easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

maisonette

unhallowedness

renegaded

unswing

deceptamque

unduloid

vestigially

olenolin

warouter

yancey

pilewski

ventucci

expletives

tyndaridis

informers

wantoned

underwhistle

microcystis


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: referentque
cipher variations:
sfgfsfourvf tghgtgpvswg uhihuhqwtxh vijivirxuyi wjkjwjsyvzj
xklkxktzwak ylmlyluaxbl zmnmzmvbycm anonanwczdn bopoboxdaeo
cpqpcpyebfp dqrqdqzfcgq ersreragdhr fstsfsbheis gtutgtcifjt
huvuhudjgku ivwvivekhlv jwxwjwflimw kxyxkxgmjnx lyzylyhnkoy
mzazmziolpz nabanajpmqa obcbobkqnrb pcdcpclrosc qdedqdmsptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: referentque
Cipher: ivuvivmgjfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: referentque
Cipher: BAAAA AABAA AABAB AABAA BAAAA AABAA ABBAA BAABA ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: referentque
cipher variations:
sfgfsfourvfanqnanogxjnivavivosdxvqdkdqdoejldylulyloqpzlgtetgtocvntwjyjwjoahpjerireromndr
mzszmzoytrzuhchuhokzfhcpmpcpowftpkxwxkxoilhxtghgtgpvswgborobophykojwbwjwpteywrelerepfkme
zmvmzmprqamhufuhupdwouxkzkxkpbiqkfsjsfspnoesnatanapzusavidiviplagidqnqdqpxguqlyxylypjmiy
uhihuhqwtxhcpspcpqizlpkxcxkxqufzxsfmfsfqglnfanwnanqsrbnivgvivqexpvylalylqcjrlgtktgtqopft
obubobqavtbwjejwjqmbhjerorerqyhvrmzyzmzqknjzvijivirxuyidqtqdqrjamqlydylyrvgaytgngtgrhmog
boxobortscojwhwjwrfyqwzmbmzmrdksmhuluhurpqgupcvcpcrbwucxkfkxkrncikfspsfsrziwsnazanarloka
wjkjwjsyvzjerurerskbnrmzezmzswhbzuhohuhsinphcpypcpsutdpkxixkxsgzrxancnanseltnivmvivsqrhv
qdwdqdscxvdylglylsodjlgtqtgtsajxtobabobsmplbxklkxktzwakfsvsfstlcosnafanatxicavipivitjoqi
dqzqdqtvueqlyjylythasybodobotfmuojwnwjwtrsiwrexeretdywezmhmzmtpekmhuruhutbkyupcbcpctnqmc
ylmlyluaxblgtwtgtumdptobgbobuyjdbwjqjwjukprjerareruwvfrmzkzmzuibtzcpepcpugnvpkxoxkxustjx
sfyfsfuezxfaninanuqflnivsvivuclzvqdcdqduorndzmnmzmvbycmhuxuhuvnequpchcpcvzkecxkrkxkvlqsk
fsbsfsvxwgsnalanavjcuadqfqdqvhowqlypylyvtukytgzgtgvfaygbojobovrgmojwtwjwvdmawrederevpsoe
anonanwczdnivyvivwofrvqdidqdwalfdylslylwmrtlgtctgtwyxhtobmbobwkdvbergrerwipxrmzqzmzwuvlz
uhahuhwgbzhcpkpcpwshnpkxuxkxwenbxsfefsfwqtpfbopoboxdaeojwzwjwxpgswrejerexbmgezmtmzmxnsum
huduhuxzyiupcncpcxlewcfshsfsxjqysnaranaxvwmavibivixhcaidqlqdqxtioqlyvylyxfocytgfgtgxruqg
cpqpcpyebfpkxaxkxyqhtxsfkfsfycnhfanunanyotvnivevivyazjvqdodqdymfxdgtitgtykrztobsbobywxnb
wjcjwjyidbjermreryujprmzwzmzygpdzuhghuhysvrhdqrqdqzfcgqlybylyzriuytglgtgzdoigbovobozpuwo
jwfwjwzbakwreperezngyehujuhuzlsaupctcpczxyocxkdkxkzjeckfsnsfszvkqsnaxanazhqeavihiviztwsi
ersreragdhrmzczmzasjvzuhmhuhaepjhcpwpcpaqvxpkxgxkxacblxsfqfsfaohzfivkvivamtbvqdudqdayzpd
ylelylakfdlgtotgtawlrtobybobairfbwjijwjauxtjfstsfsbheisnadanabtkwavinivibfqkidqxqdqbrwyq
lyhylybdcmytgrgtgbpiagjwlwjwbnucwreverebzaqezmfmzmblgemhupuhubxmsupczcpcbjsgcxkjkxkbvyuk
gtutgtcifjtobebobculxbwjojwjcgrljeryrercsxzrmzizmzcednzuhshuhcqjbhkxmxkxcovdxsfwfsfcabrf
angnancmhfnivqvivcyntvqdadqdckthdylklylcwzvlhuvuhudjgkupcfcpcdvmycxkpkxkdhsmkfszsfsdtyas
najanadfeoavitividrkcilynylydpweytgxgtgdbcsgbohobodnigojwrwjwdzouwreberedluiezmlmzmdxawm
ivwvivekhlvqdgdqdewnzdylqlyleitnlgtatgteuzbtobkbobegfpbwjujwjesldjmzozmzeqxfzuhyhuhecdth
cpipcpeojhpkxsxkxeapvxsfcfsfemvjfanmnaneybxnjwxwjwflimwreherefxoaezmrmzmfjuomhubuhufvacu
pclcpcfhgqcxkvkxkftmeknapanafrygavizivifdeuidqjqdqfpkiqlytylyfbqwytgdgtgfnwkgbonobofzcyo
kxyxkxgmjnxsfifsfgypbfansnangkvpnivcvivgwbdvqdmdqdgihrdylwlylgunflobqbobgszhbwjajwjgefvj
erkrergqljrmzuzmzgcrxzuhehuhgoxlhcpopcpgadzplyzylyhnkoytgjgtghzqcgbotobohlwqojwdwjwhxcew
renerehjisezmxmzmhvogmpcrcpchtaicxkbkxkhfgwkfslsfshrmksnavanahdsyavifivihpymidqpqdqhbeaq
mzazmziolpzuhkhuhiardhcpupcpimxrpkxexkxiydfxsfofsfikjtfanynaniwphnqdsdqdiubjdylclylighxl
gtmtgtisnltobwbobietzbwjgjwjiqznjerqrericfbrnabanajpmqavilivijbseidqvqdqjnysqlyfylyjzegy
tgpgtgjlkugbozobojxqioreterejvckezmdmzmjhiymhunuhujtomupcxcpcjfuacxkhkxkjraokfsrsfsjdgcs
obcbobkqnrbwjmjwjkctfjerwrerkoztrmzgzmzkafhzuhqhuhkmlvhcpapcpkyrjpsfufsfkwdlfanenankijzn
ivovivkupnvqdydqdkgvbdylilylksbplgtstgtkehdtpcdcpclroscxknkxkldugkfsxsfslpausnahanalbgia
virivilnmwidqbqdqlzskqtgvgtglxemgbofoboljkaojwpwjwlvqowrezerelhwcezmjmzmltcqmhutuhulfieu
qdedqdmsptdylolylmevhlgtytgtmqbvtobibobmchjbwjsjwjmonxjercrermatlruhwhuhmyfnhcpgpcpmklbp
kxqxkxmwrpxsfafsfmixdfanknanmudrnivuvivmgjfvreferentquezmpmzmnfwimhuzuhunrcwupcjcpcndikc
xktkxknpoykfsdsfsnbumsvixivinzgoidqhqdqnlmcqlyrylynxsqytgbgtgnjyegbolobonvesojwvwjwnhkgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: referentque
Cipher: ersreragdhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: referentque
Cipher: 2451125124513344145451

Extended Methods:
Method #1

Plaintext: referentque
method variations:
wklkwksyvzkbpqpbpxdaepguvugucifkumzazmzholpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
r e f e r e n t q u e 
2 5 1 5 2 5 3 4 1 5 5 
4 1 2 1 4 1 3 4 4 4 1 
They are then read out in rows:
2515253415541214134441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: referentque
Cipher: wvwsvufqltd

Read more ...
Method #3

Plaintext: referentque
method variations:
yawfylsdyyf awfylsdyyfy wfylsdyyfya
fylsdyyfyaw ylsdyyfyawf lsdyyfyawfy
sdyyfyawfyl dyyfyawfyls yyfyawfylsd
yfyawfylsdy fyawfylsdyy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: referentque

