easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

biddefordpool

rabican

sprig

solvolyze

corripiebatis

caftaned

mellesse

polyesters

nicklisch

stereopicture

protanomal

unridely

atrophic

ciccone

publicanism

galtonian

perishability

barretts


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: redderes
cipher variations:
sfeefsft tgffgtgu uhgghuhv vihhiviw wjiijwjx
xkjjkxky ylkklylz zmllmzma anmmnanb bonnoboc
cpoopcpd dqppqdqe erqqrerf fsrrsfsg gtsstgth
huttuhui ivuuvivj jwvvwjwk kxwwxkxl lyxxylym
mzyyzmzn nazzanao obaabobp pcbbcpcq qdccdqdr

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: redderes
Cipher: ivwwvivh

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: redderes
Cipher: BAAAA AABAA AAABB AAABB AABAA BAAAA AABAA BAAAB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: redderes
cipher variations:
sfeefsftankknandivqqvivnqdwwdqdxylcclylhgtiitgtrwjuujwjleraarerv
mzggzmzfuhmmhuhpcpsspcpzkxyyxkxjtgffgtgubolloboejwrrwjworexxerey
zmddmzmihujjuhusxkvvkxkmfsbbsfswnahhanagvinniviqdqttqdqalyzzylyk
uhgghuhvcpmmpcpfkxssxkxpsfyyfsfzaneenanjivkkvivtylwwlylngtcctgtx
obiibobhwjoojwjreruurerbmzaazmzlvihhiviwdqnnqdqglyttylyqtgzzgtga
boffobokjwllwjwuzmxxmzmohudduhuypcjjcpcixkppkxksfsvvsfscnabbanam
wjiijwjxeroorerhmzuuzmzruhaahuhbcpggpcplkxmmxkxvanyynanpiveevivz
qdkkdqdjylqqlyltgtwwtgtdobccbobnxkjjkxkyfsppsfsinavvanasvibbivic
dqhhqdqmlynnylywbozzoboqjwffwjwarellerekzmrrmzmuhuxxuhuepcddcpco
ylkklylzgtqqtgtjobwwbobtwjccjwjderiirernmzoozmzxcpaapcprkxggxkxb
sfmmfsflanssnanvivyyvivfqdeedqdpzmllmzmahurruhukpcxxcpcuxkddkxke
fsjjsfsonappanaydqbbqdqslyhhylyctgnngtgmbottobowjwzzwjwgreffereq
anmmnanbivssvivlqdyydqdvyleelylfgtkktgtpobqqbobzerccrertmziizmzd
uhoohuhncpuupcpxkxaaxkxhsfggfsfrbonnobocjwttwjwmrezzerewzmffmzmg
hulluhuqpcrrcpcafsddsfsunajjanaevippiviodqvvqdqylybbylyitghhgtgs
cpoopcpdkxuuxkxnsfaafsfxanggnanhivmmvivrqdssdqdbgteetgtvobkkbobf
wjqqjwjperwwrerzmzcczmzjuhiihuhtdqppqdqelyvvylyotgbbgtgybohhoboi
jwnnwjwsretterechuffuhuwpcllcpcgxkrrkxkqfsxxsfsanaddanakvijjiviu
erqqrerfmzwwzmzpuhcchuhzcpiipcpjkxooxkxtsfuufsfdivggvivxqdmmdqdh
ylsslylrgtyytgtbobeeboblwjkkjwjvfsrrsfsgnaxxanaqviddiviadqjjqdqk
lyppylyutgvvgtgejwhhwjwyrennereizmttmzmshuzzuhucpcffcpcmxkllkxkw
gtsstgthobyybobrwjeejwjberkkrerlmzqqzmzvuhwwhuhfkxiixkxzsfoofsfj
anuunantivaavivdqdggdqdnylmmlylxhuttuhuipczzcpcsxkffkxkcfsllsfsm
narranawvixxiviglyjjylyatgppgtgkbovvoboujwbbwjwerehhereozmnnmzmy
ivuuvivjqdaadqdtylgglyldgtmmtgtnobssbobxwjyyjwjhmzkkzmzbuhqqhuhl
cpwwpcpvkxccxkxfsfiifsfpanoonanzjwvvwjwkrebbereuzmhhmzmehunnuhuo
pcttcpcyxkzzkxkinallanacvirrivimdqxxqdqwlyddylygtgjjgtgqboppoboa
kxwwxkxlsfccfsfvaniinanfivoovivpqduudqdzylaalyljobmmbobdwjssjwjn
eryyrerxmzeezmzhuhkkhuhrcpqqpcpblyxxylymtgddgtgwbojjobogjwppwjwq
revvereazmbbmzmkpcnncpcexkttkxkofszzsfsynaffanaivillivisdqrrqdqc
mzyyzmznuheehuhxcpkkpcphkxqqxkxrsfwwfsfbanccnanlqdoodqdfyluulylp
gtaatgtzobggbobjwjmmjwjterssrerdnazzanaoviffiviydqllqdqilyrrylys
tgxxgtgcboddobomrepperegzmvvmzmqhubbuhuapchhcpckxknnkxkufsttsfse
obaabobpwjggjwjzermmrerjmzsszmztuhyyhuhdcpeepcpnsfqqfsfhanwwnanr
ivccvivbqdiidqdlyloolylvgtuutgtfpcbbcpcqxkhhkxkafsnnsfsknattanau
vizziviedqffqdqotgrrgtgiboxxobosjwddwjwcrejjeremzmppmzmwhuvvuhug
qdccdqdryliilylbgtootgtlobuubobvwjaajwjferggrerpuhsshuhjcpyypcpt
kxeexkxdsfkkfsfnanqqnanxivwwvivhreddereszmjjmzmchuppuhumpcvvcpcw
xkbbkxkgfshhsfsqvittivikdqzzqdqulyffylyetgllgtgoborroboyjwxxwjwi

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: redderes
Cipher: erqqrerf

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: redderes
Cipher: 2451414151245134

Extended Methods:
Method #1

Plaintext: redderes
method variations:
wkiikwkxbpoopbpcguttuguhmzyyzmzn

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
r e d d e r e s 
2 5 4 4 5 2 5 3 
4 1 1 1 1 4 1 4 
They are then read out in rows:
2544525341111414
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: redderes
Cipher: wtkpdaqq

Read more ...
Method #3

Plaintext: redderes
method variations:
yqqvfyli qqvfyliy qvfyliyq
vfyliyqq fyliyqqv yliyqqvf
liyqqvfy iyqqvfyl

