easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

nephrohypertrophy

suprachoroid

alred

unfavored

cumae

negotium

jitsuko

didder

shellysheldon

fatherlands

emelle

exteroceptist

inhiantem

dictyota

fucose

locaters

designo

manvella


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: reemerged
cipher variations:
sffnfshfe tggogtigf uhhphujhg viiqivkih wjjrjwlji
xkkskxmkj ylltlynlk zmmumzoml annvnapnm boowobqon
cppxpcrpo dqqyqdsqp errzretrq fssasfusr gttbtgvts
huucuhwut ivvdvixvu jwwewjywv kxxfxkzxw lyygylayx
mzzhzmbzy naaiancaz obbjbodba pcckcpecb qddldqfdc

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: reemerged
Cipher: ivvnvitvw

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: reemerged
Cipher: BAAAA AABAA AABAA ABABB AABAA BAAAA AABBA AABAA AAABB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: reemerged
cipher variations:
sffnfshfeannlnatnkivvjvifvqqddhdqrdwyllflydlcgttdtgptiwjjzjwnjuerrxrezra
mzzvzmlzguhhthuxhmcpprpcjpskxxpxkvxytggogtigfboomobuoljwwkwjgwrreeiersex
zmmgmzemdhuueuhqujxkkakxokvfssysfasbnaawanmahviiuivyindqqsqdkqtlyyqylwyz
uhhphujhgcppnpcvpmkxxlxkhxssffjfstfyannhnafneivvfvirvkyllblyplwgttztgbtc
obbxbonbiwjjvjwzjoerrtrelrumzzrzmxzaviiqivkihdqqoqdwqnlyymyliyttggkgtugz
booiobgofjwwgwjswlzmmcmzqmxhuuauhcudpccycpocjxkkwkxakpfssusfmsvnaasanyab
wjjrjwljierrprexromzznzmjzuuhhlhuvhacppjpchpgkxxhxktxmanndnarnyivvbvidve
qddzdqpdkyllxlyblqgttvtgntwobbtbozbcxkkskxmkjfssqsfyspnaaoankavviimivwib
dqqkqdiqhlyyiyluynbooeobsozjwwcwjewfreeaerqelzmmymzcmrhuuwuhouxpccucpacd
ylltlynlkgttrtgztqobbpbolbwwjjnjwxjcerrlrejrimzzjzmvzocppfpctpakxxdxkfxg
sffbfsrfmannznadnsivvxvipvyqddvdqbdezmmumzomlhuusuhaurpccqcpmcxxkkokxykd
fssmsfksjnaakanwapdqqgqduqblyyeylgyhtggcgtsgnbooaobeotjwwywjqwzreewercef
annvnapnmivvtvibvsqddrdqndyyllplyzlegttntgltkobblboxbqerrhrevrcmzzfzmhzi
uhhdhuthocppbpcfpukxxzxkrxasffxfsdfgboowobqonjwwuwjcwtreeseroezzmmqmzamf
huuouhmulpccmcpycrfssisfwsdnaaganiajviieivuipdqqcqdgqvlyyaylsybtggygtegh
cppxpcrpokxxvxkdxusfftfspfaannrnabngivvpvinvmqddndqzdsgttjtgxteobbhbojbk
wjjfjwvjqerrdrehrwmzzbzmtzcuhhzhufhidqqyqdsqplyywyleyvtggugtqgbboosobcoh
jwwqwjownreeoeraethuukuhyufpccicpkclxkkgkxwkrfssesfisxnaacanuadviiaivgij
errzretrqmzzxzmfzwuhhvhurhccpptpcdpikxxrxkpxosffpfsbfuivvlvizvgqddjdqldm
yllhlyxlsgttftgjtyobbdbovbewjjbjwhjkfssasfusrnaayangaxviiwivsiddqquqdeqj
lyysylqyptggqgtcgvjwwmwjawhreekermenzmmimzymthuuguhkuzpccecpwcfxkkckxikl
gttbtgvtsobbzbohbywjjxjwtjeerrvrefrkmzztzmrzquhhrhudhwkxxnxkbxisfflfsnfo
annjnaznuivvhvilvaqddfdqxdgylldlyjlmhuucuhwutpccacpiczxkkykxukffsswsfgsl
naauansarviisiveixlyyoylcyjtggmgtogpbookobaovjwwiwjmwbreegeryehzmmemzkmn
ivvdvixvuqddbdqjdayllzlyvlggttxtghtmobbvbotbswjjtjwfjymzzpzmdzkuhhnhuphq
cpplpcbpwkxxjxknxcsffhfszfiannfnalnojwwewjywvreecerkebzmmamzwmhhuuyuhiun
pccwcpuctxkkukxgkznaaqanealviioivqirdqqmqdcqxlyykyloydtggigtagjboogobmop
kxxfxkzxwsffdfslfcannbnaxniivvzvijvoqddxdqvduyllvlyhlaobbrbofbmwjjpjwrjs
errnredrymzzlzmpzeuhhjhubhkcpphpcnpqlyygylayxtggegtmgdboocobyojjwwawjkwp
reeyerwevzmmwmzimbpccscpgcnxkkqkxsktfssosfesznaamanqafviikivcildqqiqdoqr
mzzhzmbzyuhhfhunhecppdpczpkkxxbxklxqsffzfsxfwannxnajncqddtdqhdoyllrlytlu
gttptgftaobbnborbgwjjljwdjmerrjreprsnaaiancazviigivoifdqqeqdaqllyycylmyr
tggagtygxbooyobkodreeueriepzmmsmzumvhuuquhgubpccocpschxkkmkxeknfssksfqst
obbjbodbawjjhjwpjgerrfrebrmmzzdzmnzsuhhbhuzhycppzpclpesffvfsjfqanntnavnw
ivvrvihvcqddpdqtdiyllnlyflogttltgrtupcckcpecbxkkikxqkhfssgsfcsnnaaeanoat
viicivaizdqqaqdmqftggwgtkgrboouobwoxjwwswjiwdreeqeruejzmmomzgmphuumuhsuv
qddldqfdcylljlyrligtthtgdtoobbfbopbuwjjdjwbjaerrbrenrguhhxhulhscppvpcxpy
kxxtxkjxesffrfsvfkannpnahnqivvnvitvwreemergedzmmkmzsmjhuuiuheuppccgcpqcv
xkkekxckbfsscsfoshviiyivmitdqqwqdyqzlyyuylkyftggsgtwglbooqobiorjwwowjuwx

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: reemerged
Cipher: errzretrq

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: reemerged
Cipher: 245151235124225141

Extended Methods:
Method #1

Plaintext: reemerged
method variations:
wkkrkwmkibppwpbrpoguubugwutmzzgzmbzy

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
r e e m e r g e d 
2 5 5 2 5 2 2 5 4 
4 1 1 3 1 4 2 1 1 
They are then read out in rows:
255252254411314211
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: reemerged
Cipher: wkkwtacia

Read more ...
Method #3

Plaintext: reemerged
method variations:
yvfxfiwqf vfxfiwqfy fxfiwqfyv
xfiwqfyvf fiwqfyvfx iwqfyvfxf
wqfyvfxfi qfyvfxfiw fyvfxfiwq

