfe
rueddnef ruefnded ruefndde ruefnedd ruefnedd ruefnded ruefndde ruefdned ruefdnde ruefdend ruefdedn
ruefdden ruefddne ruefednd ruefeddn ruefendd ruefendd ruefednd ruefeddn ruefdden ruefddne ruefdedn
ruefdend ruefdned ruefdnde ruedndfe ruedndef ruednfde ruednfed ruednefd ruednedf rueddnfe rueddnef
rueddfne rueddfen rueddefn rueddenf ruedfdne ruedfden ruedfnde ruedfned ruedfend ruedfedn ruededfn
ruedednf ruedefdn ruedefnd ruedenfd ruedendf rudendef rudendfe rudenedf rudenefd rudenfed rudenfde
rudednef rudednfe rudedenf rudedefn rudedfen rudedfne rudeednf rudeedfn rudeendf rudeenfd rudeefnd
rudeefdn rudefden rudefdne rudefedn rudefend rudefned rudefnde rudnedef rudnedfe rudneedf rudneefd
rudnefed rudnefde rudndeef rudndefe rudndeef rudndefe rudndfee rudndfee rudnedef rudnedfe rudneedf
rudneefd rudnefed rudnefde rudnfdee rudnfdee rudnfede rudnfeed rudnfeed rudnfede ruddneef ruddnefe
ruddneef ruddnefe ruddnfee ruddnfee ruddenef ruddenfe ruddeenf ruddeefn ruddefen ruddefne ruddeenf
ruddeefn ruddenef ruddenfe ruddefne ruddefen ruddfeen ruddfene ruddfeen ruddfene ruddfnee ruddfnee
rudendef rudendfe rudenedf rudenefd rudenfed rudenfde rudednef rudednfe rudedenf rudedefn rudedfen
rudedfne rudeednf rudeedfn rudeendf rudeenfd rudeefnd rudeefdn rudefden rudefdne rudefedn rudefend
rudefned rudefnde rudfndee rudfndee rudfnede rudfneed rudfneed rudfnede rudfdnee rudfdnee rudfdene
rudfdeen rudfdeen rudfdene rudfedne rudfeden rudfende rudfened rudfeend rudfeedn rudfeden rudfedne
rudfeedn rudfeend rudfened rudfende rnfueded rnfuedde rnfueedd rnfueedd rnfueded rnfuedde rnfudeed
rnfudede rnfudeed rnfudede rnfuddee rnfuddee rnfueded rnfuedde rnfueedd rnfueedd rnfueded rnfuedde
rnfuddee rnfuddee rnfudede rnfudeed rnfudeed rnfudede rnfeuded rnfeudde rnfeuedd rnfeuedd rnfeuded
rnfeudde rnfedued rnfedude rnfedeud rnfededu rnfeddeu rnfeddue rnfeedud rnfeeddu rnfeeudd rnfeeudd
rnfeedud rnfeeddu rnfeddeu rnfeddue rnfededu rnfedeud rnfedued rnfedude rnfdeued rnfdeude rnfdeeud
rnfdeedu rnfdedeu rnfdedue rnfdueed rnfduede rnfdueed rnfduede rnfdudee rnfdudee rnfdeued rnfdeude
rnfdeeud rnfdeedu rnfdedeu rnfdedue rnfdduee rnfdduee rnfddeue rnfddeeu rnfddeeu rnfddeue rnfeedud
rnfeeddu rnfeeudd rnfeeudd rnfeedud rnfeeddu rnfedeud rnfededu rnfedued rnfedude rnfeddue rnfeddeu
rnfeuded rnfeudde rnfeuedd rnfeuedd rnfeuded rnfeudde rnfeddue rnfeddeu rnfedude rnfedued rnfedeud
rnfededu rnfdedeu rnfdedue rnfdeedu rnfdeeud rnfdeued rnfdeude rnfddeeu rnfddeue rnfddeeu rnfddeue
rnfdduee rnfdduee rnfdedeu rnfdedue rnfdeedu rnfdeeud rnfdeued rnfdeude rnfdudee rnfdudee rnfduede
rnfdueed rnfdueed rnfduede rnufeded rnufedde rnufeedd rnufeedd rnufeded rnufedde rnufdeed rnufdede
rnufdeed rnufdede rnufddee rnufddee rnufeded rnufedde rnufeedd rnufeedd rnufeded rnufedde rnufddee
rnufddee rnufdede rnufdeed rnufdeed rnufdede rnuefded rnuefdde rnuefedd rnuefedd rnuefded rnuefdde
rnuedfed rnuedfde rnuedefd rnuededf rnueddef rnueddfe rnueedfd rnueeddf rnueefdd rnueefdd rnueedfd
rnueeddf rnueddef rnueddfe rnuededf rnuedefd rnuedfed rnuedfde rnudefed rnudefde rnudeefd rnudeedf
rnudedef rnudedfe rnudfeed rnudfede rnudfeed rnudfede rnudfdee rnudfdee rnudefed rnudefde rnudeefd
rnudeedf rnudedef rnudedfe rnuddfee rnuddfee rnuddefe rnuddeef rnuddeef rnuddefe rnueedfd rnueeddf
rnueefdd rnueefdd rnueedfd rnueeddf rnuedefd rnuededf rnuedfed rnuedfde rnueddfe rnueddef rnuefded
rnuefdde rnuefedd rnuefedd rnuefded rnuefdde rnueddfe rnueddef rnuedfde rnuedfed rnuedefd rnuededf