first 5040 cipher variations(39615626 total)
referentque referentqeu referentuqe referentueq referenteuq referentequ referenqtue referenqteu referenqute referenquet
referenqeut referenqetu referenuqte referenuqet referenutqe referenuteq referenuetq referenueqt referenequt refereneqtu
refereneuqt refereneutq referenetuq referenetqu referetnque referetnqeu referetnuqe referetnueq referetneuq referetnequ
referetqnue referetqneu referetqune referetquen referetqeun referetqenu referetuqne referetuqen referetunqe referetuneq
referetuenq referetueqn referetequn refereteqnu refereteuqn refereteunq referetenuq referetenqu refereqtnue refereqtneu
refereqtune refereqtuen refereqteun refereqtenu refereqntue refereqnteu refereqnute refereqnuet refereqneut refereqnetu
referequnte referequnet referequtne referequten referequetn referequent refereqenut refereqentu refereqeunt refereqeutn
refereqetun refereqetnu refereutqne refereutqen refereutnqe refereutneq refereutenq refereuteqn refereuqtne refereuqten
refereuqnte refereuqnet refereuqent refereuqetn refereunqte refereunqet refereuntqe refereunteq refereunetq refereuneqt
refereueqnt refereueqtn refereuenqt refereuentq refereuetnq refereuetqn refereetqun refereetqnu refereetuqn refereetunq
refereetnuq refereetnqu refereeqtun refereeqtnu refereequtn refereequnt refereeqnut refereeqntu refereeuqtn refereeuqnt
refereeutqn refereeutnq refereeuntq refereeunqt refereenqut refereenqtu refereenuqt refereenutq refereentuq refereentqu
refernetque refernetqeu refernetuqe refernetueq referneteuq refernetequ referneqtue referneqteu refernequte refernequet
referneqeut referneqetu referneuqte referneuqet referneutqe referneuteq referneuetq referneueqt referneequt referneeqtu
referneeuqt referneeutq referneetuq referneetqu refernteque refernteqeu refernteuqe refernteueq refernteeuq refernteequ
referntqeue referntqeeu referntquee referntquee referntqeue referntqeeu referntuqee referntuqee referntueqe referntueeq
referntueeq referntueqe refernteque refernteqeu refernteuqe refernteueq refernteeuq refernteequ refernqteue refernqteeu
refernqtuee refernqtuee refernqteue refernqteeu refernqetue refernqeteu refernqeute refernqeuet refernqeeut refernqeetu
refernquete refernqueet refernqutee refernqutee refernquete refernqueet refernqeeut refernqeetu refernqeuet refernqeute
refernqetue refernqeteu refernutqee refernutqee refernuteqe refernuteeq refernuteeq refernuteqe refernuqtee refernuqtee
refernuqete refernuqeet refernuqeet refernuqete refernueqte refernueqet refernuetqe refernueteq refernueetq refernueeqt
refernueqet refernueqte refernueeqt refernueetq refernueteq refernuetqe refernetque refernetqeu refernetuqe refernetueq
referneteuq refernetequ referneqtue referneqteu refernequte refernequet referneqeut referneqetu referneuqte referneuqet
referneutqe referneuteq referneuetq referneueqt referneequt referneeqtu referneeuqt referneeutq referneetuq referneetqu
refertneque refertneqeu refertneuqe refertneueq refertneeuq refertneequ refertnqeue refertnqeeu refertnquee refertnquee
refertnqeue refertnqeeu refertnuqee refertnuqee refertnueqe refertnueeq refertnueeq refertnueqe refertneque refertneqeu
refertneuqe refertneueq refertneeuq refertneequ refertenque refertenqeu refertenuqe refertenueq referteneuq refertenequ
referteqnue referteqneu refertequne refertequen referteqeun referteqenu referteuqne referteuqen referteunqe referteuneq
referteuenq referteueqn referteequn referteeqnu referteeuqn referteeunq referteenuq referteenqu refertqenue refertqeneu
refertqeune refertqeuen refertqeeun refertqeenu refertqneue refertqneeu refertqnuee refertqnuee refertqneue refertqneeu
refertqunee refertqunee refertquene refertqueen refertqueen refertquene refertqenue refertqeneu refertqeune refertqeuen
refertqeeun refertqeenu refertueqne refertueqen refertuenqe refertueneq refertueenq refertueeqn refertuqene refertuqeen
refertuqnee refertuqnee refertuqene refertuqeen refertunqee refertunqee refertuneqe refertuneeq refertuneeq refertuneqe
refertueqne refertueqen refertuenqe refertueneq refertueenq refertueeqn referteequn referteeqnu referteeuqn referteeunq
referteenuq referteenqu referteqeun referteqenu refertequen refertequne referteqnue referteqneu referteuqen referteuqne
referteueqn referteuenq referteuneq referteunqe refertenque refertenqeu refertenuqe refertenueq referteneuq refertenequ
referqnteue referqnteeu referqntuee referqntuee referqnteue referqnteeu referqnetue referqneteu referqneute referqneuet
referqneeut referqneetu referqnuete referqnueet referqnutee referqnutee referqnuete referqnueet referqneeut referqneetu
referqneuet referqneute referqnetue referqneteu referqtneue referqtneeu referqtnuee referqtnuee referqtneue referqtneeu
referqtenue referqteneu referqteune referqteuen referqteeun referqteenu referqtuene referqtueen referqtunee referqtunee
referqtuene referqtueen referqteeun referqteenu referqteuen referqteune referqtenue referqteneu referqetnue referqetneu
referqetune referqetuen referqeteun referqetenu referqentue referqenteu referqenute referqenuet referqeneut referqenetu
referqeunte referqeunet referqeutne referqeuten referqeuetn referqeuent referqeenut referqeentu referqeeunt referqeeutn
referqeetun referqeetnu referqutene referquteen referqutnee referqutnee referqutene referquteen referquetne referqueten
referquente referquenet referqueent referqueetn referqunete referquneet referquntee referquntee referqunete referquneet
referqueent referqueetn referquenet referquente referquetne referqueten referqeteun referqetenu referqetuen referqetune
referqetnue referqetneu referqeetun referqeetnu referqeeutn referqeeunt referqeenut referqeentu referqeuetn referqeuent
referqeuten referqeutne referqeunte referqeunet referqeneut referqenetu referqenuet referqenute referqentue referqenteu
referuntqee referuntqee referunteqe referunteeq referunteeq referunteqe referunqtee referunqtee referunqete referunqeet
referunqeet referunqete referuneqte referuneqet referunetqe referuneteq referuneetq referuneeqt referuneqet referuneqte
referuneeqt referuneetq referuneteq referunetqe referutnqee referutnqee referutneqe referutneeq referutneeq referutneqe
referutqnee referutqnee referutqene referutqeen referutqeen referutqene referuteqne referuteqen referutenqe referuteneq
referuteenq referuteeqn referuteqen referuteqne referuteeqn referuteenq referuteneq referutenqe referuqtnee referuqtnee
referuqtene referuqteen referuqteen referuqtene referuqntee referuqntee referuqnete referuqneet referuqneet referuqnete
referuqente referuqenet referuqetne referuqeten referuqeetn referuqeent referuqenet referuqente referuqeent referuqeetn
referuqeten referuqetne referuetqne referuetqen referuetnqe referuetneq referuetenq referueteqn referueqtne referueqten
referueqnte referueqnet referueqent referueqetn referuenqte referuenqet referuentqe referuenteq referuenetq referueneqt
referueeqnt referueeqtn referueenqt referueentq referueetnq referueetqn referuetqen referuetqne referueteqn referuetenq
referuetneq referuetnqe referueqten referueqtne referueqetn referueqent referueqnet referueqnte referueeqtn referueeqnt
referueetqn referueetnq referueentq referueenqt referuenqet referuenqte referueneqt referuenetq referuenteq referuentqe
referentque referentqeu referentuqe referentueq referenteuq referentequ referenqtue referenqteu referenqute referenquet
referenqeut referenqetu referenuqte referenuqet referenutqe referenuteq referenuetq referenueqt referenequt refereneqtu
refereneuqt refereneutq referenetuq referenetqu referetnque referetnqeu referetnuqe referetnueq referetneuq referetnequ
referetqnue referetqneu referetqune referetquen referetqeun referetqenu referetuqne referetuqen referetunqe referetuneq
referetuenq referetueqn referetequn refereteqnu refereteuqn refereteunq referetenuq referetenqu refereqtnue refereqtneu
refereqtune refereqtuen refereqteun refereqtenu refereqntue refereqnteu refereqnute refereqnuet refereqneut refereqnetu
referequnte referequnet referequtne referequten referequetn referequent refereqenut refereqentu refereqeunt refereqeutn
refereqetun refereqetnu refereutqne refereutqen refereutnqe refereutneq refereutenq refereuteqn refereuqtne refereuqten
refereuqnte refereuqnet refereuqent refereuqetn refereunqte refereunqet refereuntqe refereunteq refereunetq refereuneqt
refereueqnt refereueqtn refereuenqt refereuentq refereuetnq refereuetqn refereetqun refereetqnu refereetuqn refereetunq
refereetnuq refereetnqu refereeqtun refereeqtnu refereequtn refereequnt refereeqnut refereeqntu refereeuqtn refereeuqnt
refereeutqn refereeutnq refereeuntq refereeunqt refereenqut refereenqtu refereenuqt refereenutq refereentuq refereentqu