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: reemerged

first 5040 cipher variations(362880 total)
reemerged reemergde reemeregd reemeredg reemerdeg reemerdge reemegred reemegrde reemegerd reemegedr reemegder
reemegdre reemeegrd reemeegdr reemeergd reemeerdg reemeedrg reemeedgr reemedger reemedgre reemedegr reemederg
reemedreg reemedrge reemreged reemregde reemreegd reemreedg reemredeg reemredge reemrgeed reemrgede reemrgeed
reemrgede reemrgdee reemrgdee reemreged reemregde reemreegd reemreedg reemredeg reemredge reemrdgee reemrdgee
reemrdege reemrdeeg reemrdeeg reemrdege reemgreed reemgrede reemgreed reemgrede reemgrdee reemgrdee reemgered
reemgerde reemgeerd reemgeedr reemgeder reemgedre reemgeerd reemgeedr reemgered reemgerde reemgedre reemgeder
reemgdeer reemgdere reemgdeer reemgdere reemgdree reemgdree reemerged reemergde reemeregd reemeredg reemerdeg
reemerdge reemegred reemegrde reemegerd reemegedr reemegder reemegdre reemeegrd reemeegdr reemeergd reemeerdg
reemeedrg reemeedgr reemedger reemedgre reemedegr reemederg reemedreg reemedrge reemdrgee reemdrgee reemdrege
reemdreeg reemdreeg reemdrege reemdgree reemdgree reemdgere reemdgeer reemdgeer reemdgere reemdegre reemdeger
reemderge reemdereg reemdeerg reemdeegr reemdeger reemdegre reemdeegr reemdeerg reemdereg reemderge reeemrged
reeemrgde reeemregd reeemredg reeemrdeg reeemrdge reeemgred reeemgrde reeemgerd reeemgedr reeemgder reeemgdre
reeemegrd reeemegdr reeemergd reeemerdg reeemedrg reeemedgr reeemdger reeemdgre reeemdegr reeemderg reeemdreg
reeemdrge reeermged reeermgde reeermegd reeermedg reeermdeg reeermdge reeergmed reeergmde reeergemd reeergedm
reeergdem reeergdme reeeregmd reeeregdm reeeremgd reeeremdg reeeredmg reeeredgm reeerdgem reeerdgme reeerdegm
reeerdemg reeerdmeg reeerdmge reeegrmed reeegrmde reeegremd reeegredm reeegrdem reeegrdme reeegmred reeegmrde
reeegmerd reeegmedr reeegmder reeegmdre reeegemrd reeegemdr reeegermd reeegerdm reeegedrm reeegedmr reeegdmer
reeegdmre reeegdemr reeegderm reeegdrem reeegdrme reeeergmd reeeergdm reeeermgd reeeermdg reeeerdmg reeeerdgm
reeeegrmd reeeegrdm reeeegmrd reeeegmdr reeeegdmr reeeegdrm reeeemgrd reeeemgdr reeeemrgd reeeemrdg reeeemdrg
reeeemdgr reeeedgmr reeeedgrm reeeedmgr reeeedmrg reeeedrmg reeeedrgm reeedrgem reeedrgme reeedregm reeedremg
reeedrmeg reeedrmge reeedgrem reeedgrme reeedgerm reeedgemr reeedgmer reeedgmre reeedegrm reeedegmr reeedergm
reeedermg reeedemrg reeedemgr reeedmger reeedmgre reeedmegr reeedmerg reeedmreg reeedmrge reeremged reeremgde
reeremegd reeremedg reeremdeg reeremdge reeregmed reeregmde reeregemd reeregedm reeregdem reeregdme reereegmd
reereegdm reereemgd reereemdg reereedmg reereedgm reeredgem reeredgme reeredegm reeredemg reeredmeg reeredmge
reermeged reermegde reermeegd reermeedg reermedeg reermedge reermgeed reermgede reermgeed reermgede reermgdee
reermgdee reermeged reermegde reermeegd reermeedg reermedeg reermedge reermdgee reermdgee reermdege reermdeeg
reermdeeg reermdege reergmeed reergmede reergmeed reergmede reergmdee reergmdee reergemed reergemde reergeemd
reergeedm reergedem reergedme reergeemd reergeedm reergemed reergemde reergedme reergedem reergdeem reergdeme
reergdeem reergdeme reergdmee reergdmee reeremged reeremgde reeremegd reeremedg reeremdeg reeremdge reeregmed
reeregmde reeregemd reeregedm reeregdem reeregdme reereegmd reereegdm reereemgd reereemdg reereedmg reereedgm
reeredgem reeredgme reeredegm reeredemg reeredmeg reeredmge reerdmgee reerdmgee reerdmege reerdmeeg reerdmeeg
reerdmege reerdgmee reerdgmee reerdgeme reerdgeem reerdgeem reerdgeme reerdegme reerdegem reerdemge reerdemeg
reerdeemg reerdeegm reerdegem reerdegme reerdeegm reerdeemg reerdemeg reerdemge reegermed reegermde reegeremd
reegeredm reegerdem reegerdme reegemred reegemrde reegemerd reegemedr reegemder reegemdre reegeemrd reegeemdr
reegeermd reegeerdm reegeedrm reegeedmr reegedmer reegedmre reegedemr reegederm reegedrem reegedrme reegremed
reegremde reegreemd reegreedm reegredem reegredme reegrmeed reegrmede reegrmeed reegrmede reegrmdee reegrmdee
reegremed reegremde reegreemd reegreedm reegredem reegredme reegrdmee reegrdmee reegrdeme reegrdeem reegrdeem
reegrdeme reegmreed reegmrede reegmreed reegmrede reegmrdee reegmrdee reegmered reegmerde reegmeerd reegmeedr
reegmeder reegmedre reegmeerd reegmeedr reegmered reegmerde reegmedre reegmeder reegmdeer reegmdere reegmdeer
reegmdere reegmdree reegmdree reegermed reegermde reegeremd reegeredm reegerdem reegerdme reegemred reegemrde
reegemerd reegemedr reegemder reegemdre reegeemrd reegeemdr reegeermd reegeerdm reegeedrm reegeedmr reegedmer
reegedmre reegedemr reegederm reegedrem reegedrme reegdrmee reegdrmee reegdreme reegdreem reegdreem reegdreme
reegdmree reegdmree reegdmere reegdmeer reegdmeer reegdmere reegdemre reegdemer reegderme reegderem reegdeerm
reegdeemr reegdemer reegdemre reegdeemr reegdeerm reegderem reegderme reeeergmd reeeergdm reeeermgd reeeermdg
reeeerdmg reeeerdgm reeeegrmd reeeegrdm reeeegmrd reeeegmdr reeeegdmr reeeegdrm reeeemgrd reeeemgdr reeeemrgd
reeeemrdg reeeemdrg reeeemdgr reeeedgmr reeeedgrm reeeedmgr reeeedmrg reeeedrmg reeeedrgm reeeregmd reeeregdm
reeeremgd reeeremdg reeeredmg reeeredgm reeergemd reeergedm reeergmed reeergmde reeergdme reeergdem reeermged
reeermgde reeermegd reeermedg reeermdeg reeermdge reeerdgme reeerdgem reeerdmge reeerdmeg reeerdemg reeerdegm
reeegremd reeegredm reeegrmed reeegrmde reeegrdme reeegrdem reeegermd reeegerdm reeegemrd reeegemdr reeegedmr
reeegedrm reeegmerd reeegmedr reeegmred reeegmrde reeegmdre reeegmder reeegdemr reeegderm reeegdmer reeegdmre
reeegdrme reeegdrem reeemrged reeemrgde reeemregd reeemredg reeemrdeg reeemrdge reeemgred reeemgrde reeemgerd
reeemgedr reeemgder reeemgdre reeemegrd reeemegdr reeemergd reeemerdg reeemedrg reeemedgr reeemdger reeemdgre
reeemdegr reeemderg reeemdreg reeemdrge reeedrgme reeedrgem reeedrmge reeedrmeg reeedremg reeedregm reeedgrme
reeedgrem reeedgmre reeedgmer reeedgemr reeedgerm reeedmgre reeedmger reeedmrge reeedmreg reeedmerg reeedmegr
reeedegmr reeedegrm reeedemgr reeedemrg reeedermg reeedergm reedergem reedergme reederegm reederemg reedermeg
reedermge reedegrem reedegrme reedegerm reedegemr reedegmer reedegmre reedeegrm reedeegmr reedeergm reedeermg
reedeemrg reedeemgr reedemger reedemgre reedemegr reedemerg reedemreg reedemrge reedregem reedregme reedreegm
reedreemg reedremeg reedremge reedrgeem reedrgeme reedrgeem reedrgeme reedrgmee reedrgmee reedregem reedregme
reedreegm reedreemg reedremeg reedremge reedrmgee reedrmgee reedrmege reedrmeeg reedrmeeg reedrmege reedgreem
reedgreme reedgreem reedgreme reedgrmee reedgrmee reedgerem reedgerme reedgeerm reedgeemr reedgemer reedgemre
reedgeerm reedgeemr reedgerem reedgerme reedgemre reedgemer reedgmeer reedgmere reedgmeer reedgmere reedgmree
reedgmree reedergem reedergme reederegm reederemg reedermeg reedermge reedegrem reedegrme reedegerm reedegemr
reedegmer reedegmre reedeegrm reedeegmr reedeergm reedeermg reedeemrg reedeemgr reedemger reedemgre reedemegr
reedemerg reedemreg reedemrge reedmrgee reedmrgee reedmrege reedmreeg reedmreeg reedmrege reedmgree reedmgree
reedmgere reedmgeer reedmgeer reedmgere reedmegre reedmeger reedmerge reedmereg reedmeerg reedmeegr reedmeger