rnudedef rnudedfe rnudeedf rnudeefd rnudefed rnudefde rnuddeef rnuddefe rnuddeef rnuddefe rnuddfee
rnuddfee rnudedef rnudedfe rnudeedf rnudeefd rnudefed rnudefde rnudfdee rnudfdee rnudfede rnudfeed
rnudfeed rnudfede rneufded rneufdde rneufedd rneufedd rneufded rneufdde rneudfed rneudfde rneudefd
rneudedf rneuddef rneuddfe rneuedfd rneueddf rneuefdd rneuefdd rneuedfd rneueddf rneuddef rneuddfe
rneudedf rneudefd rneudfed rneudfde rnefuded rnefudde rnefuedd rnefuedd rnefuded rnefudde rnefdued
rnefdude rnefdeud rnefdedu rnefddeu rnefddue rnefedud rnefeddu rnefeudd rnefeudd rnefedud rnefeddu
rnefddeu rnefddue rnefdedu rnefdeud rnefdued rnefdude rnedfued rnedfude rnedfeud rnedfedu rnedfdeu
rnedfdue rnedufed rnedufde rneduefd rneduedf rnedudef rnedudfe rnedeufd rnedeudf rnedefud rnedefdu
rnededfu rnededuf rnedduef rneddufe rneddeuf rneddefu rneddfeu rneddfue rneefdud rneefddu rneefudd
rneefudd rneefdud rneefddu rneedfud rneedfdu rneedufd rneedudf rneedduf rneeddfu rneeudfd rneeuddf
rneeufdd rneeufdd rneeudfd rneeuddf rneedduf rneeddfu rneedudf rneedufd rneedfud rneedfdu rnedfdeu
rnedfdue rnedfedu rnedfeud rnedfued rnedfude rneddfeu rneddfue rneddefu rneddeuf rnedduef rneddufe
rnededfu rnededuf rnedefdu rnedefud rnedeufd rnedeudf rnedudef rnedudfe rneduedf rneduefd rnedufed
rnedufde rnduefed rnduefde rndueefd rndueedf rnduedef rnduedfe rndufeed rndufede rndufeed rndufede
rndufdee rndufdee rnduefed rnduefde rndueefd rndueedf rnduedef rnduedfe rndudfee rndudfee rndudefe
rndudeef rndudeef rndudefe rndeufed rndeufde rndeuefd rndeuedf rndeudef rndeudfe rndefued rndefude
rndefeud rndefedu rndefdeu rndefdue rndeefud rndeefdu rndeeufd rndeeudf rndeeduf rndeedfu rndedfeu
rndedfue rndedefu rndedeuf rndeduef rndedufe rndfeued rndfeude rndfeeud rndfeedu rndfedeu rndfedue
rndfueed rndfuede rndfueed rndfuede rndfudee rndfudee rndfeued rndfeude rndfeeud rndfeedu rndfedeu
rndfedue rndfduee rndfduee rndfdeue rndfdeeu rndfdeeu rndfdeue rndeefud rndeefdu rndeeufd rndeeudf
rndeeduf rndeedfu rndefeud rndefedu rndefued rndefude rndefdue rndefdeu rndeufed rndeufde rndeuefd
rndeuedf rndeudef rndeudfe rndedfue rndedfeu rndedufe rndeduef rndedeuf rndedefu rnddefeu rnddefue
rnddeefu rnddeeuf rnddeuef rnddeufe rnddfeeu rnddfeue rnddfeeu rnddfeue rnddfuee rnddfuee rnddefeu
rnddefue rnddeefu rnddeeuf rnddeuef rnddeufe rnddufee rnddufee rndduefe rnddueef rnddueef rndduefe
rneuedfd rneueddf rneuefdd rneuefdd rneuedfd rneueddf rneudefd rneudedf rneudfed rneudfde rneuddfe
rneuddef rneufded rneufdde rneufedd rneufedd rneufded rneufdde rneuddfe rneuddef rneudfde rneudfed
rneudefd rneudedf rneeudfd rneeuddf rneeufdd rneeufdd rneeudfd rneeuddf rneedufd rneedudf rneedfud
rneedfdu rneeddfu rneedduf rneefdud rneefddu rneefudd rneefudd rneefdud rneefddu rneeddfu rneedduf
rneedfdu rneedfud rneedufd rneedudf rnedeufd rnedeudf rnedefud rnedefdu rnededfu rnededuf rneduefd
rneduedf rnedufed rnedufde rnedudfe rnedudef rnedfued rnedfude rnedfeud rnedfedu rnedfdeu rnedfdue
rneddufe rnedduef rneddfue rneddfeu rneddefu rneddeuf rnefedud rnefeddu rnefeudd rnefeudd rnefedud
rnefeddu rnefdeud rnefdedu rnefdued rnefdude rnefddue rnefddeu rnefuded rnefudde rnefuedd rnefuedd
rnefuded rnefudde rnefddue rnefddeu rnefdude rnefdued rnefdeud rnefdedu rnededfu rnededuf rnedefdu
rnedefud rnedeufd rnedeudf rneddefu rneddeuf rneddfeu rneddfue rneddufe rnedduef rnedfdeu rnedfdue