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: redderes

first 5040 cipher variations(40320 total)
redderes redderse reddeers reddeesr reddeser reddesre reddrees reddrese reddrees reddrese reddrsee
reddrsee redderes redderse reddeers reddeesr reddeser reddesre reddsree reddsree reddsere reddseer
reddseer reddsere rededres rededrse rededers rededesr rededser rededsre rederdes rederdse redereds
rederesd redersed redersde redeerds redeersd redeedrs redeedsr redeesdr redeesrd redesred redesrde
redeserd redesedr redesder redesdre redredes redredse redreeds redreesd redresed redresde redrdees
redrdese redrdees redrdese redrdsee redrdsee redredes redredse redreeds redreesd redresed redresde
redrsdee redrsdee redrsede redrseed redrseed redrsede redeerds redeersd redeedrs redeedsr redeesdr
redeesrd redereds rederesd rederdes rederdse redersde redersed rededres rededrse rededers rededesr
rededser rededsre redesrde redesred redesdre redesder redesedr redeserd redsered redserde redseerd
redseedr redseder redsedre redsreed redsrede redsreed redsrede redsrdee redsrdee redsered redserde
redseerd redseedr redseder redsedre redsdree redsdree redsdere redsdeer redsdeer redsdere redderes
redderse reddeers reddeesr reddeser reddesre reddrees reddrese reddrees reddrese reddrsee reddrsee
redderes redderse reddeers reddeesr reddeser reddesre reddsree reddsree reddsere reddseer reddseer
reddsere rededres rededrse rededers rededesr rededser rededsre rederdes rederdse redereds rederesd
redersed redersde redeerds redeersd redeedrs redeedsr redeesdr redeesrd redesred redesrde redeserd
redesedr redesder redesdre redredes redredse redreeds redreesd redresed redresde redrdees redrdese
redrdees redrdese redrdsee redrdsee redredes redredse redreeds redreesd redresed redresde redrsdee
redrsdee redrsede redrseed redrseed redrsede redeerds redeersd redeedrs redeedsr redeesdr redeesrd
redereds rederesd rederdes rederdse redersde redersed rededres rededrse rededers rededesr rededser
rededsre redesrde redesred redesdre redesder redesedr redeserd redsered redserde redseerd redseedr
redseder redsedre redsreed redsrede redsreed redsrede redsrdee redsrdee redsered redserde redseerd
redseedr redseder redsedre redsdree redsdree redsdere redsdeer redsdeer redsdere reeddres reeddrse
reedders reeddesr reeddser reeddsre reedrdes reedrdse reedreds reedresd reedrsed reedrsde reederds
reedersd reededrs reededsr reedesdr reedesrd reedsred reedsrde reedserd reedsedr reedsder reedsdre
reeddres reeddrse reedders reeddesr reeddser reeddsre reedrdes reedrdse reedreds reedresd reedrsed
reedrsde reederds reedersd reededrs reededsr reedesdr reedesrd reedsred reedsrde reedserd reedsedr
reedsder reedsdre reerddes reerddse reerdeds reerdesd reerdsed reerdsde reerddes reerddse reerdeds
reerdesd reerdsed reerdsde reeredds reeredsd reeredds reeredsd reeresdd reeresdd reersded reersdde
reersedd reersedd reersded reersdde reeedrds reeedrsd reeeddrs reeeddsr reeedsdr reeedsrd reeerdds
reeerdsd reeerdds reeerdsd reeersdd reeersdd reeedrds reeedrsd reeeddrs reeeddsr reeedsdr reeedsrd
reeesrdd reeesrdd reeesdrd reeesddr reeesddr reeesdrd reesdred reesdrde reesderd reesdedr reesdder
reesddre reesrded reesrdde reesredd reesredd reesrded reesrdde reeserdd reeserdd reesedrd reeseddr
reeseddr reesedrd reesdred reesdrde reesderd reesdedr reesdder reesddre rerdedes rerdedse rerdeeds
rerdeesd rerdesed rerdesde rerddees rerddese rerddees rerddese rerddsee rerddsee rerdedes rerdedse
rerdeeds rerdeesd rerdesed rerdesde rerdsdee rerdsdee rerdsede rerdseed rerdseed rerdsede rereddes
rereddse rerededs reredesd reredsed reredsde rereddes rereddse rerededs reredesd reredsed reredsde
rereedds rereedsd rereedds rereedsd rereesdd rereesdd reresded reresdde reresedd reresedd reresded
reresdde rerdedes rerdedse rerdeeds rerdeesd rerdesed rerdesde rerddees rerddese rerddees rerddese
rerddsee rerddsee rerdedes rerdedse rerdeeds rerdeesd rerdesed rerdesde rerdsdee rerdsdee rerdsede
rerdseed rerdseed rerdsede rereedds rereedsd rereedds rereedsd rereesdd rereesdd rerededs reredesd
rereddes rereddse reredsde reredsed rereddes rereddse rerededs reredesd reredsed reredsde reresdde
reresded reresdde reresded reresedd reresedd rerseded rersedde rerseedd rerseedd rerseded rersedde
rersdeed rersdede rersdeed rersdede rersddee rersddee rerseded rersedde rerseedd rerseedd rerseded
rersedde rersddee rersddee rersdede rersdeed rersdeed rersdede reederds reedersd reededrs reededsr
reedesdr reedesrd reedreds reedresd reedrdes reedrdse reedrsde reedrsed reeddres reeddrse reedders
reeddesr reeddser reeddsre reedsrde reedsred reedsdre reedsder reedsedr reedserd reeedrds reeedrsd
reeeddrs reeeddsr reeedsdr reeedsrd reeerdds reeerdsd reeerdds reeerdsd reeersdd reeersdd reeedrds
reeedrsd reeeddrs reeeddsr reeedsdr reeedsrd reeesrdd reeesrdd reeesdrd reeesddr reeesddr reeesdrd
reeredds reeredsd reeredds reeredsd reeresdd reeresdd reerdeds reerdesd reerddes reerddse reerdsde
reerdsed reerddes reerddse reerdeds reerdesd reerdsed reerdsde reersdde reersded reersdde reersded
reersedd reersedd reederds reedersd reededrs reededsr reedesdr reedesrd reedreds reedresd reedrdes