refeerntque refeerntqeu refeerntuqe refeerntueq refeernteuq refeerntequ refeernqtue refeernqteu refeernqute refeernquet
refeernqeut refeernqetu refeernuqte refeernuqet refeernutqe refeernuteq refeernuetq refeernueqt refeernequt refeerneqtu
refeerneuqt refeerneutq refeernetuq refeernetqu refeertnque refeertnqeu refeertnuqe refeertnueq refeertneuq refeertnequ
refeertqnue refeertqneu refeertqune refeertquen refeertqeun refeertqenu refeertuqne refeertuqen refeertunqe refeertuneq
refeertuenq refeertueqn refeertequn refeerteqnu refeerteuqn refeerteunq refeertenuq refeertenqu refeerqtnue refeerqtneu
refeerqtune refeerqtuen refeerqteun refeerqtenu refeerqntue refeerqnteu refeerqnute refeerqnuet refeerqneut refeerqnetu
refeerqunte refeerqunet refeerqutne refeerquten refeerquetn refeerquent refeerqenut refeerqentu refeerqeunt refeerqeutn
refeerqetun refeerqetnu refeerutqne refeerutqen refeerutnqe refeerutneq refeerutenq refeeruteqn refeeruqtne refeeruqten
refeeruqnte refeeruqnet refeeruqent refeeruqetn refeerunqte refeerunqet refeeruntqe refeerunteq refeerunetq refeeruneqt
refeerueqnt refeerueqtn refeeruenqt refeeruentq refeeruetnq refeeruetqn refeeretqun refeeretqnu refeeretuqn refeeretunq
refeeretnuq refeeretnqu refeereqtun refeereqtnu refeerequtn refeerequnt refeereqnut refeereqntu refeereuqtn refeereuqnt
refeereutqn refeereutnq refeereuntq refeereunqt refeerenqut refeerenqtu refeerenuqt refeerenutq refeerentuq refeerentqu
refeenrtque refeenrtqeu refeenrtuqe refeenrtueq refeenrteuq refeenrtequ refeenrqtue refeenrqteu refeenrqute refeenrquet
refeenrqeut refeenrqetu refeenruqte refeenruqet refeenrutqe refeenruteq refeenruetq refeenrueqt refeenrequt refeenreqtu
refeenreuqt refeenreutq refeenretuq refeenretqu refeentrque refeentrqeu refeentruqe refeentrueq refeentreuq refeentrequ
refeentqrue refeentqreu refeentqure refeentquer refeentqeur refeentqeru refeentuqre refeentuqer refeenturqe refeentureq
refeentuerq refeentueqr refeentequr refeenteqru refeenteuqr refeenteurq refeenteruq refeenterqu refeenqtrue refeenqtreu
refeenqture refeenqtuer refeenqteur refeenqteru refeenqrtue refeenqrteu refeenqrute refeenqruet refeenqreut refeenqretu
refeenqurte refeenquret refeenqutre refeenquter refeenquetr refeenquert refeenqerut refeenqertu refeenqeurt refeenqeutr
refeenqetur refeenqetru refeenutqre refeenutqer refeenutrqe refeenutreq refeenuterq refeenuteqr refeenuqtre refeenuqter
refeenuqrte refeenuqret refeenuqert refeenuqetr refeenurqte refeenurqet refeenurtqe refeenurteq refeenuretq refeenureqt
refeenueqrt refeenueqtr refeenuerqt refeenuertq refeenuetrq refeenuetqr refeenetqur refeenetqru refeenetuqr refeeneturq
refeenetruq refeenetrqu refeeneqtur refeeneqtru refeenequtr refeenequrt refeeneqrut refeeneqrtu refeeneuqtr refeeneuqrt
refeeneutqr refeeneutrq refeeneurtq refeeneurqt refeenerqut refeenerqtu refeeneruqt refeenerutq refeenertuq refeenertqu
refeetnrque refeetnrqeu refeetnruqe refeetnrueq refeetnreuq refeetnrequ refeetnqrue refeetnqreu refeetnqure refeetnquer
refeetnqeur refeetnqeru refeetnuqre refeetnuqer refeetnurqe refeetnureq refeetnuerq refeetnueqr refeetnequr refeetneqru
refeetneuqr refeetneurq refeetneruq refeetnerqu refeetrnque refeetrnqeu refeetrnuqe refeetrnueq refeetrneuq refeetrnequ
refeetrqnue refeetrqneu refeetrqune refeetrquen refeetrqeun refeetrqenu refeetruqne refeetruqen refeetrunqe refeetruneq
refeetruenq refeetrueqn refeetrequn refeetreqnu refeetreuqn refeetreunq refeetrenuq refeetrenqu refeetqrnue refeetqrneu
refeetqrune refeetqruen refeetqreun refeetqrenu refeetqnrue refeetqnreu refeetqnure refeetqnuer refeetqneur refeetqneru
refeetqunre refeetquner refeetqurne refeetquren refeetquern refeetquenr refeetqenur refeetqenru refeetqeunr refeetqeurn
refeetqerun refeetqernu refeeturqne refeeturqen refeeturnqe refeeturneq refeeturenq refeetureqn refeetuqrne refeetuqren
refeetuqnre refeetuqner refeetuqenr refeetuqern refeetunqre refeetunqer refeetunrqe refeetunreq refeetunerq refeetuneqr
refeetueqnr refeetueqrn refeetuenqr refeetuenrq refeetuernq refeetuerqn refeeterqun refeeterqnu refeeteruqn refeeterunq
refeeternuq refeeternqu refeeteqrun refeeteqrnu refeetequrn refeetequnr refeeteqnur refeeteqnru refeeteuqrn refeeteuqnr
refeeteurqn refeeteurnq refeeteunrq refeeteunqr refeetenqur refeetenqru refeetenuqr refeetenurq refeetenruq refeetenrqu
refeeqntrue refeeqntreu refeeqnture refeeqntuer refeeqnteur refeeqnteru refeeqnrtue refeeqnrteu refeeqnrute refeeqnruet
refeeqnreut refeeqnretu refeeqnurte refeeqnuret refeeqnutre refeeqnuter refeeqnuetr refeeqnuert refeeqnerut refeeqnertu
refeeqneurt refeeqneutr refeeqnetur refeeqnetru refeeqtnrue refeeqtnreu refeeqtnure refeeqtnuer refeeqtneur refeeqtneru
refeeqtrnue refeeqtrneu refeeqtrune refeeqtruen refeeqtreun refeeqtrenu refeeqturne refeeqturen refeeqtunre refeeqtuner
refeeqtuenr refeeqtuern refeeqterun refeeqternu refeeqteurn refeeqteunr refeeqtenur refeeqtenru refeeqrtnue refeeqrtneu
refeeqrtune refeeqrtuen refeeqrteun refeeqrtenu refeeqrntue refeeqrnteu refeeqrnute refeeqrnuet refeeqrneut refeeqrnetu
refeeqrunte refeeqrunet refeeqrutne refeeqruten refeeqruetn refeeqruent refeeqrenut refeeqrentu refeeqreunt refeeqreutn
refeeqretun refeeqretnu refeequtrne refeequtren refeequtnre refeequtner refeequtenr refeequtern refeequrtne refeequrten
refeequrnte refeequrnet refeequrent refeequretn refeequnrte refeequnret refeequntre refeequnter refeequnetr refeequnert
refeequernt refeequertn refeequenrt refeequentr refeequetnr refeequetrn refeeqetrun refeeqetrnu refeeqeturn refeeqetunr
refeeqetnur refeeqetnru refeeqertun refeeqertnu refeeqerutn refeeqerunt refeeqernut refeeqerntu refeeqeurtn refeeqeurnt
refeeqeutrn refeeqeutnr refeeqeuntr refeeqeunrt refeeqenrut refeeqenrtu refeeqenurt refeeqenutr refeeqentur refeeqentru
refeeuntqre refeeuntqer refeeuntrqe refeeuntreq refeeunterq refeeunteqr refeeunqtre refeeunqter refeeunqrte refeeunqret
refeeunqert refeeunqetr refeeunrqte refeeunrqet refeeunrtqe refeeunrteq refeeunretq refeeunreqt refeeuneqrt refeeuneqtr
refeeunerqt refeeunertq refeeunetrq refeeunetqr refeeutnqre refeeutnqer refeeutnrqe refeeutnreq refeeutnerq refeeutneqr
refeeutqnre refeeutqner refeeutqrne refeeutqren refeeutqern refeeutqenr refeeutrqne refeeutrqen refeeutrnqe refeeutrneq
refeeutrenq refeeutreqn refeeuteqrn refeeuteqnr refeeuterqn refeeuternq refeeutenrq refeeutenqr refeeuqtnre refeeuqtner
refeeuqtrne refeeuqtren refeeuqtern refeeuqtenr refeeuqntre refeeuqnter refeeuqnrte refeeuqnret refeeuqnert refeeuqnetr
refeeuqrnte refeeuqrnet refeeuqrtne refeeuqrten refeeuqretn refeeuqrent refeeuqenrt refeeuqentr refeeuqernt refeeuqertn
refeeuqetrn refeeuqetnr refeeurtqne refeeurtqen refeeurtnqe refeeurtneq refeeurtenq refeeurteqn refeeurqtne refeeurqten
refeeurqnte refeeurqnet refeeurqent refeeurqetn refeeurnqte refeeurnqet refeeurntqe refeeurnteq refeeurnetq refeeurneqt
refeeureqnt refeeureqtn refeeurenqt refeeurentq refeeuretnq refeeuretqn refeeuetqrn refeeuetqnr refeeuetrqn refeeuetrnq
refeeuetnrq refeeuetnqr refeeueqtrn refeeueqtnr refeeueqrtn refeeueqrnt refeeueqnrt refeeueqntr refeeuerqtn refeeuerqnt
refeeuertqn refeeuertnq refeeuerntq refeeuernqt refeeuenqrt refeeuenqtr refeeuenrqt refeeuenrtq refeeuentrq refeeuentqr
refeeentqur refeeentqru refeeentuqr refeeenturq refeeentruq refeeentrqu refeeenqtur refeeenqtru refeeenqutr refeeenqurt
refeeenqrut refeeenqrtu refeeenuqtr refeeenuqrt refeeenutqr refeeenutrq refeeenurtq refeeenurqt refeeenrqut refeeenrqtu
refeeenruqt refeeenrutq refeeenrtuq refeeenrtqu refeeetnqur refeeetnqru refeeetnuqr refeeetnurq refeeetnruq refeeetnrqu
refeeetqnur refeeetqnru refeeetqunr refeeetqurn refeeetqrun refeeetqrnu refeeetuqnr refeeetuqrn refeeetunqr refeeetunrq
refeeeturnq refeeeturqn refeeetrqun refeeetrqnu refeeetruqn refeeetrunq refeeetrnuq refeeetrnqu refeeeqtnur refeeeqtnru
refeeeqtunr refeeeqturn refeeeqtrun refeeeqtrnu refeeeqntur refeeeqntru refeeeqnutr refeeeqnurt refeeeqnrut refeeeqnrtu
refeeequntr refeeequnrt refeeequtnr refeeequtrn refeeequrtn refeeequrnt refeeeqrnut refeeeqrntu refeeeqrunt refeeeqrutn
refeeeqrtun refeeeqrtnu refeeeutqnr refeeeutqrn refeeeutnqr refeeeutnrq refeeeutrnq refeeeutrqn refeeeuqtnr refeeeuqtrn
refeeeuqntr refeeeuqnrt refeeeuqrnt refeeeuqrtn refeeeunqtr refeeeunqrt refeeeuntqr refeeeuntrq refeeeunrtq refeeeunrqt
refeeeurqnt refeeeurqtn refeeeurnqt refeeeurntq refeeeurtnq refeeeurtqn refeeertqun refeeertqnu refeeertuqn refeeertunq
refeeertnuq refeeertnqu refeeerqtun refeeerqtnu refeeerqutn refeeerqunt refeeerqnut refeeerqntu refeeeruqtn refeeeruqnt
refeeerutqn refeeerutnq refeeeruntq refeeerunqt refeeernqut refeeernqtu refeeernuqt refeeernutq refeeerntuq refeeerntqu