reedmegre reedmeegr reedmeerg reedmereg reedmerge remeerged remeergde remeeregd remeeredg remeerdeg remeerdge
remeegred remeegrde remeegerd remeegedr remeegder remeegdre remeeegrd remeeegdr remeeergd remeeerdg remeeedrg
remeeedgr remeedger remeedgre remeedegr remeederg remeedreg remeedrge remereged remeregde remereegd remereedg
remeredeg remeredge remergeed remergede remergeed remergede remergdee remergdee remereged remeregde remereegd
remereedg remeredeg remeredge remerdgee remerdgee remerdege remerdeeg remerdeeg remerdege remegreed remegrede
remegreed remegrede remegrdee remegrdee remegered remegerde remegeerd remegeedr remegeder remegedre remegeerd
remegeedr remegered remegerde remegedre remegeder remegdeer remegdere remegdeer remegdere remegdree remegdree
remeerged remeergde remeeregd remeeredg remeerdeg remeerdge remeegred remeegrde remeegerd remeegedr remeegder
remeegdre remeeegrd remeeegdr remeeergd remeeerdg remeeedrg remeeedgr remeedger remeedgre remeedegr remeederg
remeedreg remeedrge remedrgee remedrgee remedrege remedreeg remedreeg remedrege remedgree remedgree remedgere
remedgeer remedgeer remedgere remedegre remedeger remederge remedereg remedeerg remedeegr remedeger remedegre
remedeegr remedeerg remedereg remederge remeerged remeergde remeeregd remeeredg remeerdeg remeerdge remeegred
remeegrde remeegerd remeegedr remeegder remeegdre remeeegrd remeeegdr remeeergd remeeerdg remeeedrg remeeedgr
remeedger remeedgre remeedegr remeederg remeedreg remeedrge remereged remeregde remereegd remereedg remeredeg
remeredge remergeed remergede remergeed remergede remergdee remergdee remereged remeregde remereegd remereedg
remeredeg remeredge remerdgee remerdgee remerdege remerdeeg remerdeeg remerdege remegreed remegrede remegreed
remegrede remegrdee remegrdee remegered remegerde remegeerd remegeedr remegeder remegedre remegeerd remegeedr
remegered remegerde remegedre remegeder remegdeer remegdere remegdeer remegdere remegdree remegdree remeerged
remeergde remeeregd remeeredg remeerdeg remeerdge remeegred remeegrde remeegerd remeegedr remeegder remeegdre
remeeegrd remeeegdr remeeergd remeeerdg remeeedrg remeeedgr remeedger remeedgre remeedegr remeederg remeedreg
remeedrge remedrgee remedrgee remedrege remedreeg remedreeg remedrege remedgree remedgree remedgere remedgeer
remedgeer remedgere remedegre remedeger remederge remedereg remedeerg remedeegr remedeger remedegre remedeegr
remedeerg remedereg remederge remreeged remreegde remreeegd remreeedg remreedeg remreedge remregeed remregede
remregeed remregede remregdee remregdee remreeged remreegde remreeegd remreeedg remreedeg remreedge remredgee
remredgee remredege remredeeg remredeeg remredege remreeged remreegde remreeegd remreeedg remreedeg remreedge
remregeed remregede remregeed remregede remregdee remregdee remreeged remreegde remreeegd remreeedg remreedeg
remreedge remredgee remredgee remredege remredeeg remredeeg remredege remrgeeed remrgeede remrgeeed remrgeede
remrgedee remrgedee remrgeeed remrgeede remrgeeed remrgeede remrgedee remrgedee remrgeeed remrgeede remrgeeed
remrgeede remrgedee remrgedee remrgdeee remrgdeee remrgdeee remrgdeee remrgdeee remrgdeee remreeged remreegde
remreeegd remreeedg remreedeg remreedge remregeed remregede remregeed remregede remregdee remregdee remreeged
remreegde remreeegd remreeedg remreedeg remreedge remredgee remredgee remredege remredeeg remredeeg remredege
remrdegee remrdegee remrdeege remrdeeeg remrdeeeg remrdeege remrdgeee remrdgeee remrdgeee remrdgeee remrdgeee
remrdgeee remrdegee remrdegee remrdeege remrdeeeg remrdeeeg remrdeege remrdegee remrdegee remrdeege remrdeeeg
remrdeeeg remrdeege remgereed remgerede remgereed remgerede remgerdee remgerdee remgeered remgeerde remgeeerd
remgeeedr remgeeder remgeedre remgeeerd remgeeedr remgeered remgeerde remgeedre remgeeder remgedeer remgedere
remgedeer remgedere remgedree remgedree remgreeed remgreede remgreeed remgreede remgredee remgredee remgreeed
remgreede remgreeed remgreede remgredee remgredee remgreeed remgreede remgreeed remgreede remgredee remgredee
remgrdeee remgrdeee remgrdeee remgrdeee remgrdeee remgrdeee remgereed remgerede remgereed remgerede remgerdee
remgerdee remgeered remgeerde remgeeerd remgeeedr remgeeder remgeedre remgeeerd remgeeedr remgeered remgeerde
remgeedre remgeeder remgedeer remgedere remgedeer remgedere remgedree remgedree remgereed remgerede remgereed
remgerede remgerdee remgerdee remgeered remgeerde remgeeerd remgeeedr remgeeder remgeedre remgeeerd remgeeedr
remgeered remgeerde remgeedre remgeeder remgedeer remgedere remgedeer remgedere remgedree remgedree remgdreee
remgdreee remgdreee remgdreee remgdreee remgdreee remgderee remgderee remgdeere remgdeeer remgdeeer remgdeere
remgdeere remgdeeer remgderee remgderee remgdeere remgdeeer remgdeeer remgdeere remgdeeer remgdeere remgderee
remgderee remeerged remeergde remeeregd remeeredg remeerdeg remeerdge remeegred remeegrde remeegerd remeegedr
remeegder remeegdre remeeegrd remeeegdr remeeergd remeeerdg remeeedrg remeeedgr remeedger remeedgre remeedegr
remeederg remeedreg remeedrge remereged remeregde remereegd remereedg remeredeg remeredge remergeed remergede
remergeed remergede remergdee remergdee remereged remeregde remereegd remereedg remeredeg remeredge remerdgee
remerdgee remerdege remerdeeg remerdeeg remerdege remegreed remegrede remegreed remegrede remegrdee remegrdee
remegered remegerde remegeerd remegeedr remegeder remegedre remegeerd remegeedr remegered remegerde remegedre
remegeder remegdeer remegdere remegdeer remegdere remegdree remegdree remeerged remeergde remeeregd remeeredg
remeerdeg remeerdge remeegred remeegrde remeegerd remeegedr remeegder remeegdre remeeegrd remeeegdr remeeergd
remeeerdg remeeedrg remeeedgr remeedger remeedgre remeedegr remeederg remeedreg remeedrge remedrgee remedrgee
remedrege remedreeg remedreeg remedrege remedgree remedgree remedgere remedgeer remedgeer remedgere remedegre
remedeger remederge remedereg remedeerg remedeegr remedeger remedegre remedeegr remedeerg remedereg remederge
remdergee remdergee remderege remdereeg remdereeg remderege remdegree remdegree remdegere remdegeer remdegeer
remdegere remdeegre remdeeger remdeerge remdeereg remdeeerg remdeeegr remdeeger remdeegre remdeeegr remdeeerg
remdeereg remdeerge remdregee remdregee remdreege remdreeeg remdreeeg remdreege remdrgeee remdrgeee remdrgeee
remdrgeee remdrgeee remdrgeee remdregee remdregee remdreege remdreeeg remdreeeg remdreege remdregee remdregee
remdreege remdreeeg remdreeeg remdreege remdgreee remdgreee remdgreee remdgreee remdgreee remdgreee remdgeree
remdgeree remdgeere remdgeeer remdgeeer remdgeere remdgeere remdgeeer remdgeree remdgeree remdgeere remdgeeer
remdgeeer remdgeere remdgeeer remdgeere remdgeree remdgeree remdergee remdergee remderege remdereeg remdereeg
remderege remdegree remdegree remdegere remdegeer remdegeer remdegere remdeegre remdeeger remdeerge remdeereg
remdeeerg remdeeegr remdeeger remdeegre remdeeegr remdeeerg remdeereg remdeerge remdergee remdergee remderege
remdereeg remdereeg remderege remdegree remdegree remdegere remdegeer remdegeer remdegere remdeegre remdeeger