rnedfedu rnedfeud rnedfued rnedfude rnedudfe rnedudef rnedufde rnedufed rneduefd rneduedf rnduedef
rnduedfe rndueedf rndueefd rnduefed rnduefde rndudeef rndudefe rndudeef rndudefe rndudfee rndudfee
rnduedef rnduedfe rndueedf rndueefd rnduefed rnduefde rndufdee rndufdee rndufede rndufeed rndufeed
rndufede rndeudef rndeudfe rndeuedf rndeuefd rndeufed rndeufde rndeduef rndedufe rndedeuf rndedefu
rndedfeu rndedfue rndeeduf rndeedfu rndeeudf rndeeufd rndeefud rndeefdu rndefdeu rndefdue rndefedu
rndefeud rndefued rndefude rnddeuef rnddeufe rnddeeuf rnddeefu rnddefeu rnddefue rnddueef rndduefe
rnddueef rndduefe rnddufee rnddufee rnddeuef rnddeufe rnddeeuf rnddeefu rnddefeu rnddefue rnddfuee
rnddfuee rnddfeue rnddfeeu rnddfeeu rnddfeue rndeeduf rndeedfu rndeeudf rndeeufd rndeefud rndeefdu
rndedeuf rndedefu rndeduef rndedufe rndedfue rndedfeu rndeudef rndeudfe rndeuedf rndeuefd rndeufed
rndeufde rndefdue rndefdeu rndefude rndefued rndefeud rndefedu rndfedeu rndfedue rndfeedu rndfeeud
rndfeued rndfeude rndfdeeu rndfdeue rndfdeeu rndfdeue rndfduee rndfduee rndfedeu rndfedue rndfeedu
rndfeeud rndfeued rndfeude rndfudee rndfudee rndfuede rndfueed rndfueed rndfuede rdfuneed rdfunede
rdfuneed rdfunede rdfundee rdfundee rdfuened rdfuende rdfueend rdfueedn rdfueden rdfuedne rdfueend
rdfueedn rdfuened rdfuende rdfuedne rdfueden rdfudeen rdfudene rdfudeen rdfudene rdfudnee rdfudnee
rdfnueed rdfnuede rdfnueed rdfnuede rdfnudee rdfnudee rdfneued rdfneude rdfneeud rdfneedu rdfnedeu
rdfnedue rdfneeud rdfneedu rdfneued rdfneude rdfnedue rdfnedeu rdfndeeu rdfndeue rdfndeeu rdfndeue
rdfnduee rdfnduee rdfenued rdfenude rdfeneud rdfenedu rdfendeu rdfendue rdfeuned rdfeunde rdfeuend
rdfeuedn rdfeuden rdfeudne rdfeeund rdfeeudn rdfeenud rdfeendu rdfeednu rdfeedun rdfeduen rdfedune
rdfedeun rdfedenu rdfedneu rdfednue rdfeneud rdfenedu rdfenued rdfenude rdfendue rdfendeu rdfeenud
rdfeendu rdfeeund rdfeeudn rdfeedun rdfeednu rdfeuend rdfeuedn rdfeuned rdfeunde rdfeudne rdfeuden
rdfedeun rdfedenu rdfeduen rdfedune rdfednue rdfedneu rdfdneeu rdfdneue rdfdneeu rdfdneue rdfdnuee
rdfdnuee rdfdeneu rdfdenue rdfdeenu rdfdeeun rdfdeuen rdfdeune rdfdeenu rdfdeeun rdfdeneu rdfdenue
rdfdeune rdfdeuen rdfdueen rdfduene rdfdueen rdfduene rdfdunee rdfdunee rdufneed rdufnede rdufneed
rdufnede rdufndee rdufndee rdufened rdufende rdufeend rdufeedn rdufeden rdufedne rdufeend rdufeedn
rdufened rdufende rdufedne rdufeden rdufdeen rdufdene rdufdeen rdufdene rdufdnee rdufdnee rdunfeed
rdunfede rdunfeed rdunfede rdunfdee rdunfdee rdunefed rdunefde rduneefd rduneedf rdunedef rdunedfe
rduneefd rduneedf rdunefed rdunefde rdunedfe rdunedef rdundeef rdundefe rdundeef rdundefe rdundfee
rdundfee rduenfed rduenfde rduenefd rduenedf rduendef rduendfe rduefned rduefnde rduefend rduefedn
rduefden rduefdne rdueefnd rdueefdn rdueenfd rdueendf rdueednf rdueedfn rduedfen rduedfne rduedefn
rduedenf rduednef rduednfe rduenefd rduenedf rduenfed rduenfde rduendfe rduendef rdueenfd rdueendf
rdueefnd rdueefdn rdueedfn rdueednf rduefend rduefedn rduefned rduefnde rduefdne rduefden rduedefn
rduedenf rduedfen rduedfne rduednfe rduednef rdudneef rdudnefe rdudneef rdudnefe rdudnfee rdudnfee
rdudenef rdudenfe rdudeenf rdudeefn rdudefen rdudefne rdudeenf rdudeefn rdudenef rdudenfe rdudefne
rdudefen rdudfeen rdudfene rdudfeen rdudfene rdudfnee rdudfnee rdnufeed rdnufede rdnufeed rdnufede
rdnufdee rdnufdee rdnuefed rdnuefde rdnueefd rdnueedf rdnuedef rdnuedfe rdnueefd rdnueedf rdnuefed