refenertque refenertqeu refenertuqe refenertueq refenerteuq refenertequ refenerqtue refenerqteu refenerqute refenerquet
refenerqeut refenerqetu refeneruqte refeneruqet refenerutqe refeneruteq refeneruetq refenerueqt refenerequt refenereqtu
refenereuqt refenereutq refeneretuq refeneretqu refenetrque refenetrqeu refenetruqe refenetrueq refenetreuq refenetrequ
refenetqrue refenetqreu refenetqure refenetquer refenetqeur refenetqeru refenetuqre refenetuqer refeneturqe refenetureq
refenetuerq refenetueqr refenetequr refeneteqru refeneteuqr refeneteurq refeneteruq refeneterqu refeneqtrue refeneqtreu
refeneqture refeneqtuer refeneqteur refeneqteru refeneqrtue refeneqrteu refeneqrute refeneqruet refeneqreut refeneqretu
refenequrte refenequret refenequtre refenequter refenequetr refenequert refeneqerut refeneqertu refeneqeurt refeneqeutr
refeneqetur refeneqetru refeneutqre refeneutqer refeneutrqe refeneutreq refeneuterq refeneuteqr refeneuqtre refeneuqter
refeneuqrte refeneuqret refeneuqert refeneuqetr refeneurqte refeneurqet refeneurtqe refeneurteq refeneuretq refeneureqt
refeneueqrt refeneueqtr refeneuerqt refeneuertq refeneuetrq refeneuetqr refeneetqur refeneetqru refeneetuqr refeneeturq
refeneetruq refeneetrqu refeneeqtur refeneeqtru refeneequtr refeneequrt refeneeqrut refeneeqrtu refeneeuqtr refeneeuqrt
refeneeutqr refeneeutrq refeneeurtq refeneeurqt refeneerqut refeneerqtu refeneeruqt refeneerutq refeneertuq refeneertqu
refenretque refenretqeu refenretuqe refenretueq refenreteuq refenretequ refenreqtue refenreqteu refenrequte refenrequet
refenreqeut refenreqetu refenreuqte refenreuqet refenreutqe refenreuteq refenreuetq refenreueqt refenreequt refenreeqtu
refenreeuqt refenreeutq refenreetuq refenreetqu refenrteque refenrteqeu refenrteuqe refenrteueq refenrteeuq refenrteequ
refenrtqeue refenrtqeeu refenrtquee refenrtquee refenrtqeue refenrtqeeu refenrtuqee refenrtuqee refenrtueqe refenrtueeq
refenrtueeq refenrtueqe refenrteque refenrteqeu refenrteuqe refenrteueq refenrteeuq refenrteequ refenrqteue refenrqteeu
refenrqtuee refenrqtuee refenrqteue refenrqteeu refenrqetue refenrqeteu refenrqeute refenrqeuet refenrqeeut refenrqeetu
refenrquete refenrqueet refenrqutee refenrqutee refenrquete refenrqueet refenrqeeut refenrqeetu refenrqeuet refenrqeute
refenrqetue refenrqeteu refenrutqee refenrutqee refenruteqe refenruteeq refenruteeq refenruteqe refenruqtee refenruqtee
refenruqete refenruqeet refenruqeet refenruqete refenrueqte refenrueqet refenruetqe refenrueteq refenrueetq refenrueeqt
refenrueqet refenrueqte refenrueeqt refenrueetq refenrueteq refenruetqe refenretque refenretqeu refenretuqe refenretueq
refenreteuq refenretequ refenreqtue refenreqteu refenrequte refenrequet refenreqeut refenreqetu refenreuqte refenreuqet
refenreutqe refenreuteq refenreuetq refenreueqt refenreequt refenreeqtu refenreeuqt refenreeutq refenreetuq refenreetqu
refentreque refentreqeu refentreuqe refentreueq refentreeuq refentreequ refentrqeue refentrqeeu refentrquee refentrquee
refentrqeue refentrqeeu refentruqee refentruqee refentrueqe refentrueeq refentrueeq refentrueqe refentreque refentreqeu
refentreuqe refentreueq refentreeuq refentreequ refenterque refenterqeu refenteruqe refenterueq refentereuq refenterequ
refenteqrue refenteqreu refentequre refentequer refenteqeur refenteqeru refenteuqre refenteuqer refenteurqe refenteureq
refenteuerq refenteueqr refenteequr refenteeqru refenteeuqr refenteeurq refenteeruq refenteerqu refentqerue refentqereu
refentqeure refentqeuer refentqeeur refentqeeru refentqreue refentqreeu refentqruee refentqruee refentqreue refentqreeu
refentquree refentquree refentquere refentqueer refentqueer refentquere refentqerue refentqereu refentqeure refentqeuer
refentqeeur refentqeeru refentueqre refentueqer refentuerqe refentuereq refentueerq refentueeqr refentuqere refentuqeer
refentuqree refentuqree refentuqere refentuqeer refenturqee refenturqee refentureqe refentureeq refentureeq refentureqe
refentueqre refentueqer refentuerqe refentuereq refentueerq refentueeqr refenteequr refenteeqru refenteeuqr refenteeurq
refenteeruq refenteerqu refenteqeur refenteqeru refentequer refentequre refenteqrue refenteqreu refenteuqer refenteuqre
refenteueqr refenteuerq refenteureq refenteurqe refenterque refenterqeu refenteruqe refenterueq refentereuq refenterequ
refenqrteue refenqrteeu refenqrtuee refenqrtuee refenqrteue refenqrteeu refenqretue refenqreteu refenqreute refenqreuet
refenqreeut refenqreetu refenqruete refenqrueet refenqrutee refenqrutee refenqruete refenqrueet refenqreeut refenqreetu
refenqreuet refenqreute refenqretue refenqreteu refenqtreue refenqtreeu refenqtruee refenqtruee refenqtreue refenqtreeu
refenqterue refenqtereu refenqteure refenqteuer refenqteeur refenqteeru refenqtuere refenqtueer refenqturee refenqturee
refenqtuere refenqtueer refenqteeur refenqteeru refenqteuer refenqteure refenqterue refenqtereu refenqetrue refenqetreu
refenqeture refenqetuer refenqeteur refenqeteru refenqertue refenqerteu refenqerute refenqeruet refenqereut refenqeretu
refenqeurte refenqeuret refenqeutre refenqeuter refenqeuetr refenqeuert refenqeerut refenqeertu refenqeeurt refenqeeutr
refenqeetur refenqeetru refenqutere refenquteer refenqutree refenqutree refenqutere refenquteer refenquetre refenqueter
refenquerte refenqueret refenqueert refenqueetr refenqurete refenqureet refenqurtee refenqurtee refenqurete refenqureet
refenqueert refenqueetr refenqueret refenquerte refenquetre refenqueter refenqeteur refenqeteru refenqetuer refenqeture
refenqetrue refenqetreu refenqeetur refenqeetru refenqeeutr refenqeeurt refenqeerut refenqeertu refenqeuetr refenqeuert
refenqeuter refenqeutre refenqeurte refenqeuret refenqereut refenqeretu refenqeruet refenqerute refenqertue refenqerteu
refenurtqee refenurtqee refenurteqe refenurteeq refenurteeq refenurteqe refenurqtee refenurqtee refenurqete refenurqeet
refenurqeet refenurqete refenureqte refenureqet refenuretqe refenureteq refenureetq refenureeqt refenureqet refenureqte
refenureeqt refenureetq refenureteq refenuretqe refenutrqee refenutrqee refenutreqe refenutreeq refenutreeq refenutreqe
refenutqree refenutqree refenutqere refenutqeer refenutqeer refenutqere refenuteqre refenuteqer refenuterqe refenutereq
refenuteerq refenuteeqr refenuteqer refenuteqre refenuteeqr refenuteerq refenutereq refenuterqe refenuqtree refenuqtree
refenuqtere refenuqteer refenuqteer refenuqtere refenuqrtee refenuqrtee refenuqrete refenuqreet refenuqreet refenuqrete
refenuqerte refenuqeret refenuqetre refenuqeter refenuqeetr refenuqeert refenuqeret refenuqerte refenuqeert refenuqeetr
refenuqeter refenuqetre refenuetqre refenuetqer refenuetrqe refenuetreq refenueterq refenueteqr refenueqtre refenueqter
refenueqrte refenueqret refenueqert refenueqetr refenuerqte refenuerqet refenuertqe refenuerteq refenueretq refenuereqt
refenueeqrt refenueeqtr refenueerqt refenueertq refenueetrq refenueetqr refenuetqer refenuetqre refenueteqr refenueterq
refenuetreq refenuetrqe refenueqter refenueqtre refenueqetr refenueqert refenueqret refenueqrte refenueeqtr refenueeqrt
refenueetqr refenueetrq refenueertq refenueerqt refenuerqet refenuerqte refenuereqt refenueretq refenuerteq refenuertqe
refenertque refenertqeu refenertuqe refenertueq refenerteuq refenertequ refenerqtue refenerqteu refenerqute refenerquet
refenerqeut refenerqetu refeneruqte refeneruqet refenerutqe refeneruteq refeneruetq refenerueqt refenerequt refenereqtu
refenereuqt refenereutq refeneretuq refeneretqu refenetrque refenetrqeu refenetruqe refenetrueq refenetreuq refenetrequ
refenetqrue refenetqreu refenetqure refenetquer refenetqeur refenetqeru refenetuqre refenetuqer refeneturqe refenetureq
refenetuerq refenetueqr refenetequr refeneteqru refeneteuqr refeneteurq refeneteruq refeneterqu refeneqtrue refeneqtreu
refeneqture refeneqtuer refeneqteur refeneqteru refeneqrtue refeneqrteu refeneqrute refeneqruet refeneqreut refeneqretu
refenequrte refenequret refenequtre refenequter refenequetr refenequert refeneqerut refeneqertu refeneqeurt refeneqeutr
refeneqetur refeneqetru refeneutqre refeneutqer refeneutrqe refeneutreq refeneuterq refeneuteqr refeneuqtre refeneuqter
refeneuqrte refeneuqret refeneuqert refeneuqetr refeneurqte refeneurqet refeneurtqe refeneurteq refeneuretq refeneureqt
refeneueqrt refeneueqtr refeneuerqt refeneuertq refeneuetrq refeneuetqr refeneetqur refeneetqru refeneetuqr refeneeturq
refeneetruq refeneetrqu refeneeqtur refeneeqtru refeneequtr refeneequrt refeneeqrut refeneeqrtu refeneeuqtr refeneeuqrt
refeneeutqr refeneeutrq refeneeurtq refeneeurqt refeneerqut refeneerqtu refeneeruqt refeneerutq refeneertuq refeneertqu