remdeerge remdeereg remdeeerg remdeeegr remdeeger remdeegre remdeeegr remdeeerg remdeereg remdeerge reemerged
reemergde reemeregd reemeredg reemerdeg reemerdge reemegred reemegrde reemegerd reemegedr reemegder reemegdre
reemeegrd reemeegdr reemeergd reemeerdg reemeedrg reemeedgr reemedger reemedgre reemedegr reemederg reemedreg
reemedrge reemreged reemregde reemreegd reemreedg reemredeg reemredge reemrgeed reemrgede reemrgeed reemrgede
reemrgdee reemrgdee reemreged reemregde reemreegd reemreedg reemredeg reemredge reemrdgee reemrdgee reemrdege
reemrdeeg reemrdeeg reemrdege reemgreed reemgrede reemgreed reemgrede reemgrdee reemgrdee reemgered reemgerde
reemgeerd reemgeedr reemgeder reemgedre reemgeerd reemgeedr reemgered reemgerde reemgedre reemgeder reemgdeer
reemgdere reemgdeer reemgdere reemgdree reemgdree reemerged reemergde reemeregd reemeredg reemerdeg reemerdge
reemegred reemegrde reemegerd reemegedr reemegder reemegdre reemeegrd reemeegdr reemeergd reemeerdg reemeedrg
reemeedgr reemedger reemedgre reemedegr reemederg reemedreg reemedrge reemdrgee reemdrgee reemdrege reemdreeg
reemdreeg reemdrege reemdgree reemdgree reemdgere reemdgeer reemdgeer reemdgere reemdegre reemdeger reemderge
reemdereg reemdeerg reemdeegr reemdeger reemdegre reemdeegr reemdeerg reemdereg reemderge reeemrged reeemrgde
reeemregd reeemredg reeemrdeg reeemrdge reeemgred reeemgrde reeemgerd reeemgedr reeemgder reeemgdre reeemegrd
reeemegdr reeemergd reeemerdg reeemedrg reeemedgr reeemdger reeemdgre reeemdegr reeemderg reeemdreg reeemdrge
reeermged reeermgde reeermegd reeermedg reeermdeg reeermdge reeergmed reeergmde reeergemd reeergedm reeergdem
reeergdme reeeregmd reeeregdm reeeremgd reeeremdg reeeredmg reeeredgm reeerdgem reeerdgme reeerdegm reeerdemg
reeerdmeg reeerdmge reeegrmed reeegrmde reeegremd reeegredm reeegrdem reeegrdme reeegmred reeegmrde reeegmerd
reeegmedr reeegmder reeegmdre reeegemrd reeegemdr reeegermd reeegerdm reeegedrm reeegedmr reeegdmer reeegdmre
reeegdemr reeegderm reeegdrem reeegdrme reeeergmd reeeergdm reeeermgd reeeermdg reeeerdmg reeeerdgm reeeegrmd
reeeegrdm reeeegmrd reeeegmdr reeeegdmr reeeegdrm reeeemgrd reeeemgdr reeeemrgd reeeemrdg reeeemdrg reeeemdgr
reeeedgmr reeeedgrm reeeedmgr reeeedmrg reeeedrmg reeeedrgm reeedrgem reeedrgme reeedregm reeedremg reeedrmeg
reeedrmge reeedgrem reeedgrme reeedgerm reeedgemr reeedgmer reeedgmre reeedegrm reeedegmr reeedergm reeedermg
reeedemrg reeedemgr reeedmger reeedmgre reeedmegr reeedmerg reeedmreg reeedmrge reeremged reeremgde reeremegd
reeremedg reeremdeg reeremdge reeregmed reeregmde reeregemd reeregedm reeregdem reeregdme reereegmd reereegdm
reereemgd reereemdg reereedmg reereedgm reeredgem reeredgme reeredegm reeredemg reeredmeg reeredmge reermeged
reermegde reermeegd reermeedg reermedeg reermedge reermgeed reermgede reermgeed reermgede reermgdee reermgdee
reermeged reermegde reermeegd reermeedg reermedeg reermedge reermdgee reermdgee reermdege reermdeeg reermdeeg
reermdege reergmeed reergmede reergmeed reergmede reergmdee reergmdee reergemed reergemde reergeemd reergeedm
reergedem reergedme reergeemd reergeedm reergemed reergemde reergedme reergedem reergdeem reergdeme reergdeem
reergdeme reergdmee reergdmee reeremged reeremgde reeremegd reeremedg reeremdeg reeremdge reeregmed reeregmde
reeregemd reeregedm reeregdem reeregdme reereegmd reereegdm reereemgd reereemdg reereedmg reereedgm reeredgem
reeredgme reeredegm reeredemg reeredmeg reeredmge reerdmgee reerdmgee reerdmege reerdmeeg reerdmeeg reerdmege
reerdgmee reerdgmee reerdgeme reerdgeem reerdgeem reerdgeme reerdegme reerdegem reerdemge reerdemeg reerdeemg
reerdeegm reerdegem reerdegme reerdeegm reerdeemg reerdemeg reerdemge reegermed reegermde reegeremd reegeredm
reegerdem reegerdme reegemred reegemrde reegemerd reegemedr reegemder reegemdre reegeemrd reegeemdr reegeermd
reegeerdm reegeedrm reegeedmr reegedmer reegedmre reegedemr reegederm reegedrem reegedrme reegremed reegremde
reegreemd reegreedm reegredem reegredme reegrmeed reegrmede reegrmeed reegrmede reegrmdee reegrmdee reegremed
reegremde reegreemd reegreedm reegredem reegredme reegrdmee reegrdmee reegrdeme reegrdeem reegrdeem reegrdeme
reegmreed reegmrede reegmreed reegmrede reegmrdee reegmrdee reegmered reegmerde reegmeerd reegmeedr reegmeder
reegmedre reegmeerd reegmeedr reegmered reegmerde reegmedre reegmeder reegmdeer reegmdere reegmdeer reegmdere
reegmdree reegmdree reegermed reegermde reegeremd reegeredm reegerdem reegerdme reegemred reegemrde reegemerd
reegemedr reegemder reegemdre reegeemrd reegeemdr reegeermd reegeerdm reegeedrm reegeedmr reegedmer reegedmre
reegedemr reegederm reegedrem reegedrme reegdrmee reegdrmee reegdreme reegdreem reegdreem reegdreme reegdmree
reegdmree reegdmere reegdmeer reegdmeer reegdmere reegdemre reegdemer reegderme reegderem reegdeerm reegdeemr
reegdemer reegdemre reegdeemr reegdeerm reegderem reegderme reeeergmd reeeergdm reeeermgd reeeermdg reeeerdmg
reeeerdgm reeeegrmd reeeegrdm reeeegmrd reeeegmdr reeeegdmr reeeegdrm reeeemgrd reeeemgdr reeeemrgd reeeemrdg
reeeemdrg reeeemdgr reeeedgmr reeeedgrm reeeedmgr reeeedmrg reeeedrmg reeeedrgm reeeregmd reeeregdm reeeremgd
reeeremdg reeeredmg reeeredgm reeergemd reeergedm reeergmed reeergmde reeergdme reeergdem reeermged reeermgde
reeermegd reeermedg reeermdeg reeermdge reeerdgme reeerdgem reeerdmge reeerdmeg reeerdemg reeerdegm reeegremd
reeegredm reeegrmed reeegrmde reeegrdme reeegrdem reeegermd reeegerdm reeegemrd reeegemdr reeegedmr reeegedrm
reeegmerd reeegmedr reeegmred reeegmrde reeegmdre reeegmder reeegdemr reeegderm reeegdmer reeegdmre reeegdrme
reeegdrem reeemrged reeemrgde reeemregd reeemredg reeemrdeg reeemrdge reeemgred reeemgrde reeemgerd reeemgedr
reeemgder reeemgdre reeemegrd reeemegdr reeemergd reeemerdg reeemedrg reeemedgr reeemdger reeemdgre reeemdegr
reeemderg reeemdreg reeemdrge reeedrgme reeedrgem reeedrmge reeedrmeg reeedremg reeedregm reeedgrme reeedgrem
reeedgmre reeedgmer reeedgemr reeedgerm reeedmgre reeedmger reeedmrge reeedmreg reeedmerg reeedmegr reeedegmr
reeedegrm reeedemgr reeedemrg reeedermg reeedergm reedergem reedergme reederegm reederemg reedermeg reedermge
reedegrem reedegrme reedegerm reedegemr reedegmer reedegmre reedeegrm reedeegmr reedeergm reedeermg reedeemrg
reedeemgr reedemger reedemgre reedemegr reedemerg reedemreg reedemrge reedregem reedregme reedreegm reedreemg
reedremeg reedremge reedrgeem reedrgeme reedrgeem reedrgeme reedrgmee reedrgmee reedregem reedregme reedreegm
reedreemg reedremeg reedremge reedrmgee reedrmgee reedrmege reedrmeeg reedrmeeg reedrmege reedgreem reedgreme
reedgreem reedgreme reedgrmee reedgrmee reedgerem reedgerme reedgeerm reedgeemr reedgemer reedgemre reedgeerm
reedgeemr reedgerem reedgerme reedgemre reedgemer reedgmeer reedgmere reedgmeer reedgmere reedgmree reedgmree
reedergem reedergme reederegm reederemg reedermeg reedermge reedegrem reedegrme reedegerm reedegemr reedegmer
reedegmre reedeegrm reedeegmr reedeergm reedeermg reedeemrg reedeemgr reedemger reedemgre reedemegr reedemerg
reedemreg reedemrge reedmrgee reedmrgee reedmrege reedmreeg reedmreeg reedmrege reedmgree reedmgree reedmgere
reedmgeer reedmgeer reedmgere reedmegre reedmeger reedmerge reedmereg reedmeerg reedmeegr reedmeger reedmegre