reedrdse reedrsde reedrsed reeddres reeddrse reedders reeddesr reeddser reeddsre reedsrde reedsred
reedsdre reedsder reedsedr reedserd reeserdd reeserdd reesedrd reeseddr reeseddr reesedrd reesredd
reesredd reesrded reesrdde reesrdde reesrded reesdred reesdrde reesderd reesdedr reesdder reesddre
reesdrde reesdred reesddre reesdder reesdedr reesderd resdered resderde resdeerd resdeedr resdeder
resdedre resdreed resdrede resdreed resdrede resdrdee resdrdee resdered resderde resdeerd resdeedr
resdeder resdedre resddree resddree resddere resddeer resddeer resddere resedred resedrde resederd
resededr resedder reseddre reserded reserdde reseredd reseredd reserded reserdde reseerdd reseerdd
reseedrd reseeddr reseeddr reseedrd resedred resedrde resederd resededr resedder reseddre resreded
resredde resreedd resreedd resreded resredde resrdeed resrdede resrdeed resrdede resrddee resrddee
resreded resredde resreedd resreedd resreded resredde resrddee resrddee resrdede resrdeed resrdeed
resrdede reseerdd reseerdd reseedrd reseeddr reseeddr reseedrd reseredd reseredd reserded reserdde
reserdde reserded resedred resedrde resederd resededr resedder reseddre resedrde resedred reseddre
resedder resededr resederd resdered resderde resdeerd resdeedr resdeder resdedre resdreed resdrede
resdreed resdrede resdrdee resdrdee resdered resderde resdeerd resdeedr resdeder resdedre resddree
resddree resddere resddeer resddeer resddere rdederes rdederse rdedeers rdedeesr rdedeser rdedesre
rdedrees rdedrese rdedrees rdedrese rdedrsee rdedrsee rdederes rdederse rdedeers rdedeesr rdedeser
rdedesre rdedsree rdedsree rdedsere rdedseer rdedseer rdedsere rdeedres rdeedrse rdeeders rdeedesr
rdeedser rdeedsre rdeerdes rdeerdse rdeereds rdeeresd rdeersed rdeersde rdeeerds rdeeersd rdeeedrs
rdeeedsr rdeeesdr rdeeesrd rdeesred rdeesrde rdeeserd rdeesedr rdeesder rdeesdre rderedes rderedse
rdereeds rdereesd rderesed rderesde rderdees rderdese rderdees rderdese rderdsee rderdsee rderedes
rderedse rdereeds rdereesd rderesed rderesde rdersdee rdersdee rdersede rderseed rderseed rdersede
rdeeerds rdeeersd rdeeedrs rdeeedsr rdeeesdr rdeeesrd rdeereds rdeeresd rdeerdes rdeerdse rdeersde
rdeersed rdeedres rdeedrse rdeeders rdeedesr rdeedser rdeedsre rdeesrde rdeesred rdeesdre rdeesder
rdeesedr rdeeserd rdesered rdeserde rdeseerd rdeseedr rdeseder rdesedre rdesreed rdesrede rdesreed
rdesrede rdesrdee rdesrdee rdesered rdeserde rdeseerd rdeseedr rdeseder rdesedre rdesdree rdesdree
rdesdere rdesdeer rdesdeer rdesdere rddeeres rddeerse rddeeers rddeeesr rddeeser rddeesre rdderees
rdderese rdderees rdderese rddersee rddersee rddeeres rddeerse rddeeers rddeeesr rddeeser rddeesre
rddesree rddesree rddesere rddeseer rddeseer rddesere rddeeres rddeerse rddeeers rddeeesr rddeeser
rddeesre rdderees rdderese rdderees rdderese rddersee rddersee rddeeres rddeerse rddeeers rddeeesr
rddeeser rddeesre rddesree rddesree rddesere rddeseer rddeseer rddesere rddreees rddreese rddreees
rddreese rddresee rddresee rddreees rddreese rddreees rddreese rddresee rddresee rddreees rddreese
rddreees rddreese rddresee rddresee rddrseee rddrseee rddrseee rddrseee rddrseee rddrseee rddeeres
rddeerse rddeeers rddeeesr rddeeser rddeesre rdderees rdderese rdderees rdderese rddersee rddersee
rddeeres rddeerse rddeeers rddeeesr rddeeser rddeesre rddesree rddesree rddesere rddeseer rddeseer
rddesere rddseree rddseree rddseere rddseeer rddseeer rddseere rddsreee rddsreee rddsreee rddsreee
rddsreee rddsreee rddseree rddseree rddseere rddseeer rddseeer rddseere rddseree rddseree rddseere
rddseeer rddseeer rddseere rdederes rdederse rdedeers rdedeesr rdedeser rdedesre rdedrees rdedrese
rdedrees rdedrese rdedrsee rdedrsee rdederes rdederse rdedeers rdedeesr rdedeser rdedesre rdedsree
rdedsree rdedsere rdedseer rdedseer rdedsere rdeedres rdeedrse rdeeders rdeedesr rdeedser rdeedsre
rdeerdes rdeerdse rdeereds rdeeresd rdeersed rdeersde rdeeerds rdeeersd rdeeedrs rdeeedsr rdeeesdr
rdeeesrd rdeesred rdeesrde rdeeserd rdeesedr rdeesder rdeesdre rderedes rderedse rdereeds rdereesd
rderesed rderesde rderdees rderdese rderdees rderdese rderdsee rderdsee rderedes rderedse rdereeds
rdereesd rderesed rderesde rdersdee rdersdee rdersede rderseed rderseed rdersede rdeeerds rdeeersd
rdeeedrs rdeeedsr rdeeesdr rdeeesrd rdeereds rdeeresd rdeerdes rdeerdse rdeersde rdeersed rdeedres
rdeedrse rdeeders rdeedesr rdeedser rdeedsre rdeesrde rdeesred rdeesdre rdeesder rdeesedr rdeeserd
rdesered rdeserde rdeseerd rdeseedr rdeseder rdesedre rdesreed rdesrede rdesreed rdesrede rdesrdee
rdesrdee rdesered rdeserde rdeseerd rdeseedr rdeseder rdesedre rdesdree rdesdree rdesdere rdesdeer
rdesdeer rdesdere rdrdeees rdrdeese rdrdeees rdrdeese rdrdesee rdrdesee rdrdeees rdrdeese rdrdeees
rdrdeese rdrdesee rdrdesee rdrdeees rdrdeese rdrdeees rdrdeese rdrdesee rdrdesee rdrdseee rdrdseee
rdrdseee rdrdseee rdrdseee rdrdseee rdredees rdredese rdredees rdredese rdredsee rdredsee rdreedes
rdreedse rdreeeds rdreeesd rdreesed rdreesde rdreeeds rdreeesd rdreedes rdreedse rdreesde rdreesed
rdreseed rdresede rdreseed rdresede rdresdee rdresdee rdreedes rdreedse rdreeeds rdreeesd rdreesed