refetenrque refetenrqeu refetenruqe refetenrueq refetenreuq refetenrequ refetenqrue refetenqreu refetenqure refetenquer
refetenqeur refetenqeru refetenuqre refetenuqer refetenurqe refetenureq refetenuerq refetenueqr refetenequr refeteneqru
refeteneuqr refeteneurq refeteneruq refetenerqu refeternque refeternqeu refeternuqe refeternueq refeterneuq refeternequ
refeterqnue refeterqneu refeterqune refeterquen refeterqeun refeterqenu refeteruqne refeteruqen refeterunqe refeteruneq
refeteruenq refeterueqn refeterequn refetereqnu refetereuqn refetereunq refeterenuq refeterenqu refeteqrnue refeteqrneu
refeteqrune refeteqruen refeteqreun refeteqrenu refeteqnrue refeteqnreu refeteqnure refeteqnuer refeteqneur refeteqneru
refetequnre refetequner refetequrne refetequren refetequern refetequenr refeteqenur refeteqenru refeteqeunr refeteqeurn
refeteqerun refeteqernu refeteurqne refeteurqen refeteurnqe refeteurneq refeteurenq refeteureqn refeteuqrne refeteuqren
refeteuqnre refeteuqner refeteuqenr refeteuqern refeteunqre refeteunqer refeteunrqe refeteunreq refeteunerq refeteuneqr
refeteueqnr refeteueqrn refeteuenqr refeteuenrq refeteuernq refeteuerqn refeteerqun refeteerqnu refeteeruqn refeteerunq
refeteernuq refeteernqu refeteeqrun refeteeqrnu refeteequrn refeteequnr refeteeqnur refeteeqnru refeteeuqrn refeteeuqnr
refeteeurqn refeteeurnq refeteeunrq refeteeunqr refeteenqur refeteenqru refeteenuqr refeteenurq refeteenruq refeteenrqu
refetnerque refetnerqeu refetneruqe refetnerueq refetnereuq refetnerequ refetneqrue refetneqreu refetnequre refetnequer
refetneqeur refetneqeru refetneuqre refetneuqer refetneurqe refetneureq refetneuerq refetneueqr refetneequr refetneeqru
refetneeuqr refetneeurq refetneeruq refetneerqu refetnreque refetnreqeu refetnreuqe refetnreueq refetnreeuq refetnreequ
refetnrqeue refetnrqeeu refetnrquee refetnrquee refetnrqeue refetnrqeeu refetnruqee refetnruqee refetnrueqe refetnrueeq
refetnrueeq refetnrueqe refetnreque refetnreqeu refetnreuqe refetnreueq refetnreeuq refetnreequ refetnqreue refetnqreeu
refetnqruee refetnqruee refetnqreue refetnqreeu refetnqerue refetnqereu refetnqeure refetnqeuer refetnqeeur refetnqeeru
refetnquere refetnqueer refetnquree refetnquree refetnquere refetnqueer refetnqeeur refetnqeeru refetnqeuer refetnqeure
refetnqerue refetnqereu refetnurqee refetnurqee refetnureqe refetnureeq refetnureeq refetnureqe refetnuqree refetnuqree
refetnuqere refetnuqeer refetnuqeer refetnuqere refetnueqre refetnueqer refetnuerqe refetnuereq refetnueerq refetnueeqr
refetnueqer refetnueqre refetnueeqr refetnueerq refetnuereq refetnuerqe refetnerque refetnerqeu refetneruqe refetnerueq
refetnereuq refetnerequ refetneqrue refetneqreu refetnequre refetnequer refetneqeur refetneqeru refetneuqre refetneuqer
refetneurqe refetneureq refetneuerq refetneueqr refetneequr refetneeqru refetneeuqr refetneeurq refetneeruq refetneerqu
refetrneque refetrneqeu refetrneuqe refetrneueq refetrneeuq refetrneequ refetrnqeue refetrnqeeu refetrnquee refetrnquee
refetrnqeue refetrnqeeu refetrnuqee refetrnuqee refetrnueqe refetrnueeq refetrnueeq refetrnueqe refetrneque refetrneqeu
refetrneuqe refetrneueq refetrneeuq refetrneequ refetrenque refetrenqeu refetrenuqe refetrenueq refetreneuq refetrenequ
refetreqnue refetreqneu refetrequne refetrequen refetreqeun refetreqenu refetreuqne refetreuqen refetreunqe refetreuneq
refetreuenq refetreueqn refetreequn refetreeqnu refetreeuqn refetreeunq refetreenuq refetreenqu refetrqenue refetrqeneu
refetrqeune refetrqeuen refetrqeeun refetrqeenu refetrqneue refetrqneeu refetrqnuee refetrqnuee refetrqneue refetrqneeu
refetrqunee refetrqunee refetrquene refetrqueen refetrqueen refetrquene refetrqenue refetrqeneu refetrqeune refetrqeuen
refetrqeeun refetrqeenu refetrueqne refetrueqen refetruenqe refetrueneq refetrueenq refetrueeqn refetruqene refetruqeen
refetruqnee refetruqnee refetruqene refetruqeen refetrunqee refetrunqee refetruneqe refetruneeq refetruneeq refetruneqe
refetrueqne refetrueqen refetruenqe refetrueneq refetrueenq refetrueeqn refetreequn refetreeqnu refetreeuqn refetreeunq
refetreenuq refetreenqu refetreqeun refetreqenu refetrequen refetrequne refetreqnue refetreqneu refetreuqen refetreuqne
refetreueqn refetreuenq refetreuneq refetreunqe refetrenque refetrenqeu refetrenuqe refetrenueq refetreneuq refetrenequ
refetqnreue refetqnreeu refetqnruee refetqnruee refetqnreue refetqnreeu refetqnerue refetqnereu refetqneure refetqneuer
refetqneeur refetqneeru refetqnuere refetqnueer refetqnuree refetqnuree refetqnuere refetqnueer refetqneeur refetqneeru
refetqneuer refetqneure refetqnerue refetqnereu refetqrneue refetqrneeu refetqrnuee refetqrnuee refetqrneue refetqrneeu
refetqrenue refetqreneu refetqreune refetqreuen refetqreeun refetqreenu refetqruene refetqrueen refetqrunee refetqrunee
refetqruene refetqrueen refetqreeun refetqreenu refetqreuen refetqreune refetqrenue refetqreneu refetqernue refetqerneu
refetqerune refetqeruen refetqereun refetqerenu refetqenrue refetqenreu refetqenure refetqenuer refetqeneur refetqeneru
refetqeunre refetqeuner refetqeurne refetqeuren refetqeuern refetqeuenr refetqeenur refetqeenru refetqeeunr refetqeeurn
refetqeerun refetqeernu refetqurene refetqureen refetqurnee refetqurnee refetqurene refetqureen refetquerne refetqueren
refetquenre refetquener refetqueenr refetqueern refetqunere refetquneer refetqunree refetqunree refetqunere refetquneer
refetqueenr refetqueern refetquener refetquenre refetquerne refetqueren refetqereun refetqerenu refetqeruen refetqerune
refetqernue refetqerneu refetqeerun refetqeernu refetqeeurn refetqeeunr refetqeenur refetqeenru refetqeuern refetqeuenr
refetqeuren refetqeurne refetqeunre refetqeuner refetqeneur refetqeneru refetqenuer refetqenure refetqenrue refetqenreu
refetunrqee refetunrqee refetunreqe refetunreeq refetunreeq refetunreqe refetunqree refetunqree refetunqere refetunqeer
refetunqeer refetunqere refetuneqre refetuneqer refetunerqe refetunereq refetuneerq refetuneeqr refetuneqer refetuneqre
refetuneeqr refetuneerq refetunereq refetunerqe refeturnqee refeturnqee refeturneqe refeturneeq refeturneeq refeturneqe
refeturqnee refeturqnee refeturqene refeturqeen refeturqeen refeturqene refetureqne refetureqen refeturenqe refetureneq
refetureenq refetureeqn refetureqen refetureqne refetureeqn refetureenq refetureneq refeturenqe refetuqrnee refetuqrnee
refetuqrene refetuqreen refetuqreen refetuqrene refetuqnree refetuqnree refetuqnere refetuqneer refetuqneer refetuqnere
refetuqenre refetuqener refetuqerne refetuqeren refetuqeern refetuqeenr refetuqener refetuqenre refetuqeenr refetuqeern
refetuqeren refetuqerne refetuerqne refetuerqen refetuernqe refetuerneq refetuerenq refetuereqn refetueqrne refetueqren
refetueqnre refetueqner refetueqenr refetueqern refetuenqre refetuenqer refetuenrqe refetuenreq refetuenerq refetueneqr
refetueeqnr refetueeqrn refetueenqr refetueenrq refetueernq refetueerqn refetuerqen refetuerqne refetuereqn refetuerenq
refetuerneq refetuernqe refetueqren refetueqrne refetueqern refetueqenr refetueqner refetueqnre refetueeqrn refetueeqnr
refetueerqn refetueernq refetueenrq refetueenqr refetuenqer refetuenqre refetueneqr refetuenerq refetuenreq refetuenrqe
refetenrque refetenrqeu refetenruqe refetenrueq refetenreuq refetenrequ refetenqrue refetenqreu refetenqure refetenquer
refetenqeur refetenqeru refetenuqre refetenuqer refetenurqe refetenureq refetenuerq refetenueqr refetenequr refeteneqru
refeteneuqr refeteneurq refeteneruq refetenerqu refeternque refeternqeu refeternuqe refeternueq refeterneuq refeternequ
refeterqnue refeterqneu refeterqune refeterquen refeterqeun refeterqenu refeteruqne refeteruqen refeterunqe refeteruneq
refeteruenq refeterueqn refeterequn refetereqnu refetereuqn refetereunq refeterenuq refeterenqu refeteqrnue refeteqrneu
refeteqrune refeteqruen refeteqreun refeteqrenu refeteqnrue refeteqnreu refeteqnure refeteqnuer refeteqneur refeteqneru
refetequnre refetequner refetequrne refetequren refetequern refetequenr refeteqenur refeteqenru refeteqeunr refeteqeurn
refeteqerun refeteqernu refeteurqne refeteurqen refeteurnqe refeteurneq refeteurenq refeteureqn refeteuqrne refeteuqren
refeteuqnre refeteuqner refeteuqenr refeteuqern refeteunqre refeteunqer refeteunrqe refeteunreq refeteunerq refeteuneqr
refeteueqnr refeteueqrn refeteuenqr refeteuenrq refeteuernq refeteuerqn refeteerqun refeteerqnu refeteeruqn refeteerunq
refeteernuq refeteernqu refeteeqrun refeteeqrnu refeteequrn refeteequnr refeteeqnur refeteeqnru refeteeuqrn refeteeuqnr
refeteeurqn refeteeurnq refeteeunrq refeteeunqr refeteenqur refeteenqru refeteenuqr refeteenurq refeteenruq refeteenrqu