reedmeegr reedmeerg reedmereg reedmerge rermeeged rermeegde rermeeegd rermeeedg rermeedeg rermeedge rermegeed
rermegede rermegeed rermegede rermegdee rermegdee rermeeged rermeegde rermeeegd rermeeedg rermeedeg rermeedge
rermedgee rermedgee rermedege rermedeeg rermedeeg rermedege rermeeged rermeegde rermeeegd rermeeedg rermeedeg
rermeedge rermegeed rermegede rermegeed rermegede rermegdee rermegdee rermeeged rermeegde rermeeegd rermeeedg
rermeedeg rermeedge rermedgee rermedgee rermedege rermedeeg rermedeeg rermedege rermgeeed rermgeede rermgeeed
rermgeede rermgedee rermgedee rermgeeed rermgeede rermgeeed rermgeede rermgedee rermgedee rermgeeed rermgeede
rermgeeed rermgeede rermgedee rermgedee rermgdeee rermgdeee rermgdeee rermgdeee rermgdeee rermgdeee rermeeged
rermeegde rermeeegd rermeeedg rermeedeg rermeedge rermegeed rermegede rermegeed rermegede rermegdee rermegdee
rermeeged rermeegde rermeeegd rermeeedg rermeedeg rermeedge rermedgee rermedgee rermedege rermedeeg rermedeeg
rermedege rermdegee rermdegee rermdeege rermdeeeg rermdeeeg rermdeege rermdgeee rermdgeee rermdgeee rermdgeee
rermdgeee rermdgeee rermdegee rermdegee rermdeege rermdeeeg rermdeeeg rermdeege rermdegee rermdegee rermdeege
rermdeeeg rermdeeeg rermdeege reremeged reremegde reremeegd reremeedg reremedeg reremedge reremgeed reremgede
reremgeed reremgede reremgdee reremgdee reremeged reremegde reremeegd reremeedg reremedeg reremedge reremdgee
reremdgee reremdege reremdeeg reremdeeg reremdege rereemged rereemgde rereemegd rereemedg rereemdeg rereemdge
rereegmed rereegmde rereegemd rereegedm rereegdem rereegdme rereeegmd rereeegdm rereeemgd rereeemdg rereeedmg
rereeedgm rereedgem rereedgme rereedegm rereedemg rereedmeg rereedmge reregemed reregemde reregeemd reregeedm
reregedem reregedme reregmeed reregmede reregmeed reregmede reregmdee reregmdee reregemed reregemde reregeemd
reregeedm reregedem reregedme reregdmee reregdmee reregdeme reregdeem reregdeem reregdeme rereeegmd rereeegdm
rereeemgd rereeemdg rereeedmg rereeedgm rereegemd rereegedm rereegmed rereegmde rereegdme rereegdem rereemged
rereemgde rereemegd rereemedg rereemdeg rereemdge rereedgme rereedgem rereedmge rereedmeg rereedemg rereedegm
reredegem reredegme reredeegm reredeemg reredemeg reredemge reredgeem reredgeme reredgeem reredgeme reredgmee
reredgmee reredegem reredegme reredeegm reredeemg reredemeg reredemge reredmgee reredmgee reredmege reredmeeg
reredmeeg reredmege rereemged rereemgde rereemegd rereemedg rereemdeg rereemdge rereegmed rereegmde rereegemd
rereegedm rereegdem rereegdme rereeegmd rereeegdm rereeemgd rereeemdg rereeedmg rereeedgm rereedgem rereedgme
rereedegm rereedemg rereedmeg rereedmge reremeged reremegde reremeegd reremeedg reremedeg reremedge reremgeed
reremgede reremgeed reremgede reremgdee reremgdee reremeged reremegde reremeegd reremeedg reremedeg reremedge
reremdgee reremdgee reremdege reremdeeg reremdeeg reremdege reregmeed reregmede reregmeed reregmede reregmdee
reregmdee reregemed reregemde reregeemd reregeedm reregedem reregedme reregeemd reregeedm reregemed reregemde
reregedme reregedem reregdeem reregdeme reregdeem reregdeme reregdmee reregdmee rereemged rereemgde rereemegd
rereemedg rereemdeg rereemdge rereegmed rereegmde rereegemd rereegedm rereegdem rereegdme rereeegmd rereeegdm
rereeemgd rereeemdg rereeedmg rereeedgm rereedgem rereedgme rereedegm rereedemg rereedmeg rereedmge reredmgee
reredmgee reredmege reredmeeg reredmeeg reredmege reredgmee reredgmee reredgeme reredgeem reredgeem reredgeme
reredegme reredegem reredemge reredemeg reredeemg reredeegm reredegem reredegme reredeegm reredeemg reredemeg
reredemge rergeemed rergeemde rergeeemd rergeeedm rergeedem rergeedme rergemeed rergemede rergemeed rergemede
rergemdee rergemdee rergeemed rergeemde rergeeemd rergeeedm rergeedem rergeedme rergedmee rergedmee rergedeme
rergedeem rergedeem rergedeme rergeemed rergeemde rergeeemd rergeeedm rergeedem rergeedme rergemeed rergemede
rergemeed rergemede rergemdee rergemdee rergeemed rergeemde rergeeemd rergeeedm rergeedem rergeedme rergedmee
rergedmee rergedeme rergedeem rergedeem rergedeme rergmeeed rergmeede rergmeeed rergmeede rergmedee rergmedee
rergmeeed rergmeede rergmeeed rergmeede rergmedee rergmedee rergmeeed rergmeede rergmeeed rergmeede rergmedee
rergmedee rergmdeee rergmdeee rergmdeee rergmdeee rergmdeee rergmdeee rergeemed rergeemde rergeeemd rergeeedm
rergeedem rergeedme rergemeed rergemede rergemeed rergemede rergemdee rergemdee rergeemed rergeemde rergeeemd
rergeeedm rergeedem rergeedme rergedmee rergedmee rergedeme rergedeem rergedeem rergedeme rergdemee rergdemee
rergdeeme rergdeeem rergdeeem rergdeeme rergdmeee rergdmeee rergdmeee rergdmeee rergdmeee rergdmeee rergdemee
rergdemee rergdeeme rergdeeem rergdeeem rergdeeme rergdemee rergdemee rergdeeme rergdeeem rergdeeem rergdeeme
rereeegmd rereeegdm rereeemgd rereeemdg rereeedmg rereeedgm rereegemd rereegedm rereegmed rereegmde rereegdme
rereegdem rereemged rereemgde rereemegd rereemedg rereemdeg rereemdge rereedgme rereedgem rereedmge rereedmeg
rereedemg rereedegm rereeegmd rereeegdm rereeemgd rereeemdg rereeedmg rereeedgm rereegemd rereegedm rereegmed
rereegmde rereegdme rereegdem rereemged rereemgde rereemegd rereemedg rereemdeg rereemdge rereedgme rereedgem
rereedmge rereedmeg rereedemg rereedegm reregeemd reregeedm reregemed reregemde reregedme reregedem reregeemd
reregeedm reregemed reregemde reregedme reregedem reregmeed reregmede reregmeed reregmede reregmdee reregmdee
reregdeme reregdeem reregdmee reregdmee reregdeme reregdeem reremeged reremegde reremeegd reremeedg reremedeg
reremedge reremgeed reremgede reremgeed reremgede reremgdee reremgdee reremeged reremegde reremeegd reremeedg
reremedeg reremedge reremdgee reremdgee reremdege reremdeeg reremdeeg reremdege reredegme reredegem reredemge
reredemeg reredeemg reredeegm reredgeme reredgeem reredgmee reredgmee reredgeme reredgeem reredmgee reredmgee
reredmege reredmeeg reredmeeg reredmege reredegme reredegem reredemge reredemeg reredeemg reredeegm rerdeegem
rerdeegme rerdeeegm rerdeeemg rerdeemeg rerdeemge rerdegeem rerdegeme rerdegeem rerdegeme rerdegmee rerdegmee
rerdeegem rerdeegme rerdeeegm rerdeeemg rerdeemeg rerdeemge rerdemgee rerdemgee rerdemege rerdemeeg rerdemeeg
rerdemege rerdeegem rerdeegme rerdeeegm rerdeeemg rerdeemeg rerdeemge rerdegeem rerdegeme rerdegeem rerdegeme
rerdegmee rerdegmee rerdeegem rerdeegme rerdeeegm rerdeeemg rerdeemeg rerdeemge rerdemgee rerdemgee rerdemege
rerdemeeg rerdemeeg rerdemege rerdgeeem rerdgeeme rerdgeeem rerdgeeme rerdgemee rerdgemee rerdgeeem rerdgeeme
rerdgeeem rerdgeeme rerdgemee rerdgemee rerdgeeem rerdgeeme rerdgeeem rerdgeeme rerdgemee rerdgemee rerdgmeee
rerdgmeee rerdgmeee rerdgmeee rerdgmeee rerdgmeee rerdeegem rerdeegme rerdeeegm rerdeeemg rerdeemeg rerdeemge
rerdegeem rerdegeme rerdegeem rerdegeme rerdegmee rerdegmee rerdeegem rerdeegme rerdeeegm rerdeeemg rerdeemeg
rerdeemge rerdemgee rerdemgee rerdemege rerdemeeg rerdemeeg rerdemege rerdmegee rerdmegee rerdmeege rerdmeeeg
rerdmeeeg rerdmeege rerdmgeee rerdmgeee rerdmgeee rerdmgeee rerdmgeee rerdmgeee rerdmegee rerdmegee rerdmeege
rerdmeeeg rerdmeeeg rerdmeege rerdmegee rerdmegee rerdmeege rerdmeeeg rerdmeeeg rerdmeege regmereed regmerede