rdreesde rdredees rdredese rdredees rdredese rdredsee rdredsee rdreedes rdreedse rdreeeds rdreeesd
rdreesed rdreesde rdresdee rdresdee rdresede rdreseed rdreseed rdresede rdreeeds rdreeesd rdreedes
rdreedse rdreesde rdreesed rdreeeds rdreeesd rdreedes rdreedse rdreesde rdreesed rdredees rdredese
rdredees rdredese rdredsee rdredsee rdresede rdreseed rdresdee rdresdee rdresede rdreseed rdrseeed
rdrseede rdrseeed rdrseede rdrsedee rdrsedee rdrseeed rdrseede rdrseeed rdrseede rdrsedee rdrsedee
rdrseeed rdrseede rdrseeed rdrseede rdrsedee rdrsedee rdrsdeee rdrsdeee rdrsdeee rdrsdeee rdrsdeee
rdrsdeee rdederes rdederse rdedeers rdedeesr rdedeser rdedesre rdedrees rdedrese rdedrees rdedrese
rdedrsee rdedrsee rdederes rdederse rdedeers rdedeesr rdedeser rdedesre rdedsree rdedsree rdedsere
rdedseer rdedseer rdedsere rdeedres rdeedrse rdeeders rdeedesr rdeedser rdeedsre rdeerdes rdeerdse
rdeereds rdeeresd rdeersed rdeersde rdeeerds rdeeersd rdeeedrs rdeeedsr rdeeesdr rdeeesrd rdeesred
rdeesrde rdeeserd rdeesedr rdeesder rdeesdre rderedes rderedse rdereeds rdereesd rderesed rderesde
rderdees rderdese rderdees rderdese rderdsee rderdsee rderedes rderedse rdereeds rdereesd rderesed
rderesde rdersdee rdersdee rdersede rderseed rderseed rdersede rdeeerds rdeeersd rdeeedrs rdeeedsr
rdeeesdr rdeeesrd rdeereds rdeeresd rdeerdes rdeerdse rdeersde rdeersed rdeedres rdeedrse rdeeders
rdeedesr rdeedser rdeedsre rdeesrde rdeesred rdeesdre rdeesder rdeesedr rdeeserd rdesered rdeserde
rdeseerd rdeseedr rdeseder rdesedre rdesreed rdesrede rdesreed rdesrede rdesrdee rdesrdee rdesered
rdeserde rdeseerd rdeseedr rdeseder rdesedre rdesdree rdesdree rdesdere rdesdeer rdesdeer rdesdere
rdsderee rdsderee rdsdeere rdsdeeer rdsdeeer rdsdeere rdsdreee rdsdreee rdsdreee rdsdreee rdsdreee
rdsdreee rdsderee rdsderee rdsdeere rdsdeeer rdsdeeer rdsdeere rdsderee rdsderee rdsdeere rdsdeeer
rdsdeeer rdsdeere rdsedree rdsedree rdsedere rdsedeer rdsedeer rdsedere rdserdee rdserdee rdserede
rdsereed rdsereed rdserede rdseerde rdseered rdseedre rdseeder rdseeedr rdseeerd rdseered rdseerde
rdseeerd rdseeedr rdseeder rdseedre rdsredee rdsredee rdsreede rdsreeed rdsreeed rdsreede rdsrdeee
rdsrdeee rdsrdeee rdsrdeee rdsrdeee rdsrdeee rdsredee rdsredee rdsreede rdsreeed rdsreeed rdsreede
rdsredee rdsredee rdsreede rdsreeed rdsreeed rdsreede rdseerde rdseered rdseedre rdseeder rdseeedr
rdseeerd rdserede rdsereed rdserdee rdserdee rdserede rdsereed rdsedree rdsedree rdsedere rdsedeer
rdsedeer rdsedere rdseerde rdseered rdseedre rdseeder rdseeedr rdseeerd rdseered rdseerde rdseeerd
rdseeedr rdseeder rdseedre rdsereed rdserede rdsereed rdserede rdserdee rdserdee rdseered rdseerde
rdseeerd rdseeedr rdseeder rdseedre rdsedree rdsedree rdsedere rdsedeer rdsedeer rdsedere rddeeres
rddeerse rddeeers rddeeesr rddeeser rddeesre rdderees rdderese rdderees rdderese rddersee rddersee
rddeeres rddeerse rddeeers rddeeesr rddeeser rddeesre rddesree rddesree rddesere rddeseer rddeseer
rddesere rddeeres rddeerse rddeeers rddeeesr rddeeser rddeesre rdderees rdderese rdderees rdderese
rddersee rddersee rddeeres rddeerse rddeeers rddeeesr rddeeser rddeesre rddesree rddesree rddesere
rddeseer rddeseer rddesere rddreees rddreese rddreees rddreese rddresee rddresee rddreees rddreese
rddreees rddreese rddresee rddresee rddreees rddreese rddreees rddreese rddresee rddresee rddrseee
rddrseee rddrseee rddrseee rddrseee rddrseee rddeeres rddeerse rddeeers rddeeesr rddeeser rddeesre
rdderees rdderese rdderees rdderese rddersee rddersee rddeeres rddeerse rddeeers rddeeesr rddeeser
rddeesre rddesree rddesree rddesere rddeseer rddeseer rddesere rddseree rddseree rddseere rddseeer
rddseeer rddseere rddsreee rddsreee rddsreee rddsreee rddsreee rddsreee rddseree rddseree rddseere
rddseeer rddseeer rddseere rddseree rddseree rddseere rddseeer rddseeer rddseere rdederes rdederse
rdedeers rdedeesr rdedeser rdedesre rdedrees rdedrese rdedrees rdedrese rdedrsee rdedrsee rdederes
rdederse rdedeers rdedeesr rdedeser rdedesre rdedsree rdedsree rdedsere rdedseer rdedseer rdedsere
rdeedres rdeedrse rdeeders rdeedesr rdeedser rdeedsre rdeerdes rdeerdse rdeereds rdeeresd rdeersed
rdeersde rdeeerds rdeeersd rdeeedrs rdeeedsr rdeeesdr rdeeesrd rdeesred rdeesrde rdeeserd rdeesedr
rdeesder rdeesdre rderedes rderedse rdereeds rdereesd rderesed rderesde rderdees rderdese rderdees
rderdese rderdsee rderdsee rderedes rderedse rdereeds rdereesd rderesed rderesde rdersdee rdersdee
rdersede rderseed rderseed rdersede rdeeerds rdeeersd rdeeedrs rdeeedsr rdeeesdr rdeeesrd rdeereds
rdeeresd rdeerdes rdeerdse rdeersde rdeersed rdeedres rdeedrse rdeeders rdeedesr rdeedser rdeedsre
rdeesrde rdeesred rdeesdre rdeesder rdeesedr rdeeserd rdesered rdeserde rdeseerd rdeseedr rdeseder
rdesedre rdesreed rdesrede rdesreed rdesrede rdesrdee rdesrdee rdesered rdeserde rdeseerd rdeseedr
rdeseder rdesedre rdesdree rdesdree rdesdere rdesdeer rdesdeer rdesdere rdeedres rdeedrse rdeeders
rdeedesr rdeedser rdeedsre rdeerdes rdeerdse rdeereds rdeeresd rdeersed rdeersde rdeeerds rdeeersd
rdeeedrs rdeeedsr rdeeesdr rdeeesrd rdeesred rdeesrde rdeeserd rdeesedr rdeesder rdeesdre rdederes