refeqentrue refeqentreu refeqenture refeqentuer refeqenteur refeqenteru refeqenrtue refeqenrteu refeqenrute refeqenruet
refeqenreut refeqenretu refeqenurte refeqenuret refeqenutre refeqenuter refeqenuetr refeqenuert refeqenerut refeqenertu
refeqeneurt refeqeneutr refeqenetur refeqenetru refeqetnrue refeqetnreu refeqetnure refeqetnuer refeqetneur refeqetneru
refeqetrnue refeqetrneu refeqetrune refeqetruen refeqetreun refeqetrenu refeqeturne refeqeturen refeqetunre refeqetuner
refeqetuenr refeqetuern refeqeterun refeqeternu refeqeteurn refeqeteunr refeqetenur refeqetenru refeqertnue refeqertneu
refeqertune refeqertuen refeqerteun refeqertenu refeqerntue refeqernteu refeqernute refeqernuet refeqerneut refeqernetu
refeqerunte refeqerunet refeqerutne refeqeruten refeqeruetn refeqeruent refeqerenut refeqerentu refeqereunt refeqereutn
refeqeretun refeqeretnu refeqeutrne refeqeutren refeqeutnre refeqeutner refeqeutenr refeqeutern refeqeurtne refeqeurten
refeqeurnte refeqeurnet refeqeurent refeqeuretn refeqeunrte refeqeunret refeqeuntre refeqeunter refeqeunetr refeqeunert
refeqeuernt refeqeuertn refeqeuenrt refeqeuentr refeqeuetnr refeqeuetrn refeqeetrun refeqeetrnu refeqeeturn refeqeetunr
refeqeetnur refeqeetnru refeqeertun refeqeertnu refeqeerutn refeqeerunt refeqeernut refeqeerntu refeqeeurtn refeqeeurnt
refeqeeutrn refeqeeutnr refeqeeuntr refeqeeunrt refeqeenrut refeqeenrtu refeqeenurt refeqeenutr refeqeentur refeqeentru
refeqnetrue refeqnetreu refeqneture refeqnetuer refeqneteur refeqneteru refeqnertue refeqnerteu refeqnerute refeqneruet
refeqnereut refeqneretu refeqneurte refeqneuret refeqneutre refeqneuter refeqneuetr refeqneuert refeqneerut refeqneertu
refeqneeurt refeqneeutr refeqneetur refeqneetru refeqnterue refeqntereu refeqnteure refeqnteuer refeqnteeur refeqnteeru
refeqntreue refeqntreeu refeqntruee refeqntruee refeqntreue refeqntreeu refeqnturee refeqnturee refeqntuere refeqntueer
refeqntueer refeqntuere refeqnterue refeqntereu refeqnteure refeqnteuer refeqnteeur refeqnteeru refeqnrteue refeqnrteeu
refeqnrtuee refeqnrtuee refeqnrteue refeqnrteeu refeqnretue refeqnreteu refeqnreute refeqnreuet refeqnreeut refeqnreetu
refeqnruete refeqnrueet refeqnrutee refeqnrutee refeqnruete refeqnrueet refeqnreeut refeqnreetu refeqnreuet refeqnreute
refeqnretue refeqnreteu refeqnutree refeqnutree refeqnutere refeqnuteer refeqnuteer refeqnutere refeqnurtee refeqnurtee
refeqnurete refeqnureet refeqnureet refeqnurete refeqnuerte refeqnueret refeqnuetre refeqnueter refeqnueetr refeqnueert
refeqnueret refeqnuerte refeqnueert refeqnueetr refeqnueter refeqnuetre refeqnetrue refeqnetreu refeqneture refeqnetuer
refeqneteur refeqneteru refeqnertue refeqnerteu refeqnerute refeqneruet refeqnereut refeqneretu refeqneurte refeqneuret
refeqneutre refeqneuter refeqneuetr refeqneuert refeqneerut refeqneertu refeqneeurt refeqneeutr refeqneetur refeqneetru
refeqtnerue refeqtnereu refeqtneure refeqtneuer refeqtneeur refeqtneeru refeqtnreue refeqtnreeu refeqtnruee refeqtnruee
refeqtnreue refeqtnreeu refeqtnuree refeqtnuree refeqtnuere refeqtnueer refeqtnueer refeqtnuere refeqtnerue refeqtnereu
refeqtneure refeqtneuer refeqtneeur refeqtneeru refeqtenrue refeqtenreu refeqtenure refeqtenuer refeqteneur refeqteneru
refeqternue refeqterneu refeqterune refeqteruen refeqtereun refeqterenu refeqteurne refeqteuren refeqteunre refeqteuner
refeqteuenr refeqteuern refeqteerun refeqteernu refeqteeurn refeqteeunr refeqteenur refeqteenru refeqtrenue refeqtreneu
refeqtreune refeqtreuen refeqtreeun refeqtreenu refeqtrneue refeqtrneeu refeqtrnuee refeqtrnuee refeqtrneue refeqtrneeu
refeqtrunee refeqtrunee refeqtruene refeqtrueen refeqtrueen refeqtruene refeqtrenue refeqtreneu refeqtreune refeqtreuen
refeqtreeun refeqtreenu refeqtuerne refeqtueren refeqtuenre refeqtuener refeqtueenr refeqtueern refeqturene refeqtureen
refeqturnee refeqturnee refeqturene refeqtureen refeqtunree refeqtunree refeqtunere refeqtuneer refeqtuneer refeqtunere
refeqtuerne refeqtueren refeqtuenre refeqtuener refeqtueenr refeqtueern refeqteerun refeqteernu refeqteeurn refeqteeunr
refeqteenur refeqteenru refeqtereun refeqterenu refeqteruen refeqterune refeqternue refeqterneu refeqteuren refeqteurne
refeqteuern refeqteuenr refeqteuner refeqteunre refeqtenrue refeqtenreu refeqtenure refeqtenuer refeqteneur refeqteneru
refeqrnteue refeqrnteeu refeqrntuee refeqrntuee refeqrnteue refeqrnteeu refeqrnetue refeqrneteu refeqrneute refeqrneuet
refeqrneeut refeqrneetu refeqrnuete refeqrnueet refeqrnutee refeqrnutee refeqrnuete refeqrnueet refeqrneeut refeqrneetu
refeqrneuet refeqrneute refeqrnetue refeqrneteu refeqrtneue refeqrtneeu refeqrtnuee refeqrtnuee refeqrtneue refeqrtneeu
refeqrtenue refeqrteneu refeqrteune refeqrteuen refeqrteeun refeqrteenu refeqrtuene refeqrtueen refeqrtunee refeqrtunee
refeqrtuene refeqrtueen refeqrteeun refeqrteenu refeqrteuen refeqrteune refeqrtenue refeqrteneu refeqretnue refeqretneu
refeqretune refeqretuen refeqreteun refeqretenu refeqrentue refeqrenteu refeqrenute refeqrenuet refeqreneut refeqrenetu
refeqreunte refeqreunet refeqreutne refeqreuten refeqreuetn refeqreuent refeqreenut refeqreentu refeqreeunt refeqreeutn
refeqreetun refeqreetnu refeqrutene refeqruteen refeqrutnee refeqrutnee refeqrutene refeqruteen refeqruetne refeqrueten
refeqruente refeqruenet refeqrueent refeqrueetn refeqrunete refeqruneet refeqruntee refeqruntee refeqrunete refeqruneet
refeqrueent refeqrueetn refeqruenet refeqruente refeqruetne refeqrueten refeqreteun refeqretenu refeqretuen refeqretune
refeqretnue refeqretneu refeqreetun refeqreetnu refeqreeutn refeqreeunt refeqreenut refeqreentu refeqreuetn refeqreuent
refeqreuten refeqreutne refeqreunte refeqreunet refeqreneut refeqrenetu refeqrenuet refeqrenute refeqrentue refeqrenteu
refequntree refequntree refequntere refequnteer refequnteer refequntere refequnrtee refequnrtee refequnrete refequnreet
refequnreet refequnrete refequnerte refequneret refequnetre refequneter refequneetr refequneert refequneret refequnerte
refequneert refequneetr refequneter refequnetre refequtnree refequtnree refequtnere refequtneer refequtneer refequtnere
refequtrnee refequtrnee refequtrene refequtreen refequtreen refequtrene refequterne refequteren refequtenre refequtener
refequteenr refequteern refequteren refequterne refequteern refequteenr refequtener refequtenre refequrtnee refequrtnee
refequrtene refequrteen refequrteen refequrtene refequrntee refequrntee refequrnete refequrneet refequrneet refequrnete
refequrente refequrenet refequretne refequreten refequreetn refequreent refequrenet refequrente refequreent refequreetn
refequreten refequretne refequetrne refequetren refequetnre refequetner refequetenr refequetern refequertne refequerten
refequernte refequernet refequerent refequeretn refequenrte refequenret refequentre refequenter refequenetr refequenert
refequeernt refequeertn refequeenrt refequeentr refequeetnr refequeetrn refequetren refequetrne refequetern refequetenr
refequetner refequetnre refequerten refequertne refequeretn refequerent refequernet refequernte refequeertn refequeernt
refequeetrn refequeetnr refequeentr refequeenrt refequenret refequenrte refequenert refequenetr refequenter refequentre
refeqentrue refeqentreu refeqenture refeqentuer refeqenteur refeqenteru refeqenrtue refeqenrteu refeqenrute refeqenruet
refeqenreut refeqenretu refeqenurte refeqenuret refeqenutre refeqenuter refeqenuetr refeqenuert refeqenerut refeqenertu
refeqeneurt refeqeneutr refeqenetur refeqenetru refeqetnrue refeqetnreu refeqetnure refeqetnuer refeqetneur refeqetneru
refeqetrnue refeqetrneu refeqetrune refeqetruen refeqetreun refeqetrenu refeqeturne refeqeturen refeqetunre refeqetuner
refeqetuenr refeqetuern refeqeterun refeqeternu refeqeteurn refeqeteunr refeqetenur refeqetenru refeqertnue refeqertneu
refeqertune refeqertuen refeqerteun refeqertenu refeqerntue refeqernteu refeqernute refeqernuet refeqerneut refeqernetu
refeqerunte refeqerunet refeqerutne refeqeruten refeqeruetn refeqeruent refeqerenut refeqerentu refeqereunt refeqereutn
refeqeretun refeqeretnu refeqeutrne refeqeutren refeqeutnre refeqeutner refeqeutenr refeqeutern refeqeurtne refeqeurten
refeqeurnte refeqeurnet refeqeurent refeqeuretn refeqeunrte refeqeunret refeqeuntre refeqeunter refeqeunetr refeqeunert
refeqeuernt refeqeuertn refeqeuenrt refeqeuentr refeqeuetnr refeqeuetrn refeqeetrun refeqeetrnu refeqeeturn refeqeetunr
refeqeetnur refeqeetnru refeqeertun refeqeertnu refeqeerutn refeqeerunt refeqeernut refeqeerntu refeqeeurtn refeqeeurnt
refeqeeutrn refeqeeutnr refeqeeuntr refeqeeunrt refeqeenrut refeqeenrtu refeqeenurt refeqeenutr refeqeentur refeqeentru