regmereed regmerede regmerdee regmerdee regmeered regmeerde regmeeerd regmeeedr regmeeder regmeedre regmeeerd
regmeeedr regmeered regmeerde regmeedre regmeeder regmedeer regmedere regmedeer regmedere regmedree regmedree
regmreeed regmreede regmreeed regmreede regmredee regmredee regmreeed regmreede regmreeed regmreede regmredee
regmredee regmreeed regmreede regmreeed regmreede regmredee regmredee regmrdeee regmrdeee regmrdeee regmrdeee
regmrdeee regmrdeee regmereed regmerede regmereed regmerede regmerdee regmerdee regmeered regmeerde regmeeerd
regmeeedr regmeeder regmeedre regmeeerd regmeeedr regmeered regmeerde regmeedre regmeeder regmedeer regmedere
regmedeer regmedere regmedree regmedree regmereed regmerede regmereed regmerede regmerdee regmerdee regmeered
regmeerde regmeeerd regmeeedr regmeeder regmeedre regmeeerd regmeeedr regmeered regmeerde regmeedre regmeeder
regmedeer regmedere regmedeer regmedere regmedree regmedree regmdreee regmdreee regmdreee regmdreee regmdreee
regmdreee regmderee regmderee regmdeere regmdeeer regmdeeer regmdeere regmdeere regmdeeer regmderee regmderee
regmdeere regmdeeer regmdeeer regmdeere regmdeeer regmdeere regmderee regmderee regemreed regemrede regemreed
regemrede regemrdee regemrdee regemered regemerde regemeerd regemeedr regemeder regemedre regemeerd regemeedr
regemered regemerde regemedre regemeder regemdeer regemdere regemdeer regemdere regemdree regemdree regermeed
regermede regermeed regermede regermdee regermdee regeremed regeremde regereemd regereedm regeredem regeredme
regereemd regereedm regeremed regeremde regeredme regeredem regerdeem regerdeme regerdeem regerdeme regerdmee
regerdmee regeermed regeermde regeeremd regeeredm regeerdem regeerdme regeemred regeemrde regeemerd regeemedr
regeemder regeemdre regeeemrd regeeemdr regeeermd regeeerdm regeeedrm regeeedmr regeedmer regeedmre regeedemr
regeederm regeedrem regeedrme regeeremd regeeredm regeermed regeermde regeerdme regeerdem regeeermd regeeerdm
regeeemrd regeeemdr regeeedmr regeeedrm regeemerd regeemedr regeemred regeemrde regeemdre regeemder regeedemr
regeederm regeedmer regeedmre regeedrme regeedrem regedreem regedreme regedreem regedreme regedrmee regedrmee
regederem regederme regedeerm regedeemr regedemer regedemre regedeerm regedeemr regederem regederme regedemre
regedemer regedmeer regedmere regedmeer regedmere regedmree regedmree regremeed regremede regremeed regremede
regremdee regremdee regreemed regreemde regreeemd regreeedm regreedem regreedme regreeemd regreeedm regreemed
regreemde regreedme regreedem regredeem regredeme regredeem regredeme regredmee regredmee regrmeeed regrmeede
regrmeeed regrmeede regrmedee regrmedee regrmeeed regrmeede regrmeeed regrmeede regrmedee regrmedee regrmeeed
regrmeede regrmeeed regrmeede regrmedee regrmedee regrmdeee regrmdeee regrmdeee regrmdeee regrmdeee regrmdeee
regremeed regremede regremeed regremede regremdee regremdee regreemed regreemde regreeemd regreeedm regreedem
regreedme regreeemd regreeedm regreemed regreemde regreedme regreedem regredeem regredeme regredeem regredeme
regredmee regredmee regremeed regremede regremeed regremede regremdee regremdee regreemed regreemde regreeemd
regreeedm regreedem regreedme regreeemd regreeedm regreemed regreemde regreedme regreedem regredeem regredeme
regredeem regredeme regredmee regredmee regrdmeee regrdmeee regrdmeee regrdmeee regrdmeee regrdmeee regrdemee
regrdemee regrdeeme regrdeeem regrdeeem regrdeeme regrdeeme regrdeeem regrdemee regrdemee regrdeeme regrdeeem
regrdeeem regrdeeme regrdeeem regrdeeme regrdemee regrdemee regeermed regeermde regeeremd regeeredm regeerdem
regeerdme regeemred regeemrde regeemerd regeemedr regeemder regeemdre regeeemrd regeeemdr regeeermd regeeerdm
regeeedrm regeeedmr regeedmer regeedmre regeedemr regeederm regeedrem regeedrme regeremed regeremde regereemd
regereedm regeredem regeredme regermeed regermede regermeed regermede regermdee regermdee regeremed regeremde
regereemd regereedm regeredem regeredme regerdmee regerdmee regerdeme regerdeem regerdeem regerdeme regemreed
regemrede regemreed regemrede regemrdee regemrdee regemered regemerde regemeerd regemeedr regemeder regemedre
regemeerd regemeedr regemered regemerde regemedre regemeder regemdeer regemdere regemdeer regemdere regemdree
regemdree regeermed regeermde regeeremd regeeredm regeerdem regeerdme regeemred regeemrde regeemerd regeemedr
regeemder regeemdre regeeemrd regeeemdr regeeermd regeeerdm regeeedrm regeeedmr regeedmer regeedmre regeedemr
regeederm regeedrem regeedrme regedrmee regedrmee regedreme regedreem regedreem regedreme regedmree regedmree
regedmere regedmeer regedmeer regedmere regedemre regedemer regederme regederem regedeerm regedeemr regedemer
regedemre regedeemr regedeerm regederem regederme regeeremd regeeredm regeermed regeermde regeerdme regeerdem
regeeermd regeeerdm regeeemrd regeeemdr regeeedmr regeeedrm regeemerd regeemedr regeemred regeemrde regeemdre
regeemder regeedemr regeederm regeedmer regeedmre regeedrme regeedrem regereemd regereedm regeremed regeremde
regeredme regeredem regereemd regereedm regeremed regeremde regeredme regeredem regermeed regermede regermeed
regermede regermdee regermdee regerdeme regerdeem regerdmee regerdmee regerdeme regerdeem regeeremd regeeredm
regeermed regeermde regeerdme regeerdem regeeermd regeeerdm regeeemrd regeeemdr regeeedmr regeeedrm regeemerd
regeemedr regeemred regeemrde regeemdre regeemder regeedemr regeederm regeedmer regeedmre regeedrme regeedrem
regemreed regemrede regemreed regemrede regemrdee regemrdee regemered regemerde regemeerd regemeedr regemeder
regemedre regemeerd regemeedr regemered regemerde regemedre regemeder regemdeer regemdere regemdeer regemdere
regemdree regemdree regedreme regedreem regedrmee regedrmee regedreme regedreem regederme regederem regedemre
regedemer regedeemr regedeerm regedmere regedmeer regedmree regedmree regedmere regedmeer regedeemr regedeerm
regedemer regedemre regederme regederem regdereem regdereme regdereem regdereme regdermee regdermee regdeerem
regdeerme regdeeerm regdeeemr regdeemer regdeemre regdeeerm regdeeemr regdeerem regdeerme regdeemre regdeemer
regdemeer regdemere regdemeer regdemere regdemree regdemree regdreeem regdreeme regdreeem regdreeme regdremee
regdremee regdreeem regdreeme regdreeem regdreeme regdremee regdremee regdreeem regdreeme regdreeem regdreeme
regdremee regdremee regdrmeee regdrmeee regdrmeee regdrmeee regdrmeee regdrmeee regdereem regdereme regdereem
regdereme regdermee regdermee regdeerem regdeerme regdeeerm regdeeemr regdeemer regdeemre regdeeerm regdeeemr
regdeerem regdeerme regdeemre regdeemer regdemeer regdemere regdemeer regdemere regdemree regdemree regdereem
regdereme regdereem regdereme regdermee regdermee regdeerem regdeerme regdeeerm regdeeemr regdeemer regdeemre
regdeeerm regdeeemr regdeerem regdeerme regdeemre regdeemer regdemeer regdemere regdemeer regdemere regdemree
regdemree regdmreee regdmreee regdmreee regdmreee regdmreee regdmreee regdmeree regdmeree regdmeere regdmeeer
regdmeeer regdmeere regdmeere regdmeeer regdmeree regdmeree regdmeere regdmeeer regdmeeer regdmeere regdmeeer