rdederse rdedeers rdedeesr rdedeser rdedesre rdedrees rdedrese rdedrees rdedrese rdedrsee rdedrsee
rdederes rdederse rdedeers rdedeesr rdedeser rdedesre rdedsree rdedsree rdedsere rdedseer rdedseer
rdedsere rderdees rderdese rderdees rderdese rderdsee rderdsee rderedes rderedse rdereeds rdereesd
rderesed rderesde rdereeds rdereesd rderedes rderedse rderesde rderesed rderseed rdersede rderseed
rdersede rdersdee rdersdee rdeedres rdeedrse rdeeders rdeedesr rdeedser rdeedsre rdeerdes rdeerdse
rdeereds rdeeresd rdeersed rdeersde rdeeerds rdeeersd rdeeedrs rdeeedsr rdeeesdr rdeeesrd rdeesred
rdeesrde rdeeserd rdeesedr rdeesder rdeesdre rdesdree rdesdree rdesdere rdesdeer rdesdeer rdesdere
rdesrdee rdesrdee rdesrede rdesreed rdesreed rdesrede rdeserde rdesered rdesedre rdeseder rdeseedr
rdeseerd rdesered rdeserde rdeseerd rdeseedr rdeseder rdesedre rdreedes rdreedse rdreeeds rdreeesd
rdreesed rdreesde rdredees rdredese rdredees rdredese rdredsee rdredsee rdreedes rdreedse rdreeeds
rdreeesd rdreesed rdreesde rdresdee rdresdee rdresede rdreseed rdreseed rdresede rdreedes rdreedse
rdreeeds rdreeesd rdreesed rdreesde rdredees rdredese rdredees rdredese rdredsee rdredsee rdreedes
rdreedse rdreeeds rdreeesd rdreesed rdreesde rdresdee rdresdee rdresede rdreseed rdreseed rdresede
rdrdeees rdrdeese rdrdeees rdrdeese rdrdesee rdrdesee rdrdeees rdrdeese rdrdeees rdrdeese rdrdesee
rdrdesee rdrdeees rdrdeese rdrdeees rdrdeese rdrdesee rdrdesee rdrdseee rdrdseee rdrdseee rdrdseee
rdrdseee rdrdseee rdreedes rdreedse rdreeeds rdreeesd rdreesed rdreesde rdredees rdredese rdredees
rdredese rdredsee rdredsee rdreedes rdreedse rdreeeds rdreeesd rdreesed rdreesde rdresdee rdresdee
rdresede rdreseed rdreseed rdresede rdrsedee rdrsedee rdrseede rdrseeed rdrseeed rdrseede rdrsdeee
rdrsdeee rdrsdeee rdrsdeee rdrsdeee rdrsdeee rdrsedee rdrsedee rdrseede rdrseeed rdrseeed rdrseede
rdrsedee rdrsedee rdrseede rdrseeed rdrseeed rdrseede rdeeerds rdeeersd rdeeedrs rdeeedsr rdeeesdr
rdeeesrd rdeereds rdeeresd rdeerdes rdeerdse rdeersde rdeersed rdeedres rdeedrse rdeeders rdeedesr
rdeedser rdeedsre rdeesrde rdeesred rdeesdre rdeesder rdeesedr rdeeserd rdeeerds rdeeersd rdeeedrs
rdeeedsr rdeeesdr rdeeesrd rdeereds rdeeresd rdeerdes rdeerdse rdeersde rdeersed rdeedres rdeedrse
rdeeders rdeedesr rdeedser rdeedsre rdeesrde rdeesred rdeesdre rdeesder rdeesedr rdeeserd rdereeds
rdereesd rderedes rderedse rderesde rderesed rdereeds rdereesd rderedes rderedse rderesde rderesed
rderdees rderdese rderdees rderdese rderdsee rderdsee rdersede rderseed rdersdee rdersdee rdersede
rderseed rdederes rdederse rdedeers rdedeesr rdedeser rdedesre rdedrees rdedrese rdedrees rdedrese
rdedrsee rdedrsee rdederes rdederse rdedeers rdedeesr rdedeser rdedesre rdedsree rdedsree rdedsere
rdedseer rdedseer rdedsere rdeserde rdesered rdesedre rdeseder rdeseedr rdeseerd rdesrede rdesreed
rdesrdee rdesrdee rdesrede rdesreed rdesdree rdesdree rdesdere rdesdeer rdesdeer rdesdere rdeserde
rdesered rdesedre rdeseder rdeseedr rdeseerd rdseered rdseerde rdseeerd rdseeedr rdseeder rdseedre
rdsereed rdserede rdsereed rdserede rdserdee rdserdee rdseered rdseerde rdseeerd rdseeedr rdseeder
rdseedre rdsedree rdsedree rdsedere rdsedeer rdsedeer rdsedere rdseered rdseerde rdseeerd rdseeedr
rdseeder rdseedre rdsereed rdserede rdsereed rdserede rdserdee rdserdee rdseered rdseerde rdseeerd
rdseeedr rdseeder rdseedre rdsedree rdsedree rdsedere rdsedeer rdsedeer rdsedere rdsreeed rdsreede
rdsreeed rdsreede rdsredee rdsredee rdsreeed rdsreede rdsreeed rdsreede rdsredee rdsredee rdsreeed
rdsreede rdsreeed rdsreede rdsredee rdsredee rdsrdeee rdsrdeee rdsrdeee rdsrdeee rdsrdeee rdsrdeee
rdseered rdseerde rdseeerd rdseeedr rdseeder rdseedre rdsereed rdserede rdsereed rdserede rdserdee
rdserdee rdseered rdseerde rdseeerd rdseeedr rdseeder rdseedre rdsedree rdsedree rdsedere rdsedeer
rdsedeer rdsedere rdsderee rdsderee rdsdeere rdsdeeer rdsdeeer rdsdeere rdsdreee rdsdreee rdsdreee
rdsdreee rdsdreee rdsdreee rdsderee rdsderee rdsdeere rdsdeeer rdsdeeer rdsdeere rdsderee rdsderee
rdsdeere rdsdeeer rdsdeeer rdsdeere redderes redderse reddeers reddeesr reddeser reddesre reddrees
reddrese reddrees reddrese reddrsee reddrsee redderes redderse reddeers reddeesr reddeser reddesre
reddsree reddsree reddsere reddseer reddseer reddsere rededres rededrse rededers rededesr rededser
rededsre rederdes rederdse redereds rederesd redersed redersde redeerds redeersd redeedrs redeedsr
redeesdr redeesrd redesred redesrde redeserd redesedr redesder redesdre redredes redredse redreeds
redreesd redresed redresde redrdees redrdese redrdees redrdese redrdsee redrdsee redredes redredse
redreeds redreesd redresed redresde redrsdee redrsdee redrsede redrseed redrseed redrsede redeerds
redeersd redeedrs redeedsr redeesdr redeesrd redereds rederesd rederdes rederdse redersde redersed
rededres rededrse rededers rededesr rededser rededsre redesrde redesred redesdre redesder redesedr
redeserd redsered redserde redseerd redseedr redseder redsedre redsreed redsrede redsreed redsrede
redsrdee redsrdee redsered redserde redseerd redseedr redseder redsedre redsdree redsdree redsdere