refeuentqre refeuentqer refeuentrqe refeuentreq refeuenterq refeuenteqr refeuenqtre refeuenqter refeuenqrte refeuenqret
refeuenqert refeuenqetr refeuenrqte refeuenrqet refeuenrtqe refeuenrteq refeuenretq refeuenreqt refeueneqrt refeueneqtr
refeuenerqt refeuenertq refeuenetrq refeuenetqr refeuetnqre refeuetnqer refeuetnrqe refeuetnreq refeuetnerq refeuetneqr
refeuetqnre refeuetqner refeuetqrne refeuetqren refeuetqern refeuetqenr refeuetrqne refeuetrqen refeuetrnqe refeuetrneq
refeuetrenq refeuetreqn refeueteqrn refeueteqnr refeueterqn refeueternq refeuetenrq refeuetenqr refeueqtnre refeueqtner
refeueqtrne refeueqtren refeueqtern refeueqtenr refeueqntre refeueqnter refeueqnrte refeueqnret refeueqnert refeueqnetr
refeueqrnte refeueqrnet refeueqrtne refeueqrten refeueqretn refeueqrent refeueqenrt refeueqentr refeueqernt refeueqertn
refeueqetrn refeueqetnr refeuertqne refeuertqen refeuertnqe refeuertneq refeuertenq refeuerteqn refeuerqtne refeuerqten
refeuerqnte refeuerqnet refeuerqent refeuerqetn refeuernqte refeuernqet refeuerntqe refeuernteq refeuernetq refeuerneqt
refeuereqnt refeuereqtn refeuerenqt refeuerentq refeueretnq refeueretqn refeueetqrn refeueetqnr refeueetrqn refeueetrnq
refeueetnrq refeueetnqr refeueeqtrn refeueeqtnr refeueeqrtn refeueeqrnt refeueeqnrt refeueeqntr refeueerqtn refeueerqnt
refeueertqn refeueertnq refeueerntq refeueernqt refeueenqrt refeueenqtr refeueenrqt refeueenrtq refeueentrq refeueentqr
refeunetqre refeunetqer refeunetrqe refeunetreq refeuneterq refeuneteqr refeuneqtre refeuneqter refeuneqrte refeuneqret
refeuneqert refeuneqetr refeunerqte refeunerqet refeunertqe refeunerteq refeuneretq refeunereqt refeuneeqrt refeuneeqtr
refeuneerqt refeuneertq refeuneetrq refeuneetqr refeunteqre refeunteqer refeunterqe refeuntereq refeunteerq refeunteeqr
refeuntqere refeuntqeer refeuntqree refeuntqree refeuntqere refeuntqeer refeuntrqee refeuntrqee refeuntreqe refeuntreeq
refeuntreeq refeuntreqe refeunteqre refeunteqer refeunterqe refeuntereq refeunteerq refeunteeqr refeunqtere refeunqteer
refeunqtree refeunqtree refeunqtere refeunqteer refeunqetre refeunqeter refeunqerte refeunqeret refeunqeert refeunqeetr
refeunqrete refeunqreet refeunqrtee refeunqrtee refeunqrete refeunqreet refeunqeert refeunqeetr refeunqeret refeunqerte
refeunqetre refeunqeter refeunrtqee refeunrtqee refeunrteqe refeunrteeq refeunrteeq refeunrteqe refeunrqtee refeunrqtee
refeunrqete refeunrqeet refeunrqeet refeunrqete refeunreqte refeunreqet refeunretqe refeunreteq refeunreetq refeunreeqt
refeunreqet refeunreqte refeunreeqt refeunreetq refeunreteq refeunretqe refeunetqre refeunetqer refeunetrqe refeunetreq
refeuneterq refeuneteqr refeuneqtre refeuneqter refeuneqrte refeuneqret refeuneqert refeuneqetr refeunerqte refeunerqet
refeunertqe refeunerteq refeuneretq refeunereqt refeuneeqrt refeuneeqtr refeuneerqt refeuneertq refeuneetrq refeuneetqr
refeutneqre refeutneqer refeutnerqe refeutnereq refeutneerq refeutneeqr refeutnqere refeutnqeer refeutnqree refeutnqree
refeutnqere refeutnqeer refeutnrqee refeutnrqee refeutnreqe refeutnreeq refeutnreeq refeutnreqe refeutneqre refeutneqer
refeutnerqe refeutnereq refeutneerq refeutneeqr refeutenqre refeutenqer refeutenrqe refeutenreq refeutenerq refeuteneqr
refeuteqnre refeuteqner refeuteqrne refeuteqren refeuteqern refeuteqenr refeuterqne refeuterqen refeuternqe refeuterneq
refeuterenq refeutereqn refeuteeqrn refeuteeqnr refeuteerqn refeuteernq refeuteenrq refeuteenqr refeutqenre refeutqener
refeutqerne refeutqeren refeutqeern refeutqeenr refeutqnere refeutqneer refeutqnree refeutqnree refeutqnere refeutqneer
refeutqrnee refeutqrnee refeutqrene refeutqreen refeutqreen refeutqrene refeutqenre refeutqener refeutqerne refeutqeren
refeutqeern refeutqeenr refeutreqne refeutreqen refeutrenqe refeutreneq refeutreenq refeutreeqn refeutrqene refeutrqeen
refeutrqnee refeutrqnee refeutrqene refeutrqeen refeutrnqee refeutrnqee refeutrneqe refeutrneeq refeutrneeq refeutrneqe
refeutreqne refeutreqen refeutrenqe refeutreneq refeutreenq refeutreeqn refeuteeqrn refeuteeqnr refeuteerqn refeuteernq
refeuteenrq refeuteenqr refeuteqern refeuteqenr refeuteqren refeuteqrne refeuteqnre refeuteqner refeuterqen refeuterqne
refeutereqn refeuterenq refeuterneq refeuternqe refeutenqre refeutenqer refeutenrqe refeutenreq refeutenerq refeuteneqr
refeuqntere refeuqnteer refeuqntree refeuqntree refeuqntere refeuqnteer refeuqnetre refeuqneter refeuqnerte refeuqneret
refeuqneert refeuqneetr refeuqnrete refeuqnreet refeuqnrtee refeuqnrtee refeuqnrete refeuqnreet refeuqneert refeuqneetr
refeuqneret refeuqnerte refeuqnetre refeuqneter refeuqtnere refeuqtneer refeuqtnree refeuqtnree refeuqtnere refeuqtneer
refeuqtenre refeuqtener refeuqterne refeuqteren refeuqteern refeuqteenr refeuqtrene refeuqtreen refeuqtrnee refeuqtrnee
refeuqtrene refeuqtreen refeuqteern refeuqteenr refeuqteren refeuqterne refeuqtenre refeuqtener refeuqetnre refeuqetner
refeuqetrne refeuqetren refeuqetern refeuqetenr refeuqentre refeuqenter refeuqenrte refeuqenret refeuqenert refeuqenetr
refeuqernte refeuqernet refeuqertne refeuqerten refeuqeretn refeuqerent refeuqeenrt refeuqeentr refeuqeernt refeuqeertn
refeuqeetrn refeuqeetnr refeuqrtene refeuqrteen refeuqrtnee refeuqrtnee refeuqrtene refeuqrteen refeuqretne refeuqreten
refeuqrente refeuqrenet refeuqreent refeuqreetn refeuqrnete refeuqrneet refeuqrntee refeuqrntee refeuqrnete refeuqrneet
refeuqreent refeuqreetn refeuqrenet refeuqrente refeuqretne refeuqreten refeuqetern refeuqetenr refeuqetren refeuqetrne
refeuqetnre refeuqetner refeuqeetrn refeuqeetnr refeuqeertn refeuqeernt refeuqeenrt refeuqeentr refeuqeretn refeuqerent
refeuqerten refeuqertne refeuqernte refeuqernet refeuqenert refeuqenetr refeuqenret refeuqenrte refeuqentre refeuqenter
refeurntqee refeurntqee refeurnteqe refeurnteeq refeurnteeq refeurnteqe refeurnqtee refeurnqtee refeurnqete refeurnqeet
refeurnqeet refeurnqete refeurneqte refeurneqet refeurnetqe refeurneteq refeurneetq refeurneeqt refeurneqet refeurneqte
refeurneeqt refeurneetq refeurneteq refeurnetqe refeurtnqee refeurtnqee refeurtneqe refeurtneeq refeurtneeq refeurtneqe
refeurtqnee refeurtqnee refeurtqene refeurtqeen refeurtqeen refeurtqene refeurteqne refeurteqen refeurtenqe refeurteneq
refeurteenq refeurteeqn refeurteqen refeurteqne refeurteeqn refeurteenq refeurteneq refeurtenqe refeurqtnee refeurqtnee
refeurqtene refeurqteen refeurqteen refeurqtene refeurqntee refeurqntee refeurqnete refeurqneet refeurqneet refeurqnete
refeurqente refeurqenet refeurqetne refeurqeten refeurqeetn refeurqeent refeurqenet refeurqente refeurqeent refeurqeetn
refeurqeten refeurqetne refeuretqne refeuretqen refeuretnqe refeuretneq refeuretenq refeureteqn refeureqtne refeureqten
refeureqnte refeureqnet refeureqent refeureqetn refeurenqte refeurenqet refeurentqe refeurenteq refeurenetq refeureneqt
refeureeqnt refeureeqtn refeureenqt refeureentq refeureetnq refeureetqn refeuretqen refeuretqne refeureteqn refeuretenq
refeuretneq refeuretnqe refeureqten refeureqtne refeureqetn refeureqent refeureqnet refeureqnte refeureeqtn refeureeqnt
refeureetqn refeureetnq refeureentq refeureenqt refeurenqet refeurenqte refeureneqt refeurenetq refeurenteq refeurentqe
refeuentqre refeuentqer refeuentrqe refeuentreq refeuenterq refeuenteqr refeuenqtre refeuenqter refeuenqrte refeuenqret
refeuenqert refeuenqetr refeuenrqte refeuenrqet refeuenrtqe refeuenrteq refeuenretq refeuenreqt refeueneqrt refeueneqtr
refeuenerqt refeuenertq refeuenetrq refeuenetqr refeuetnqre refeuetnqer refeuetnrqe refeuetnreq refeuetnerq refeuetneqr
refeuetqnre refeuetqner refeuetqrne refeuetqren refeuetqern refeuetqenr refeuetrqne refeuetrqen refeuetrnqe refeuetrneq
refeuetrenq refeuetreqn refeueteqrn refeueteqnr refeueterqn refeueternq refeuetenrq refeuetenqr refeueqtnre refeueqtner
refeueqtrne refeueqtren refeueqtern refeueqtenr refeueqntre refeueqnter refeueqnrte refeueqnret refeueqnert refeueqnetr
refeueqrnte refeueqrnet refeueqrtne refeueqrten refeueqretn refeueqrent refeueqenrt refeueqentr refeueqernt refeueqertn
refeueqetrn refeueqetnr refeuertqne refeuertqen refeuertnqe refeuertneq refeuertenq refeuerteqn refeuerqtne refeuerqten
refeuerqnte refeuerqnet refeuerqent refeuerqetn refeuernqte refeuernqet refeuerntqe refeuernteq refeuernetq refeuerneqt
refeuereqnt refeuereqtn refeuerenqt refeuerentq refeueretnq refeueretqn refeueetqrn refeueetqnr refeueetrqn refeueetrnq
refeueetnrq refeueetnqr refeueeqtrn refeueeqtnr refeueeqrtn refeueeqrnt refeueeqnrt refeueeqntr refeueerqtn refeueerqnt
refeueertqn refeueertnq refeueerntq refeueernqt refeueenqrt refeueenqtr refeueenrqt refeueenrtq refeueentrq refeueentqr