rdnuefde rdnuedfe rdnuedef rdnudeef rdnudefe rdnudeef rdnudefe rdnudfee rdnudfee rdnfueed rdnfuede
rdnfueed rdnfuede rdnfudee rdnfudee rdnfeued rdnfeude rdnfeeud rdnfeedu rdnfedeu rdnfedue rdnfeeud
rdnfeedu rdnfeued rdnfeude rdnfedue rdnfedeu rdnfdeeu rdnfdeue rdnfdeeu rdnfdeue rdnfduee rdnfduee
rdnefued rdnefude rdnefeud rdnefedu rdnefdeu rdnefdue rdneufed rdneufde rdneuefd rdneuedf rdneudef
rdneudfe rdneeufd rdneeudf rdneefud rdneefdu rdneedfu rdneeduf rdneduef rdnedufe rdnedeuf rdnedefu
rdnedfeu rdnedfue rdnefeud rdnefedu rdnefued rdnefude rdnefdue rdnefdeu rdneefud rdneefdu rdneeufd
rdneeudf rdneeduf rdneedfu rdneuefd rdneuedf rdneufed rdneufde rdneudfe rdneudef rdnedeuf rdnedefu
rdneduef rdnedufe rdnedfue rdnedfeu rdndfeeu rdndfeue rdndfeeu rdndfeue rdndfuee rdndfuee rdndefeu
rdndefue rdndeefu rdndeeuf rdndeuef rdndeufe rdndeefu rdndeeuf rdndefeu rdndefue rdndeufe rdndeuef
rdndueef rdnduefe rdndueef rdnduefe rdndufee rdndufee rdeunfed rdeunfde rdeunefd rdeunedf rdeundef
rdeundfe rdeufned rdeufnde rdeufend rdeufedn rdeufden rdeufdne rdeuefnd rdeuefdn rdeuenfd rdeuendf
rdeuednf rdeuedfn rdeudfen rdeudfne rdeudefn rdeudenf rdeudnef rdeudnfe rdenufed rdenufde rdenuefd
rdenuedf rdenudef rdenudfe rdenfued rdenfude rdenfeud rdenfedu rdenfdeu rdenfdue rdenefud rdenefdu
rdeneufd rdeneudf rdeneduf rdenedfu rdendfeu rdendfue rdendefu rdendeuf rdenduef rdendufe rdefnued
rdefnude rdefneud rdefnedu rdefndeu rdefndue rdefuned rdefunde rdefuend rdefuedn rdefuden rdefudne
rdefeund rdefeudn rdefenud rdefendu rdefednu rdefedun rdefduen rdefdune rdefdeun rdefdenu rdefdneu
rdefdnue rdeenfud rdeenfdu rdeenufd rdeenudf rdeenduf rdeendfu rdeefnud rdeefndu rdeefund rdeefudn
rdeefdun rdeefdnu rdeeufnd rdeeufdn rdeeunfd rdeeundf rdeeudnf rdeeudfn rdeedfun rdeedfnu rdeedufn
rdeedunf rdeednuf rdeednfu rdednfeu rdednfue rdednefu rdedneuf rdednuef rdednufe rdedfneu rdedfnue
rdedfenu rdedfeun rdedfuen rdedfune rdedefnu rdedefun rdedenfu rdedenuf rdedeunf rdedeufn rdedufen
rdedufne rdeduefn rdeduenf rdedunef rdedunfe rdeunefd rdeunedf rdeunfed rdeunfde rdeundfe rdeundef
rdeuenfd rdeuendf rdeuefnd rdeuefdn rdeuedfn rdeuednf rdeufend rdeufedn rdeufned rdeufnde rdeufdne
rdeufden rdeudefn rdeudenf rdeudfen rdeudfne rdeudnfe rdeudnef rdenuefd rdenuedf rdenufed rdenufde
rdenudfe rdenudef rdeneufd rdeneudf rdenefud rdenefdu rdenedfu rdeneduf rdenfeud rdenfedu rdenfued
rdenfude rdenfdue rdenfdeu rdendefu rdendeuf rdendfeu rdendfue rdendufe rdenduef rdeenufd rdeenudf
rdeenfud rdeenfdu rdeendfu rdeenduf rdeeunfd rdeeundf rdeeufnd rdeeufdn rdeeudfn rdeeudnf rdeefund
rdeefudn rdeefnud rdeefndu rdeefdnu rdeefdun rdeedufn rdeedunf rdeedfun rdeedfnu rdeednfu rdeednuf
rdefneud rdefnedu rdefnued rdefnude rdefndue rdefndeu rdefenud rdefendu rdefeund rdefeudn rdefedun
rdefednu rdefuend rdefuedn rdefuned rdefunde rdefudne rdefuden rdefdeun rdefdenu rdefduen rdefdune
rdefdnue rdefdneu rdednefu rdedneuf rdednfeu rdednfue rdednufe rdednuef rdedenfu rdedenuf rdedefnu
rdedefun rdedeufn rdedeunf rdedfenu rdedfeun rdedfneu rdedfnue rdedfune rdedfuen rdeduefn rdeduenf
rdedufen rdedufne rdedunfe rdedunef rdduneef rddunefe rdduneef rddunefe rddunfee rddunfee rdduenef
rdduenfe rddueenf rddueefn rdduefen rdduefne rddueenf rddueefn rdduenef rdduenfe rdduefne rdduefen
rddufeen rddufene rddufeen rddufene rddufnee rddufnee rddnueef rddnuefe rddnueef rddnuefe rddnufee
rddnufee rddneuef rddneufe rddneeuf rddneefu rddnefeu rddnefue rddneeuf rddneefu rddneuef rddneufe