redsdeer redsdeer redsdere redderes redderse reddeers reddeesr reddeser reddesre reddrees reddrese
reddrees reddrese reddrsee reddrsee redderes redderse reddeers reddeesr reddeser reddesre reddsree
reddsree reddsere reddseer reddseer reddsere rededres rededrse rededers rededesr rededser rededsre
rederdes rederdse redereds rederesd redersed redersde redeerds redeersd redeedrs redeedsr redeesdr
redeesrd redesred redesrde redeserd redesedr redesder redesdre redredes redredse redreeds redreesd
redresed redresde redrdees redrdese redrdees redrdese redrdsee redrdsee redredes redredse redreeds
redreesd redresed redresde redrsdee redrsdee redrsede redrseed redrseed redrsede redeerds redeersd
redeedrs redeedsr redeesdr redeesrd redereds rederesd rederdes rederdse redersde redersed rededres
rededrse rededers rededesr rededser rededsre redesrde redesred redesdre redesder redesedr redeserd
redsered redserde redseerd redseedr redseder redsedre redsreed redsrede redsreed redsrede redsrdee
redsrdee redsered redserde redseerd redseedr redseder redsedre redsdree redsdree redsdere redsdeer
redsdeer redsdere reeddres reeddrse reedders reeddesr reeddser reeddsre reedrdes reedrdse reedreds
reedresd reedrsed reedrsde reederds reedersd reededrs reededsr reedesdr reedesrd reedsred reedsrde
reedserd reedsedr reedsder reedsdre reeddres reeddrse reedders reeddesr reeddser reeddsre reedrdes
reedrdse reedreds reedresd reedrsed reedrsde reederds reedersd reededrs reededsr reedesdr reedesrd
reedsred reedsrde reedserd reedsedr reedsder reedsdre reerddes reerddse reerdeds reerdesd reerdsed
reerdsde reerddes reerddse reerdeds reerdesd reerdsed reerdsde reeredds reeredsd reeredds reeredsd
reeresdd reeresdd reersded reersdde reersedd reersedd reersded reersdde reeedrds reeedrsd reeeddrs
reeeddsr reeedsdr reeedsrd reeerdds reeerdsd reeerdds reeerdsd reeersdd reeersdd reeedrds reeedrsd
reeeddrs reeeddsr reeedsdr reeedsrd reeesrdd reeesrdd reeesdrd reeesddr reeesddr reeesdrd reesdred
reesdrde reesderd reesdedr reesdder reesddre reesrded reesrdde reesredd reesredd reesrded reesrdde
reeserdd reeserdd reesedrd reeseddr reeseddr reesedrd reesdred reesdrde reesderd reesdedr reesdder
reesddre rerdedes rerdedse rerdeeds rerdeesd rerdesed rerdesde rerddees rerddese rerddees rerddese
rerddsee rerddsee rerdedes rerdedse rerdeeds rerdeesd rerdesed rerdesde rerdsdee rerdsdee rerdsede
rerdseed rerdseed rerdsede rereddes rereddse rerededs reredesd reredsed reredsde rereddes rereddse
rerededs reredesd reredsed reredsde rereedds rereedsd rereedds rereedsd rereesdd rereesdd reresded
reresdde reresedd reresedd reresded reresdde rerdedes rerdedse rerdeeds rerdeesd rerdesed rerdesde
rerddees rerddese rerddees rerddese rerddsee rerddsee rerdedes rerdedse rerdeeds rerdeesd rerdesed
rerdesde rerdsdee rerdsdee rerdsede rerdseed rerdseed rerdsede rereedds rereedsd rereedds rereedsd
rereesdd rereesdd rerededs reredesd rereddes rereddse reredsde reredsed rereddes rereddse rerededs
reredesd reredsed reredsde reresdde reresded reresdde reresded reresedd reresedd rerseded rersedde
rerseedd rerseedd rerseded rersedde rersdeed rersdede rersdeed rersdede rersddee rersddee rerseded
rersedde rerseedd rerseedd rerseded rersedde rersddee rersddee rersdede rersdeed rersdeed rersdede
reederds reedersd reededrs reededsr reedesdr reedesrd reedreds reedresd reedrdes reedrdse reedrsde
reedrsed reeddres reeddrse reedders reeddesr reeddser reeddsre reedsrde reedsred reedsdre reedsder
reedsedr reedserd reeedrds reeedrsd reeeddrs reeeddsr reeedsdr reeedsrd reeerdds reeerdsd reeerdds
reeerdsd reeersdd reeersdd reeedrds reeedrsd reeeddrs reeeddsr reeedsdr reeedsrd reeesrdd reeesrdd
reeesdrd reeesddr reeesddr reeesdrd reeredds reeredsd reeredds reeredsd reeresdd reeresdd reerdeds
reerdesd reerddes reerddse reerdsde reerdsed reerddes reerddse reerdeds reerdesd reerdsed reerdsde
reersdde reersded reersdde reersded reersedd reersedd reederds reedersd reededrs reededsr reedesdr
reedesrd reedreds reedresd reedrdes reedrdse reedrsde reedrsed reeddres reeddrse reedders reeddesr
reeddser reeddsre reedsrde reedsred reedsdre reedsder reedsedr reedserd reeserdd reeserdd reesedrd
reeseddr reeseddr reesedrd reesredd reesredd reesrded reesrdde reesrdde reesrded reesdred reesdrde
reesderd reesdedr reesdder reesddre reesdrde reesdred reesddre reesdder reesdedr reesderd resdered
resderde resdeerd resdeedr resdeder resdedre resdreed resdrede resdreed resdrede resdrdee resdrdee
resdered resderde resdeerd resdeedr resdeder resdedre resddree resddree resddere resddeer resddeer
resddere resedred resedrde resederd resededr resedder reseddre reserded reserdde reseredd reseredd
reserded reserdde reseerdd reseerdd reseedrd reseeddr reseeddr reseedrd resedred resedrde resederd
resededr resedder reseddre resreded resredde resreedd resreedd resreded resredde resrdeed resrdede
resrdeed resrdede resrddee resrddee resreded resredde resreedd resreedd resreded resredde resrddee
resrddee resrdede resrdeed resrdeed resrdede reseerdd reseerdd reseedrd reseeddr reseeddr reseedrd
reseredd reseredd reserded reserdde reserdde reserded resedred resedrde resederd resededr resedder
reseddre resedrde resedred reseddre resedder resededr resederd resdered resderde resdeerd resdeedr