refeeentqur refeeentqru refeeentuqr refeeenturq refeeentruq refeeentrqu refeeenqtur refeeenqtru refeeenqutr refeeenqurt
refeeenqrut refeeenqrtu refeeenuqtr refeeenuqrt refeeenutqr refeeenutrq refeeenurtq refeeenurqt refeeenrqut refeeenrqtu
refeeenruqt refeeenrutq refeeenrtuq refeeenrtqu refeeetnqur refeeetnqru refeeetnuqr refeeetnurq refeeetnruq refeeetnrqu
refeeetqnur refeeetqnru refeeetqunr refeeetqurn refeeetqrun refeeetqrnu refeeetuqnr refeeetuqrn refeeetunqr refeeetunrq
refeeeturnq refeeeturqn refeeetrqun refeeetrqnu refeeetruqn refeeetrunq refeeetrnuq refeeetrnqu refeeeqtnur refeeeqtnru
refeeeqtunr refeeeqturn refeeeqtrun refeeeqtrnu refeeeqntur refeeeqntru refeeeqnutr refeeeqnurt refeeeqnrut refeeeqnrtu
refeeequntr refeeequnrt refeeequtnr refeeequtrn refeeequrtn refeeequrnt refeeeqrnut refeeeqrntu refeeeqrunt refeeeqrutn
refeeeqrtun refeeeqrtnu refeeeutqnr refeeeutqrn refeeeutnqr refeeeutnrq refeeeutrnq refeeeutrqn refeeeuqtnr refeeeuqtrn
refeeeuqntr refeeeuqnrt refeeeuqrnt refeeeuqrtn refeeeunqtr refeeeunqrt refeeeuntqr refeeeuntrq refeeeunrtq refeeeunrqt
refeeeurqnt refeeeurqtn refeeeurnqt refeeeurntq refeeeurtnq refeeeurtqn refeeertqun refeeertqnu refeeertuqn refeeertunq
refeeertnuq refeeertnqu refeeerqtun refeeerqtnu refeeerqutn refeeerqunt refeeerqnut refeeerqntu refeeeruqtn refeeeruqnt
refeeerutqn refeeerutnq refeeeruntq refeeerunqt refeeernqut refeeernqtu refeeernuqt refeeernutq refeeerntuq refeeerntqu
refeenetqur refeenetqru refeenetuqr refeeneturq refeenetruq refeenetrqu refeeneqtur refeeneqtru refeenequtr refeenequrt
refeeneqrut refeeneqrtu refeeneuqtr refeeneuqrt refeeneutqr refeeneutrq refeeneurtq refeeneurqt refeenerqut refeenerqtu
refeeneruqt refeenerutq refeenertuq refeenertqu refeentequr refeenteqru refeenteuqr refeenteurq refeenteruq refeenterqu
refeentqeur refeentqeru refeentquer refeentqure refeentqrue refeentqreu refeentuqer refeentuqre refeentueqr refeentuerq
refeentureq refeenturqe refeentrque refeentrqeu refeentruqe refeentrueq refeentreuq refeentrequ refeenqteur refeenqteru
refeenqtuer refeenqture refeenqtrue refeenqtreu refeenqetur refeenqetru refeenqeutr refeenqeurt refeenqerut refeenqertu
refeenquetr refeenquert refeenquter refeenqutre refeenqurte refeenquret refeenqreut refeenqretu refeenqruet refeenqrute
refeenqrtue refeenqrteu refeenutqer refeenutqre refeenuteqr refeenuterq refeenutreq refeenutrqe refeenuqter refeenuqtre
refeenuqetr refeenuqert refeenuqret refeenuqrte refeenueqtr refeenueqrt refeenuetqr refeenuetrq refeenuertq refeenuerqt
refeenurqet refeenurqte refeenureqt refeenuretq refeenurteq refeenurtqe refeenrtque refeenrtqeu refeenrtuqe refeenrtueq
refeenrteuq refeenrtequ refeenrqtue refeenrqteu refeenrqute refeenrquet refeenrqeut refeenrqetu refeenruqte refeenruqet
refeenrutqe refeenruteq refeenruetq refeenrueqt refeenrequt refeenreqtu refeenreuqt refeenreutq refeenretuq refeenretqu
refeetnequr refeetneqru refeetneuqr refeetneurq refeetneruq refeetnerqu refeetnqeur refeetnqeru refeetnquer refeetnqure
refeetnqrue refeetnqreu refeetnuqer refeetnuqre refeetnueqr refeetnuerq refeetnureq refeetnurqe refeetnrque refeetnrqeu
refeetnruqe refeetnrueq refeetnreuq refeetnrequ refeetenqur refeetenqru refeetenuqr refeetenurq refeetenruq refeetenrqu
refeeteqnur refeeteqnru refeetequnr refeetequrn refeeteqrun refeeteqrnu refeeteuqnr refeeteuqrn refeeteunqr refeeteunrq
refeeteurnq refeeteurqn refeeterqun refeeterqnu refeeteruqn refeeterunq refeeternuq refeeternqu refeetqenur refeetqenru
refeetqeunr refeetqeurn refeetqerun refeetqernu refeetqneur refeetqneru refeetqnuer refeetqnure refeetqnrue refeetqnreu
refeetquner refeetqunre refeetquenr refeetquern refeetquren refeetqurne refeetqrnue refeetqrneu refeetqrune refeetqruen
refeetqreun refeetqrenu refeetueqnr refeetueqrn refeetuenqr refeetuenrq refeetuernq refeetuerqn refeetuqenr refeetuqern
refeetuqner refeetuqnre refeetuqrne refeetuqren refeetunqer refeetunqre refeetuneqr refeetunerq refeetunreq refeetunrqe
refeeturqne refeeturqen refeeturnqe refeeturneq refeeturenq refeetureqn refeetrequn refeetreqnu refeetreuqn refeetreunq
refeetrenuq refeetrenqu refeetrqeun refeetrqenu refeetrquen refeetrqune refeetrqnue refeetrqneu refeetruqen refeetruqne
refeetrueqn refeetruenq refeetruneq refeetrunqe refeetrnque refeetrnqeu refeetrnuqe refeetrnueq refeetrneuq refeetrnequ
refeeqnteur refeeqnteru refeeqntuer refeeqnture refeeqntrue refeeqntreu refeeqnetur refeeqnetru refeeqneutr refeeqneurt
refeeqnerut refeeqnertu refeeqnuetr refeeqnuert refeeqnuter refeeqnutre refeeqnurte refeeqnuret refeeqnreut refeeqnretu
refeeqnruet refeeqnrute refeeqnrtue refeeqnrteu refeeqtneur refeeqtneru refeeqtnuer refeeqtnure refeeqtnrue refeeqtnreu
refeeqtenur refeeqtenru refeeqteunr refeeqteurn refeeqterun refeeqternu refeeqtuenr refeeqtuern refeeqtuner refeeqtunre
refeeqturne refeeqturen refeeqtreun refeeqtrenu refeeqtruen refeeqtrune refeeqtrnue refeeqtrneu refeeqetnur refeeqetnru
refeeqetunr refeeqeturn refeeqetrun refeeqetrnu refeeqentur refeeqentru refeeqenutr refeeqenurt refeeqenrut refeeqenrtu
refeeqeuntr refeeqeunrt refeeqeutnr refeeqeutrn refeeqeurtn refeeqeurnt refeeqernut refeeqerntu refeeqerunt refeeqerutn
refeeqertun refeeqertnu refeequtenr refeequtern refeequtner refeequtnre refeequtrne refeequtren refeequetnr refeequetrn
refeequentr refeequenrt refeequernt refeequertn refeequnetr refeequnert refeequnter refeequntre refeequnrte refeequnret
refeequrent refeequretn refeequrnet refeequrnte refeequrtne refeequrten refeeqrteun refeeqrtenu refeeqrtuen refeeqrtune
refeeqrtnue refeeqrtneu refeeqretun refeeqretnu refeeqreutn refeeqreunt refeeqrenut refeeqrentu refeeqruetn refeeqruent
refeeqruten refeeqrutne refeeqrunte refeeqrunet refeeqrneut refeeqrnetu refeeqrnuet refeeqrnute refeeqrntue refeeqrnteu
refeeuntqer refeeuntqre refeeunteqr refeeunterq refeeuntreq refeeuntrqe refeeunqter refeeunqtre refeeunqetr refeeunqert
refeeunqret refeeunqrte refeeuneqtr refeeuneqrt refeeunetqr refeeunetrq refeeunertq refeeunerqt refeeunrqet refeeunrqte
refeeunreqt refeeunretq refeeunrteq refeeunrtqe refeeutnqer refeeutnqre refeeutneqr refeeutnerq refeeutnreq refeeutnrqe
refeeutqner refeeutqnre refeeutqenr refeeutqern refeeutqren refeeutqrne refeeuteqnr refeeuteqrn refeeutenqr refeeutenrq
refeeuternq refeeuterqn refeeutrqen refeeutrqne refeeutreqn refeeutrenq refeeutrneq refeeutrnqe refeeuqtner refeeuqtnre
refeeuqtenr refeeuqtern refeeuqtren refeeuqtrne refeeuqnter refeeuqntre refeeuqnetr refeeuqnert refeeuqnret refeeuqnrte
refeeuqentr refeeuqenrt refeeuqetnr refeeuqetrn refeeuqertn refeeuqernt refeeuqrnet refeeuqrnte refeeuqrent refeeuqretn
refeeuqrten refeeuqrtne refeeuetqnr refeeuetqrn refeeuetnqr refeeuetnrq refeeuetrnq refeeuetrqn refeeueqtnr refeeueqtrn
refeeueqntr refeeueqnrt refeeueqrnt refeeueqrtn refeeuenqtr refeeuenqrt refeeuentqr refeeuentrq refeeuenrtq refeeuenrqt
refeeuerqnt refeeuerqtn refeeuernqt refeeuerntq refeeuertnq refeeuertqn refeeurtqen refeeurtqne refeeurteqn refeeurtenq
refeeurtneq refeeurtnqe refeeurqten refeeurqtne refeeurqetn refeeurqent refeeurqnet refeeurqnte refeeureqtn refeeureqnt
refeeuretqn refeeuretnq refeeurentq refeeurenqt refeeurnqet refeeurnqte refeeurneqt refeeurnetq refeeurnteq refeeurntqe
refeerntque refeerntqeu refeerntuqe refeerntueq refeernteuq refeerntequ refeernqtue refeernqteu refeernqute refeernquet
refeernqeut refeernqetu refeernuqte refeernuqet refeernutqe refeernuteq refeernuetq refeernueqt refeernequt refeerneqtu
refeerneuqt refeerneutq refeernetuq refeernetqu refeertnque refeertnqeu refeertnuqe refeertnueq refeertneuq refeertnequ
refeertqnue refeertqneu refeertqune refeertquen refeertqeun refeertqenu refeertuqne refeertuqen refeertunqe refeertuneq
refeertuenq refeertueqn refeertequn refeerteqnu refeerteuqn refeerteunq refeertenuq refeertenqu refeerqtnue refeerqtneu
refeerqtune refeerqtuen refeerqteun refeerqtenu refeerqntue refeerqnteu refeerqnute refeerqnuet refeerqneut refeerqnetu
refeerqunte refeerqunet refeerqutne refeerquten refeerquetn refeerquent refeerqenut refeerqentu refeerqeunt refeerqeutn
refeerqetun refeerqetnu refeerutqne refeerutqen refeerutnqe refeerutneq refeerutenq refeeruteqn refeeruqtne refeeruqten
refeeruqnte refeeruqnet refeeruqent refeeruqetn refeerunqte refeerunqet refeeruntqe refeerunteq refeerunetq refeeruneqt
refeerueqnt refeerueqtn refeeruenqt refeeruentq refeeruetnq refeeruetqn refeeretqun refeeretqnu refeeretuqn refeeretunq
refeeretnuq refeeretnqu refeereqtun refeereqtnu refeerequtn refeerequnt refeereqnut refeereqntu refeereuqtn refeereuqnt
refeereutqn refeereutnq refeereuntq refeereunqt refeerenqut refeerenqtu refeerenuqt refeerenutq refeerentuq refeerentqu

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us