rddnefue rddnefeu rddnfeeu rddnfeue rddnfeeu rddnfeue rddnfuee rddnfuee rddenuef rddenufe rddeneuf
rddenefu rddenfeu rddenfue rddeunef rddeunfe rddeuenf rddeuefn rddeufen rddeufne rddeeunf rddeeufn
rddeenuf rddeenfu rddeefnu rddeefun rddefuen rddefune rddefeun rddefenu rddefneu rddefnue rddeneuf
rddenefu rddenuef rddenufe rddenfue rddenfeu rddeenuf rddeenfu rddeeunf rddeeufn rddeefun rddeefnu
rddeuenf rddeuefn rddeunef rddeunfe rddeufne rddeufen rddefeun rddefenu rddefuen rddefune rddefnue
rddefneu rddfneeu rddfneue rddfneeu rddfneue rddfnuee rddfnuee rddfeneu rddfenue rddfeenu rddfeeun
rddfeuen rddfeune rddfeenu rddfeeun rddfeneu rddfenue rddfeune rddfeuen rddfueen rddfuene rddfueen
rddfuene rddfunee rddfunee refunded refundde refunedd refunedd refunded refundde refudned refudnde
refudend refudedn refudden refuddne refuednd refueddn refuendd refuendd refuednd refueddn refudden
refuddne refudedn refudend refudned refudnde refnuded refnudde refnuedd refnuedd refnuded refnudde
refndued refndude refndeud refndedu refnddeu refnddue refnedud refneddu refneudd refneudd refnedud
refneddu refnddeu refnddue refndedu refndeud refndued refndude refdnued refdnude refdneud refdnedu
refdndeu refdndue refduned refdunde refduend refduedn refduden refdudne refdeund refdeudn refdenud
refdendu refdednu refdedun refdduen refddune refddeun refddenu refddneu refddnue refendud refenddu
refenudd refenudd refendud refenddu refednud refedndu refedund refedudn refeddun refeddnu refeudnd
refeuddn refeundd refeundd refeudnd refeuddn refeddun refeddnu refedudn refedund refednud refedndu
refdndeu refdndue refdnedu refdneud refdnued refdnude refddneu refddnue refddenu refddeun refdduen
refddune refdednu refdedun refdendu refdenud refdeund refdeudn refduden refdudne refduedn refduend
refduned refdunde reufnded reufndde reufnedd reufnedd reufnded reufndde reufdned reufdnde reufdend
reufdedn reufdden reufddne reufednd reufeddn reufendd reufendd reufednd reufeddn reufdden reufddne
reufdedn reufdend reufdned reufdnde reunfded reunfdde reunfedd reunfedd reunfded reunfdde reundfed
reundfde reundefd reundedf reunddef reunddfe reunedfd reuneddf reunefdd reunefdd reunedfd reuneddf
reunddef reunddfe reundedf reundefd reundfed reundfde reudnfed reudnfde reudnefd reudnedf reudndef
reudndfe reudfned reudfnde reudfend reudfedn reudfden reudfdne reudefnd reudefdn reudenfd reudendf
reudednf reudedfn reuddfen reuddfne reuddefn reuddenf reuddnef reuddnfe reuendfd reuenddf reuenfdd
reuenfdd reuendfd reuenddf reuednfd reuedndf reuedfnd reuedfdn reueddfn reueddnf reuefdnd reuefddn
reuefndd reuefndd reuefdnd reuefddn reueddfn reueddnf reuedfdn reuedfnd reuednfd reuedndf reudndef
reudndfe reudnedf reudnefd reudnfed reudnfde reuddnef reuddnfe reuddenf reuddefn reuddfen reuddfne
reudednf reudedfn reudendf reudenfd reudefnd reudefdn reudfden reudfdne reudfedn reudfend reudfned
reudfnde renufded renufdde renufedd renufedd renufded renufdde renudfed renudfde renudefd renudedf
renuddef renuddfe renuedfd renueddf renuefdd renuefdd renuedfd renueddf renuddef renuddfe renudedf
renudefd renudfed renudfde renfuded renfudde renfuedd renfuedd renfuded renfudde renfdued renfdude
renfdeud renfdedu renfddeu renfddue renfedud renfeddu renfeudd renfeudd renfedud renfeddu renfddeu
renfddue renfdedu renfdeud renfdued renfdude rendfued rendfude rendfeud rendfedu rendfdeu rendfdue
rendufed rendufde renduefd renduedf rendudef rendudfe rendeufd rendeudf rendefud rendefdu rendedfu