resdeder resdedre resdreed resdrede resdreed resdrede resdrdee resdrdee resdered resderde resdeerd
resdeedr resdeder resdedre resddree resddree resddere resddeer resddeer resddere rrddeees rrddeese
rrddeees rrddeese rrddesee rrddesee rrddeees rrddeese rrddeees rrddeese rrddesee rrddesee rrddeees
rrddeese rrddeees rrddeese rrddesee rrddesee rrddseee rrddseee rrddseee rrddseee rrddseee rrddseee
rrdedees rrdedese rrdedees rrdedese rrdedsee rrdedsee rrdeedes rrdeedse rrdeeeds rrdeeesd rrdeesed
rrdeesde rrdeeeds rrdeeesd rrdeedes rrdeedse rrdeesde rrdeesed rrdeseed rrdesede rrdeseed rrdesede
rrdesdee rrdesdee rrdeedes rrdeedse rrdeeeds rrdeeesd rrdeesed rrdeesde rrdedees rrdedese rrdedees
rrdedese rrdedsee rrdedsee rrdeedes rrdeedse rrdeeeds rrdeeesd rrdeesed rrdeesde rrdesdee rrdesdee
rrdesede rrdeseed rrdeseed rrdesede rrdeeeds rrdeeesd rrdeedes rrdeedse rrdeesde rrdeesed rrdeeeds
rrdeeesd rrdeedes rrdeedse rrdeesde rrdeesed rrdedees rrdedese rrdedees rrdedese rrdedsee rrdedsee
rrdesede rrdeseed rrdesdee rrdesdee rrdesede rrdeseed rrdseeed rrdseede rrdseeed rrdseede rrdsedee
rrdsedee rrdseeed rrdseede rrdseeed rrdseede rrdsedee rrdsedee rrdseeed rrdseede rrdseeed rrdseede
rrdsedee rrdsedee rrdsdeee rrdsdeee rrdsdeee rrdsdeee rrdsdeee rrdsdeee rrddeees rrddeese rrddeees
rrddeese rrddesee rrddesee rrddeees rrddeese rrddeees rrddeese rrddesee rrddesee rrddeees rrddeese
rrddeees rrddeese rrddesee rrddesee rrddseee rrddseee rrddseee rrddseee rrddseee rrddseee rrdedees
rrdedese rrdedees rrdedese rrdedsee rrdedsee rrdeedes rrdeedse rrdeeeds rrdeeesd rrdeesed rrdeesde
rrdeeeds rrdeeesd rrdeedes rrdeedse rrdeesde rrdeesed rrdeseed rrdesede rrdeseed rrdesede rrdesdee
rrdesdee rrdeedes rrdeedse rrdeeeds rrdeeesd rrdeesed rrdeesde rrdedees rrdedese rrdedees rrdedese
rrdedsee rrdedsee rrdeedes rrdeedse rrdeeeds rrdeeesd rrdeesed rrdeesde rrdesdee rrdesdee rrdesede
rrdeseed rrdeseed rrdesede rrdeeeds rrdeeesd rrdeedes rrdeedse rrdeesde rrdeesed rrdeeeds rrdeeesd
rrdeedes rrdeedse rrdeesde rrdeesed rrdedees rrdedese rrdedees rrdedese rrdedsee rrdedsee rrdesede
rrdeseed rrdesdee rrdesdee rrdesede rrdeseed rrdseeed rrdseede rrdseeed rrdseede rrdsedee rrdsedee
rrdseeed rrdseede rrdseeed rrdseede rrdsedee rrdsedee rrdseeed rrdseede rrdseeed rrdseede rrdsedee
rrdsedee rrdsdeee rrdsdeee rrdsdeee rrdsdeee rrdsdeee rrdsdeee rreddees rreddese rreddees rreddese
rreddsee rreddsee rrededes rrededse rredeeds rredeesd rredesed rredesde rredeeds rredeesd rrededes
rrededse rredesde rredesed rredseed rredsede rredseed rredsede rredsdee rredsdee rreddees rreddese
rreddees rreddese rreddsee rreddsee rrededes rrededse rredeeds rredeesd rredesed rredesde rredeeds
rredeesd rrededes rrededse rredesde rredesed rredseed rredsede rredseed rredsede rredsdee rredsdee
rreeddes rreeddse rreededs rreedesd rreedsed rreedsde rreeddes rreeddse rreededs rreedesd rreedsed
rreedsde rreeedds rreeedsd rreeedds rreeedsd rreeesdd rreeesdd rreesded rreesdde rreesedd rreesedd
rreesded rreesdde rreededs rreedesd rreeddes rreeddse rreedsde rreedsed rreeedds rreeedsd rreeedds
rreeedsd rreeesdd rreeesdd rreededs rreedesd rreeddes rreeddse rreedsde rreedsed rreesedd rreesedd
rreesded rreesdde rreesdde rreesded rresdeed rresdede rresdeed rresdede rresddee rresddee rreseded
rresedde rreseedd rreseedd rreseded rresedde rreseedd rreseedd rreseded rresedde rresedde rreseded
rresdeed rresdede rresdeed rresdede rresddee rresddee rrededes rrededse rredeeds rredeesd rredesed
rredesde rreddees rreddese rreddees rreddese rreddsee rreddsee rrededes rrededse rredeeds rredeesd
rredesed rredesde rredsdee rredsdee rredsede rredseed rredseed rredsede rreeddes rreeddse rreededs
rreedesd rreedsed rreedsde rreeddes rreeddse rreededs rreedesd rreedsed rreedsde rreeedds rreeedsd
rreeedds rreeedsd rreeesdd rreeesdd rreesded rreesdde rreesedd rreesedd rreesded rreesdde rrededes
rrededse rredeeds rredeesd rredesed rredesde rreddees rreddese rreddees rreddese rreddsee rreddsee
rrededes rrededse rredeeds rredeesd rredesed rredesde rredsdee rredsdee rredsede rredseed rredseed
rredsede rreeedds rreeedsd rreeedds rreeedsd rreeesdd rreeesdd rreededs rreedesd rreeddes rreeddse
rreedsde rreedsed rreeddes rreeddse rreededs rreedesd rreedsed rreedsde rreesdde rreesded rreesdde
rreesded rreesedd rreesedd rreseded rresedde rreseedd rreseedd rreseded rresedde rresdeed rresdede
rresdeed rresdede rresddee rresddee rreseded rresedde rreseedd rreseedd rreseded rresedde rresddee
rresddee rresdede rresdeed rresdeed rresdede rredeeds rredeesd rrededes rrededse rredesde rredesed
rredeeds rredeesd rrededes rrededse rredesde rredesed rreddees rreddese rreddees rreddese rreddsee
rreddsee rredsede rredseed rredsdee rredsdee rredsede rredseed rreededs rreedesd rreeddes rreeddse
rreedsde rreedsed rreeedds rreeedsd rreeedds rreeedsd rreeesdd rreeesdd rreededs rreedesd rreeddes
rreeddse rreedsde rreedsed rreesedd rreesedd rreesded rreesdde rreesdde rreesded rreeedds rreeedsd
rreeedds rreeedsd rreeesdd rreeesdd rreededs rreedesd rreeddes rreeddse rreedsde rreedsed rreeddes
rreeddse rreededs rreedesd rreedsed rreedsde rreesdde rreesded rreesdde rreesded rreesedd rreesedd