regdmeere regdmeree regdmeree reemerged reemergde reemeregd reemeredg reemerdeg reemerdge reemegred reemegrde
reemegerd reemegedr reemegder reemegdre reemeegrd reemeegdr reemeergd reemeerdg reemeedrg reemeedgr reemedger
reemedgre reemedegr reemederg reemedreg reemedrge reemreged reemregde reemreegd reemreedg reemredeg reemredge
reemrgeed reemrgede reemrgeed reemrgede reemrgdee reemrgdee reemreged reemregde reemreegd reemreedg reemredeg
reemredge reemrdgee reemrdgee reemrdege reemrdeeg reemrdeeg reemrdege reemgreed reemgrede reemgreed reemgrede
reemgrdee reemgrdee reemgered reemgerde reemgeerd reemgeedr reemgeder reemgedre reemgeerd reemgeedr reemgered
reemgerde reemgedre reemgeder reemgdeer reemgdere reemgdeer reemgdere reemgdree reemgdree reemerged reemergde
reemeregd reemeredg reemerdeg reemerdge reemegred reemegrde reemegerd reemegedr reemegder reemegdre reemeegrd
reemeegdr reemeergd reemeerdg reemeedrg reemeedgr reemedger reemedgre reemedegr reemederg reemedreg reemedrge
reemdrgee reemdrgee reemdrege reemdreeg reemdreeg reemdrege reemdgree reemdgree reemdgere reemdgeer reemdgeer
reemdgere reemdegre reemdeger reemderge reemdereg reemdeerg reemdeegr reemdeger reemdegre reemdeegr reemdeerg
reemdereg reemderge reeemrged reeemrgde reeemregd reeemredg reeemrdeg reeemrdge reeemgred reeemgrde reeemgerd
reeemgedr reeemgder reeemgdre reeemegrd reeemegdr reeemergd reeemerdg reeemedrg reeemedgr reeemdger reeemdgre
reeemdegr reeemderg reeemdreg reeemdrge reeermged reeermgde reeermegd reeermedg reeermdeg reeermdge reeergmed
reeergmde reeergemd reeergedm reeergdem reeergdme reeeregmd reeeregdm reeeremgd reeeremdg reeeredmg reeeredgm
reeerdgem reeerdgme reeerdegm reeerdemg reeerdmeg reeerdmge reeegrmed reeegrmde reeegremd reeegredm reeegrdem
reeegrdme reeegmred reeegmrde reeegmerd reeegmedr reeegmder reeegmdre reeegemrd reeegemdr reeegermd reeegerdm
reeegedrm reeegedmr reeegdmer reeegdmre reeegdemr reeegderm reeegdrem reeegdrme reeeergmd reeeergdm reeeermgd
reeeermdg reeeerdmg reeeerdgm reeeegrmd reeeegrdm reeeegmrd reeeegmdr reeeegdmr reeeegdrm reeeemgrd reeeemgdr
reeeemrgd reeeemrdg reeeemdrg reeeemdgr reeeedgmr reeeedgrm reeeedmgr reeeedmrg reeeedrmg reeeedrgm reeedrgem
reeedrgme reeedregm reeedremg reeedrmeg reeedrmge reeedgrem reeedgrme reeedgerm reeedgemr reeedgmer reeedgmre
reeedegrm reeedegmr reeedergm reeedermg reeedemrg reeedemgr reeedmger reeedmgre reeedmegr reeedmerg reeedmreg
reeedmrge reeremged reeremgde reeremegd reeremedg reeremdeg reeremdge reeregmed reeregmde reeregemd reeregedm
reeregdem reeregdme reereegmd reereegdm reereemgd reereemdg reereedmg reereedgm reeredgem reeredgme reeredegm
reeredemg reeredmeg reeredmge reermeged reermegde reermeegd reermeedg reermedeg reermedge reermgeed reermgede
reermgeed reermgede reermgdee reermgdee reermeged reermegde reermeegd reermeedg reermedeg reermedge reermdgee
reermdgee reermdege reermdeeg reermdeeg reermdege reergmeed reergmede reergmeed reergmede reergmdee reergmdee
reergemed reergemde reergeemd reergeedm reergedem reergedme reergeemd reergeedm reergemed reergemde reergedme
reergedem reergdeem reergdeme reergdeem reergdeme reergdmee reergdmee reeremged reeremgde reeremegd reeremedg
reeremdeg reeremdge reeregmed reeregmde reeregemd reeregedm reeregdem reeregdme reereegmd reereegdm reereemgd
reereemdg reereedmg reereedgm reeredgem reeredgme reeredegm reeredemg reeredmeg reeredmge reerdmgee reerdmgee
reerdmege reerdmeeg reerdmeeg reerdmege reerdgmee reerdgmee reerdgeme reerdgeem reerdgeem reerdgeme reerdegme
reerdegem reerdemge reerdemeg reerdeemg reerdeegm reerdegem reerdegme reerdeegm reerdeemg reerdemeg reerdemge
reegermed reegermde reegeremd reegeredm reegerdem reegerdme reegemred reegemrde reegemerd reegemedr reegemder
reegemdre reegeemrd reegeemdr reegeermd reegeerdm reegeedrm reegeedmr reegedmer reegedmre reegedemr reegederm
reegedrem reegedrme reegremed reegremde reegreemd reegreedm reegredem reegredme reegrmeed reegrmede reegrmeed
reegrmede reegrmdee reegrmdee reegremed reegremde reegreemd reegreedm reegredem reegredme reegrdmee reegrdmee
reegrdeme reegrdeem reegrdeem reegrdeme reegmreed reegmrede reegmreed reegmrede reegmrdee reegmrdee reegmered
reegmerde reegmeerd reegmeedr reegmeder reegmedre reegmeerd reegmeedr reegmered reegmerde reegmedre reegmeder
reegmdeer reegmdere reegmdeer reegmdere reegmdree reegmdree reegermed reegermde reegeremd reegeredm reegerdem
reegerdme reegemred reegemrde reegemerd reegemedr reegemder reegemdre reegeemrd reegeemdr reegeermd reegeerdm
reegeedrm reegeedmr reegedmer reegedmre reegedemr reegederm reegedrem reegedrme reegdrmee reegdrmee reegdreme
reegdreem reegdreem reegdreme reegdmree reegdmree reegdmere reegdmeer reegdmeer reegdmere reegdemre reegdemer
reegderme reegderem reegdeerm reegdeemr reegdemer reegdemre reegdeemr reegdeerm reegderem reegderme reeeergmd
reeeergdm reeeermgd reeeermdg reeeerdmg reeeerdgm reeeegrmd reeeegrdm reeeegmrd reeeegmdr reeeegdmr reeeegdrm
reeeemgrd reeeemgdr reeeemrgd reeeemrdg reeeemdrg reeeemdgr reeeedgmr reeeedgrm reeeedmgr reeeedmrg reeeedrmg
reeeedrgm reeeregmd reeeregdm reeeremgd reeeremdg reeeredmg reeeredgm reeergemd reeergedm reeergmed reeergmde
reeergdme reeergdem reeermged reeermgde reeermegd reeermedg reeermdeg reeermdge reeerdgme reeerdgem reeerdmge
reeerdmeg reeerdemg reeerdegm reeegremd reeegredm reeegrmed reeegrmde reeegrdme reeegrdem reeegermd reeegerdm
reeegemrd reeegemdr reeegedmr reeegedrm reeegmerd reeegmedr reeegmred reeegmrde reeegmdre reeegmder reeegdemr
reeegderm reeegdmer reeegdmre reeegdrme reeegdrem reeemrged reeemrgde reeemregd reeemredg reeemrdeg reeemrdge
reeemgred reeemgrde reeemgerd reeemgedr reeemgder reeemgdre reeemegrd reeemegdr reeemergd reeemerdg reeemedrg
reeemedgr reeemdger reeemdgre reeemdegr reeemderg reeemdreg reeemdrge reeedrgme reeedrgem reeedrmge reeedrmeg
reeedremg reeedregm reeedgrme reeedgrem reeedgmre reeedgmer reeedgemr reeedgerm reeedmgre reeedmger reeedmrge
reeedmreg reeedmerg reeedmegr reeedegmr reeedegrm reeedemgr reeedemrg reeedermg reeedergm reedergem reedergme
reederegm reederemg reedermeg reedermge reedegrem reedegrme reedegerm reedegemr reedegmer reedegmre reedeegrm
reedeegmr reedeergm reedeermg reedeemrg reedeemgr reedemger reedemgre reedemegr reedemerg reedemreg reedemrge
reedregem reedregme reedreegm reedreemg reedremeg reedremge reedrgeem reedrgeme reedrgeem reedrgeme reedrgmee
reedrgmee reedregem reedregme reedreegm reedreemg reedremeg reedremge reedrmgee reedrmgee reedrmege reedrmeeg
reedrmeeg reedrmege reedgreem reedgreme reedgreem reedgreme reedgrmee reedgrmee reedgerem reedgerme reedgeerm
reedgeemr reedgemer reedgemre reedgeerm reedgeemr reedgerem reedgerme reedgemre reedgemer reedgmeer reedgmere
reedgmeer reedgmere reedgmree reedgmree reedergem reedergme reederegm reederemg reedermeg reedermge reedegrem
reedegrme reedegerm reedegemr reedegmer reedegmre reedeegrm reedeegmr reedeergm reedeermg reedeemrg reedeemgr
reedemger reedemgre reedemegr reedemerg reedemreg reedemrge reedmrgee reedmrgee reedmrege reedmreeg reedmreeg
reedmrege reedmgree reedmgree reedmgere reedmgeer reedmgeer reedmgere reedmegre reedmeger reedmerge reedmereg
reedmeerg reedmeegr reedmeger reedmegre reedmeegr reedmeerg reedmereg reedmerge redmergee redmergee redmerege