rendeduf rendduef renddufe renddeuf renddefu renddfeu renddfue renefdud renefddu renefudd renefudd
renefdud renefddu renedfud renedfdu renedufd renedudf renedduf reneddfu reneudfd reneuddf reneufdd
reneufdd reneudfd reneuddf renedduf reneddfu renedudf renedufd renedfud renedfdu rendfdeu rendfdue
rendfedu rendfeud rendfued rendfude renddfeu renddfue renddefu renddeuf rendduef renddufe rendedfu
rendeduf rendefdu rendefud rendeufd rendeudf rendudef rendudfe renduedf renduefd rendufed rendufde
redunfed redunfde redunefd redunedf redundef redundfe redufned redufnde redufend redufedn redufden
redufdne reduefnd reduefdn reduenfd reduendf reduednf reduedfn redudfen redudfne redudefn redudenf
redudnef redudnfe rednufed rednufde rednuefd rednuedf rednudef rednudfe rednfued rednfude rednfeud
rednfedu rednfdeu rednfdue rednefud rednefdu redneufd redneudf redneduf rednedfu redndfeu redndfue
redndefu redndeuf rednduef redndufe redfnued redfnude redfneud redfnedu redfndeu redfndue redfuned
redfunde redfuend redfuedn redfuden redfudne redfeund redfeudn redfenud redfendu redfednu redfedun
redfduen redfdune redfdeun redfdenu redfdneu redfdnue redenfud redenfdu redenufd redenudf redenduf
redendfu redefnud redefndu redefund redefudn redefdun redefdnu redeufnd redeufdn redeunfd redeundf
redeudnf redeudfn rededfun rededfnu rededufn rededunf redednuf redednfu reddnfeu reddnfue reddnefu
reddneuf reddnuef reddnufe reddfneu reddfnue reddfenu reddfeun reddfuen reddfune reddefnu reddefun
reddenfu reddenuf reddeunf reddeufn reddufen reddufne redduefn redduenf reddunef reddunfe reeundfd
reeunddf reeunfdd reeunfdd reeundfd reeunddf reeudnfd reeudndf reeudfnd reeudfdn reeuddfn reeuddnf
reeufdnd reeufddn reeufndd reeufndd reeufdnd reeufddn reeuddfn reeuddnf reeudfdn reeudfnd reeudnfd
reeudndf reenudfd reenuddf reenufdd reenufdd reenudfd reenuddf reendufd reendudf reendfud reendfdu
reenddfu reendduf reenfdud reenfddu reenfudd reenfudd reenfdud reenfddu reenddfu reendduf reendfdu
reendfud reendufd reendudf reednufd reednudf reednfud reednfdu reedndfu reednduf reedunfd reedundf
reedufnd reedufdn reedudfn reedudnf reedfund reedfudn reedfnud reedfndu reedfdnu reedfdun reeddufn
reeddunf reeddfun reeddfnu reeddnfu reeddnuf reefndud reefnddu reefnudd reefnudd reefndud reefnddu
reefdnud reefdndu reefdund reefdudn reefddun reefddnu reefudnd reefuddn reefundd reefundd reefudnd
reefuddn reefddun reefddnu reefdudn reefdund reefdnud reefdndu reedndfu reednduf reednfdu reednfud
reednufd reednudf reeddnfu reeddnuf reeddfnu reeddfun reeddufn reeddunf reedfdnu reedfdun reedfndu
reedfnud reedfund reedfudn reedudfn reedudnf reedufdn reedufnd reedunfd reedundf redundef redundfe
redunedf redunefd redunfed redunfde redudnef redudnfe redudenf redudefn redudfen redudfne reduednf
reduedfn reduendf reduenfd reduefnd reduefdn redufden redufdne redufedn redufend redufned redufnde
rednudef rednudfe rednuedf rednuefd rednufed rednufde rednduef redndufe redndeuf redndefu redndfeu
redndfue redneduf rednedfu redneudf redneufd rednefud rednefdu rednfdeu rednfdue rednfedu rednfeud
rednfued rednfude reddnuef reddnufe reddneuf reddnefu reddnfeu reddnfue reddunef reddunfe redduenf
redduefn reddufen reddufne reddeunf reddeufn reddenuf reddenfu reddefnu reddefun reddfuen reddfune
reddfeun reddfenu reddfneu reddfnue redenduf redendfu redenudf redenufd redenfud redenfdu redednuf
redednfu rededunf rededufn rededfun rededfnu redeudnf redeudfn redeundf redeunfd redeufnd redeufdn
redefdun redefdnu redefudn redefund redefnud redefndu redfndeu redfndue redfnedu redfneud redfnued
redfnude redfdneu redfdnue redfdenu redfdeun redfduen redfdune redfednu redfedun redfendu redfenud
redfeund redfeudn redfuden redfudne redfuedn redfuend redfuned redfunde rdfundee rdfundee rdfunede
rdfuneed rdfuneed rdfunede rdfudnee rdfudnee rdfudene rdfudeen rdfudeen rdfudene rdfuedne rdfueden
rdfuende rdfuened rdfueend rdfueedn rdfueden rdfuedne rdfueedn rdfueend rdfuened rdfuende rdfnudee
rdfnudee rdfnuede rdfnueed rdfnueed rdfnuede rdfnduee rdfnduee rdfndeue rdfndeeu rdfndeeu rdfndeue
rdfnedue rdfnedeu rdfneude rdfneued rdfneeud rdfneedu rdfnedeu rdfnedue rdfneedu rdfneeud rdfneued
rdfneude rdfdnuee rdfdnuee rdfdneue rdfdneeu rdfdneeu rdfdneue rdfdunee rdfdunee rdfduene rdfdueen
rdfdueen rdfduene rdfdeune rdfdeuen rdfdenue rdfdeneu rdfdeenu rdfdeeun rdfdeuen rdfdeune rdfdeeun
rdfdeenu rdfdeneu rdfdenue rdfendue rdfendeu rdfenude rdfenued rdfeneud rdfenedu rdfednue rdfedneu
rdfedune rdfeduen rdfedeun rdfedenu rdfeudne rdfeuden rdfeunde rdfeuned rdfeuend rdfeuedn rdfeedun
rdfeednu rdfeeudn rdfeeund rdfeenud rdfeendu rdfendeu rdfendue rdfenedu rdfeneud rdfenued rdfenude
rdfedneu rdfednue rdfedenu rdfedeun rdfeduen rdfedune rdfeednu rdfeedun rdfeendu rdfeenud rdfeeund
rdfeeudn rdfeuden rdfeudne rdfeuedn rdfeuend rdfeuned rdfeunde rdufndee rdufndee rdufnede rdufneed
rdufneed rdufnede rdufdnee rdufdnee rdufdene rdufdeen rdufdeen rdufdene rdufedne rdufeden rdufende
rdufened rdufeend rdufeedn rdufeden rdufedne rdufeedn rdufeend rdufened rdufende rdunfdee rdunfdee
rdunfede rdunfeed rdunfeed rdunfede rdundfee rdundfee rdundefe rdundeef rdundeef rdundefe rdunedfe
rdunedef rdunefde rdunefed rduneefd rduneedf rdunedef rdunedfe rduneedf rduneefd rdunefed rdunefde
rdudnfee rdudnfee rdudnefe rdudneef rdudneef rdudnefe rdudfnee rdudfnee rdudfene rdudfeen rdudfeen
rdudfene rdudefne rdudefen rdudenfe rdudenef rdudeenf rdudeefn rdudefen rdudefne rdudeefn rdudeenf
rdudenef rdudenfe rduendfe rduendef rduenfde rduenfed rduenefd rduenedf rduednfe rduednef rduedfne
rduedfen rduedefn rduedenf rduefdne rduefden rduefnde rduefned rduefend rduefedn rdueedfn rdueednf
rdueefdn rdueefnd rdueenfd rdueendf rduendef rduendfe rduenedf rduenefd rduenfed rduenfde rduednef
rduednfe rduedenf rduedefn rduedfen rduedfne rdueednf rdueedfn rdueendf rdueenfd rdueefnd rdueefdn
rduefden rduefdne rduefedn rduefend rduefned rduefnde rdnufdee rdnufdee rdnufede rdnufeed rdnufeed
rdnufede rdnudfee rdnudfee rdnudefe rdnudeef rdnudeef rdnudefe rdnuedfe rdnuedef rdnuefde rdnuefed
rdnueefd rdnueedf rdnuedef rdnuedfe rdnueedf rdnueefd rdnuefed rdnuefde rdnfudee rdnfudee rdnfuede
rdnfueed rdnfueed rdnfuede rdnfduee rdnfduee rdnfdeue rdnfdeeu rdnfdeeu rdnfdeue rdnfedue rdnfedeu
rdnfeude rdnfeued rdnfeeud rdnfeedu rdnfedeu rdnfedue rdnfeedu rdnfeeud rdnfeued rdnfeude rdndfuee
rdndfuee rdndfeue rdndfeeu rdndfeeu rdndfeue rdndufee rdndufee rdnduefe rdndueef rdndueef rdnduefe
rdndeufe rdndeuef rdndefue rdndefeu rdndeefu rdndeeuf rdndeuef rdndeufe rdndeeuf rdndeefu rdndefeu
rdndefue rdnefdue rdnefdeu rdnefude rdnefued rdnefeud rdnefedu rdnedfue rdnedfeu rdnedufe rdneduef
rdnedeuf rdnedefu rdneudfe rdneudef rdneufde rdneufed rdneuefd rdneuedf rdneeduf rdneedfu rdneeudf
rdneeufd rdneefud rdneefdu rdnefdeu rdnefdue rdnefedu rdnefeud rdnefued rdnefude rdnedfeu rdnedfue