redmereeg redmereeg redmerege redmegree redmegree redmegere redmegeer redmegeer redmegere redmeegre redmeeger
redmeerge redmeereg redmeeerg redmeeegr redmeeger redmeegre redmeeegr redmeeerg redmeereg redmeerge redmregee
redmregee redmreege redmreeeg redmreeeg redmreege redmrgeee redmrgeee redmrgeee redmrgeee redmrgeee redmrgeee
redmregee redmregee redmreege redmreeeg redmreeeg redmreege redmregee redmregee redmreege redmreeeg redmreeeg
redmreege redmgreee redmgreee redmgreee redmgreee redmgreee redmgreee redmgeree redmgeree redmgeere redmgeeer
redmgeeer redmgeere redmgeere redmgeeer redmgeree redmgeree redmgeere redmgeeer redmgeeer redmgeere redmgeeer
redmgeere redmgeree redmgeree redmergee redmergee redmerege redmereeg redmereeg redmerege redmegree redmegree
redmegere redmegeer redmegeer redmegere redmeegre redmeeger redmeerge redmeereg redmeeerg redmeeegr redmeeger
redmeegre redmeeegr redmeeerg redmeereg redmeerge redmergee redmergee redmerege redmereeg redmereeg redmerege
redmegree redmegree redmegere redmegeer redmegeer redmegere redmeegre redmeeger redmeerge redmeereg redmeeerg
redmeeegr redmeeger redmeegre redmeeegr redmeeerg redmeereg redmeerge redemrgee redemrgee redemrege redemreeg
redemreeg redemrege redemgree redemgree redemgere redemgeer redemgeer redemgere redemegre redemeger redemerge
redemereg redemeerg redemeegr redemeger redemegre redemeegr redemeerg redemereg redemerge redermgee redermgee
redermege redermeeg redermeeg redermege redergmee redergmee redergeme redergeem redergeem redergeme rederegme
rederegem rederemge rederemeg redereemg redereegm rederegem rederegme redereegm redereemg rederemeg rederemge
redegrmee redegrmee redegreme redegreem redegreem redegreme redegmree redegmree redegmere redegmeer redegmeer
redegmere redegemre redegemer redegerme redegerem redegeerm redegeemr redegemer redegemre redegeemr redegeerm
redegerem redegerme redeergme redeergem redeermge redeermeg redeeremg redeeregm redeegrme redeegrem redeegmre
redeegmer redeegemr redeegerm redeemgre redeemger redeemrge redeemreg redeemerg redeemegr redeeegmr redeeegrm
redeeemgr redeeemrg redeeermg redeeergm redeergem redeergme redeeregm redeeremg redeermeg redeermge redeegrem
redeegrme redeegerm redeegemr redeegmer redeegmre redeeegrm redeeegmr redeeergm redeeermg redeeemrg redeeemgr
redeemger redeemgre redeemegr redeemerg redeemreg redeemrge redremgee redremgee redremege redremeeg redremeeg
redremege redregmee redregmee redregeme redregeem redregeem redregeme redreegme redreegem redreemge redreemeg
redreeemg redreeegm redreegem redreegme redreeegm redreeemg redreemeg redreemge redrmegee redrmegee redrmeege
redrmeeeg redrmeeeg redrmeege redrmgeee redrmgeee redrmgeee redrmgeee redrmgeee redrmgeee redrmegee redrmegee
redrmeege redrmeeeg redrmeeeg redrmeege redrmegee redrmegee redrmeege redrmeeeg redrmeeeg redrmeege redrgmeee
redrgmeee redrgmeee redrgmeee redrgmeee redrgmeee redrgemee redrgemee redrgeeme redrgeeem redrgeeem redrgeeme
redrgeeme redrgeeem redrgemee redrgemee redrgeeme redrgeeem redrgeeem redrgeeme redrgeeem redrgeeme redrgemee
redrgemee redremgee redremgee redremege redremeeg redremeeg redremege redregmee redregmee redregeme redregeem
redregeem redregeme redreegme redreegem redreemge redreemeg redreeemg redreeegm redreegem redreegme redreeegm
redreeemg redreemeg redreemge redremgee redremgee redremege redremeeg redremeeg redremege redregmee redregmee
redregeme redregeem redregeem redregeme redreegme redreegem redreemge redreemeg redreeemg redreeegm redreegem
redreegme redreeegm redreeemg redreemeg redreemge redgermee redgermee redgereme redgereem redgereem redgereme
redgemree redgemree redgemere redgemeer redgemeer redgemere redgeemre redgeemer redgeerme redgeerem redgeeerm
redgeeemr redgeemer redgeemre redgeeemr redgeeerm redgeerem redgeerme redgremee redgremee redgreeme redgreeem
redgreeem redgreeme redgrmeee redgrmeee redgrmeee redgrmeee redgrmeee redgrmeee redgremee redgremee redgreeme
redgreeem redgreeem redgreeme redgremee redgremee redgreeme redgreeem redgreeem redgreeme redgmreee redgmreee
redgmreee redgmreee redgmreee redgmreee redgmeree redgmeree redgmeere redgmeeer redgmeeer redgmeere redgmeere
redgmeeer redgmeree redgmeree redgmeere redgmeeer redgmeeer redgmeere redgmeeer redgmeere redgmeree redgmeree
redgermee redgermee redgereme redgereem redgereem redgereme redgemree redgemree redgemere redgemeer redgemeer
redgemere redgeemre redgeemer redgeerme redgeerem redgeeerm redgeeemr redgeemer redgeemre redgeeemr redgeeerm
redgeerem redgeerme redgermee redgermee redgereme redgereem redgereem redgereme redgemree redgemree redgemere
redgemeer redgemeer redgemere redgeemre redgeemer redgeerme redgeerem redgeeerm redgeeemr redgeemer redgeemre
redgeeemr redgeeerm redgeerem redgeerme redeergme redeergem redeermge redeermeg redeeremg redeeregm redeegrme
redeegrem redeegmre redeegmer redeegemr redeegerm redeemgre redeemger redeemrge redeemreg redeemerg redeemegr
redeeegmr redeeegrm redeeemgr redeeemrg redeeermg redeeergm rederegme rederegem rederemge rederemeg redereemg
redereegm redergeme redergeem redergmee redergmee redergeme redergeem redermgee redermgee redermege redermeeg
redermeeg redermege rederegme rederegem rederemge rederemeg redereemg redereegm redegreme redegreem redegrmee
redegrmee redegreme redegreem redegerme redegerem redegemre redegemer redegeemr redegeerm redegmere redegmeer
redegmree redegmree redegmere redegmeer redegeemr redegeerm redegemer redegemre redegerme redegerem redemrgee
redemrgee redemrege redemreeg redemreeg redemrege redemgree redemgree redemgere redemgeer redemgeer redemgere
redemegre redemeger redemerge redemereg redemeerg redemeegr redemeger redemegre redemeegr redemeerg redemereg
redemerge redeergme redeergem redeermge redeermeg redeeremg redeeregm redeegrme redeegrem redeegmre redeegmer
redeegemr redeegerm redeemgre redeemger redeemrge redeemreg redeemerg redeemegr redeeegmr redeeegrm redeeemgr
redeeemrg redeeermg redeeergm redeergem redeergme redeeregm redeeremg redeermeg redeermge redeegrem redeegrme
redeegerm redeegemr redeegmer redeegmre redeeegrm redeeegmr redeeergm redeeermg redeeemrg redeeemgr redeemger
redeemgre redeemegr redeemerg redeemreg redeemrge rederegem rederegme redereegm redereemg rederemeg rederemge
redergeem redergeme redergeem redergeme redergmee redergmee rederegem rederegme redereegm redereemg rederemeg
rederemge redermgee redermgee redermege redermeeg redermeeg redermege redegreem redegreme redegreem redegreme
redegrmee redegrmee redegerem redegerme redegeerm redegeemr redegemer redegemre redegeerm redegeemr redegerem
redegerme redegemre redegemer redegmeer redegmere redegmeer redegmere redegmree redegmree redeergem redeergme
redeeregm redeeremg redeermeg redeermge redeegrem redeegrme redeegerm redeegemr redeegmer redeegmre redeeegrm
redeeegmr redeeergm redeeermg redeeemrg redeeemgr redeemger redeemgre redeemegr redeemerg redeemreg redeemrge
redemrgee redemrgee redemrege redemreeg redemreeg redemrege redemgree redemgree redemgere redemgeer redemgeer
redemgere redemegre redemeger redemerge redemereg redemeerg redemeegr redemeger redemegre redemeegr redemeerg
redemereg redemerge

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us