rdnedefu rdnedeuf rdneduef rdnedufe rdneedfu rdneeduf rdneefdu rdneefud rdneeufd rdneeudf rdneudef
rdneudfe rdneuedf rdneuefd rdneufed rdneufde rddunfee rddunfee rddunefe rdduneef rdduneef rddunefe
rddufnee rddufnee rddufene rddufeen rddufeen rddufene rdduefne rdduefen rdduenfe rdduenef rddueenf
rddueefn rdduefen rdduefne rddueefn rddueenf rdduenef rdduenfe rddnufee rddnufee rddnuefe rddnueef
rddnueef rddnuefe rddnfuee rddnfuee rddnfeue rddnfeeu rddnfeeu rddnfeue rddnefue rddnefeu rddneufe
rddneuef rddneeuf rddneefu rddnefeu rddnefue rddneefu rddneeuf rddneuef rddneufe rddfnuee rddfnuee
rddfneue rddfneeu rddfneeu rddfneue rddfunee rddfunee rddfuene rddfueen rddfueen rddfuene rddfeune
rddfeuen rddfenue rddfeneu rddfeenu rddfeeun rddfeuen rddfeune rddfeeun rddfeenu rddfeneu rddfenue
rddenfue rddenfeu rddenufe rddenuef rddeneuf rddenefu rddefnue rddefneu rddefune rddefuen rddefeun
rddefenu rddeufne rddeufen rddeunfe rddeunef rddeuenf rddeuefn rddeefun rddeefnu rddeeufn rddeeunf
rddeenuf rddeenfu rddenfeu rddenfue rddenefu rddeneuf rddenuef rddenufe rddefneu rddefnue rddefenu
rddefeun rddefuen rddefune rddeefnu rddeefun rddeenfu rddeenuf rddeeunf rddeeufn rddeufen rddeufne
rddeuefn rddeuenf rddeunef rddeunfe rdeundfe rdeundef rdeunfde rdeunfed rdeunefd rdeunedf rdeudnfe
rdeudnef rdeudfne rdeudfen rdeudefn rdeudenf rdeufdne rdeufden rdeufnde rdeufned rdeufend rdeufedn
rdeuedfn rdeuednf rdeuefdn rdeuefnd rdeuenfd rdeuendf rdenudfe rdenudef rdenufde rdenufed rdenuefd
rdenuedf rdendufe rdenduef rdendfue rdendfeu rdendefu rdendeuf rdenfdue rdenfdeu rdenfude rdenfued
rdenfeud rdenfedu rdenedfu rdeneduf rdenefdu rdenefud rdeneufd rdeneudf rdednufe rdednuef rdednfue
rdednfeu rdednefu rdedneuf rdedunfe rdedunef rdedufne rdedufen rdeduefn rdeduenf rdedfune rdedfuen
rdedfnue rdedfneu rdedfenu rdedfeun rdedeufn rdedeunf rdedefun rdedefnu rdedenfu rdedenuf rdefndue
rdefndeu rdefnude rdefnued rdefneud rdefnedu rdefdnue rdefdneu rdefdune rdefduen rdefdeun rdefdenu
rdefudne rdefuden rdefunde rdefuned rdefuend rdefuedn rdefedun rdefednu rdefeudn rdefeund rdefenud
rdefendu rdeendfu rdeenduf rdeenfdu rdeenfud rdeenufd rdeenudf rdeednfu rdeednuf rdeedfnu rdeedfun
rdeedufn rdeedunf rdeefdnu rdeefdun rdeefndu rdeefnud rdeefund rdeefudn rdeeudfn rdeeudnf rdeeufdn
rdeeufnd rdeeunfd rdeeundf rdeundef rdeundfe rdeunedf rdeunefd rdeunfed rdeunfde rdeudnef rdeudnfe
rdeudenf rdeudefn rdeudfen rdeudfne rdeuednf rdeuedfn rdeuendf rdeuenfd rdeuefnd rdeuefdn rdeufden
rdeufdne rdeufedn rdeufend rdeufned rdeufnde rdenudef rdenudfe rdenuedf rdenuefd rdenufed rdenufde
rdenduef rdendufe rdendeuf rdendefu rdendfeu rdendfue rdeneduf rdenedfu rdeneudf rdeneufd rdenefud
rdenefdu rdenfdeu rdenfdue rdenfedu rdenfeud rdenfued rdenfude rdednuef rdednufe rdedneuf rdednefu
rdednfeu rdednfue rdedunef rdedunfe rdeduenf rdeduefn rdedufen rdedufne rdedeunf rdedeufn rdedenuf
rdedenfu rdedefnu rdedefun rdedfuen rdedfune rdedfeun rdedfenu rdedfneu rdedfnue rdeenduf rdeendfu
rdeenudf rdeenufd rdeenfud rdeenfdu rdeednuf rdeednfu rdeedunf rdeedufn rdeedfun rdeedfnu rdeeudnf
rdeeudfn rdeeundf rdeeunfd rdeeufnd rdeeufdn rdeefdun rdeefdnu rdeefudn rdeefund rdeefnud rdeefndu
rdefndeu rdefndue rdefnedu rdefneud rdefnued rdefnude rdefdneu rdefdnue rdefdenu rdefdeun rdefduen
rdefdune rdefednu rdefedun rdefendu rdefenud rdefeund rdefeudn rdefuden rdefudne rdefuedn rdefuend
rdefuned rdefunde

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us