rredeeds rredeesd rrededes rrededse rredesde rredesed rredeeds rredeesd rrededes rrededse rredesde
rredesed rreddees rreddese rreddees rreddese rreddsee rreddsee rredsede rredseed rredsdee rredsdee
rredsede rredseed rreseedd rreseedd rreseded rresedde rresedde rreseded rreseedd rreseedd rreseded
rresedde rresedde rreseded rresdeed rresdede rresdeed rresdede rresddee rresddee rresdede rresdeed
rresddee rresddee rresdede rresdeed rrsdeeed rrsdeede rrsdeeed rrsdeede rrsdedee rrsdedee rrsdeeed
rrsdeede rrsdeeed rrsdeede rrsdedee rrsdedee rrsdeeed rrsdeede rrsdeeed rrsdeede rrsdedee rrsdedee
rrsddeee rrsddeee rrsddeee rrsddeee rrsddeee rrsddeee rrsedeed rrsedede rrsedeed rrsedede rrseddee
rrseddee rrseeded rrseedde rrseeedd rrseeedd rrseeded rrseedde rrseeedd rrseeedd rrseeded rrseedde
rrseedde rrseeded rrsedeed rrsedede rrsedeed rrsedede rrseddee rrseddee rrseeded rrseedde rrseeedd
rrseeedd rrseeded rrseedde rrsedeed rrsedede rrsedeed rrsedede rrseddee rrseddee rrseeded rrseedde
rrseeedd rrseeedd rrseeded rrseedde rrseddee rrseddee rrsedede rrsedeed rrsedeed rrsedede rrseeedd
rrseeedd rrseeded rrseedde rrseedde rrseeded rrseeedd rrseeedd rrseeded rrseedde rrseedde rrseeded
rrsedeed rrsedede rrsedeed rrsedede rrseddee rrseddee rrsedede rrsedeed rrseddee rrseddee rrsedede
rrsedeed rrsdeeed rrsdeede rrsdeeed rrsdeede rrsdedee rrsdedee rrsdeeed rrsdeede rrsdeeed rrsdeede
rrsdedee rrsdedee rrsdeeed rrsdeede rrsdeeed rrsdeede rrsdedee rrsdedee rrsddeee rrsddeee rrsddeee
rrsddeee rrsddeee rrsddeee redderes redderse reddeers reddeesr reddeser reddesre reddrees reddrese
reddrees reddrese reddrsee reddrsee redderes redderse reddeers reddeesr reddeser reddesre reddsree
reddsree reddsere reddseer reddseer reddsere rededres rededrse rededers rededesr rededser rededsre
rederdes rederdse redereds rederesd redersed redersde redeerds redeersd redeedrs redeedsr redeesdr
redeesrd redesred redesrde redeserd redesedr redesder redesdre redredes redredse redreeds redreesd
redresed redresde redrdees redrdese redrdees redrdese redrdsee redrdsee redredes redredse redreeds
redreesd redresed redresde redrsdee redrsdee redrsede redrseed redrseed redrsede redeerds redeersd
redeedrs redeedsr redeesdr redeesrd redereds rederesd rederdes rederdse redersde redersed rededres
rededrse rededers rededesr rededser rededsre redesrde redesred redesdre redesder redesedr redeserd
redsered redserde redseerd redseedr redseder redsedre redsreed redsrede redsreed redsrede redsrdee
redsrdee redsered redserde redseerd redseedr redseder redsedre redsdree redsdree redsdere redsdeer
redsdeer redsdere redderes redderse reddeers reddeesr reddeser reddesre reddrees reddrese reddrees
reddrese reddrsee reddrsee redderes redderse reddeers reddeesr reddeser reddesre reddsree reddsree
reddsere reddseer reddseer reddsere rededres rededrse rededers rededesr rededser rededsre rederdes
rederdse redereds rederesd redersed redersde redeerds redeersd redeedrs redeedsr redeesdr redeesrd
redesred redesrde redeserd redesedr redesder redesdre redredes redredse redreeds redreesd redresed
redresde redrdees redrdese redrdees redrdese redrdsee redrdsee redredes redredse redreeds redreesd
redresed redresde redrsdee redrsdee redrsede redrseed redrseed redrsede redeerds redeersd redeedrs
redeedsr redeesdr redeesrd redereds rederesd rederdes rederdse redersde redersed rededres rededrse
rededers rededesr rededser rededsre redesrde redesred redesdre redesder redesedr redeserd redsered
redserde redseerd redseedr redseder redsedre redsreed redsrede redsreed redsrede redsrdee redsrdee
redsered redserde redseerd redseedr redseder redsedre redsdree redsdree redsdere redsdeer redsdeer
redsdere reeddres reeddrse reedders reeddesr reeddser reeddsre reedrdes reedrdse reedreds reedresd
reedrsed reedrsde reederds reedersd reededrs reededsr reedesdr reedesrd reedsred reedsrde reedserd
reedsedr reedsder reedsdre reeddres reeddrse reedders reeddesr reeddser reeddsre reedrdes reedrdse
reedreds reedresd reedrsed reedrsde reederds reedersd reededrs reededsr reedesdr reedesrd reedsred
reedsrde reedserd reedsedr reedsder reedsdre reerddes reerddse reerdeds reerdesd reerdsed reerdsde
reerddes reerddse reerdeds reerdesd reerdsed reerdsde reeredds reeredsd reeredds reeredsd reeresdd
reeresdd reersded reersdde reersedd reersedd reersded reersdde reeedrds reeedrsd reeeddrs reeeddsr
reeedsdr reeedsrd reeerdds reeerdsd reeerdds reeerdsd reeersdd reeersdd reeedrds reeedrsd reeeddrs
reeeddsr reeedsdr reeedsrd reeesrdd reeesrdd reeesdrd reeesddr reeesddr reeesdrd reesdred reesdrde
reesderd reesdedr reesdder reesddre reesrded reesrdde reesredd reesredd reesrded reesrdde reeserdd
reeserdd reesedrd reeseddr reeseddr reesedrd reesdred reesdrde reesderd reesdedr reesdder reesddre
rerdedes rerdedse rerdeeds rerdeesd rerdesed rerdesde rerddees rerddese rerddees rerddese rerddsee
rerddsee rerdedes rerdedse rerdeeds rerdeesd rerdesed rerdesde rerdsdee rerdsdee rerdsede rerdseed
rerdseed rerdsede rereddes rereddse rerededs reredesd reredsed reredsde rereddes rereddse rerededs
reredesd reredsed reredsde rereedds rereedsd rereedds rereedsd rereesdd rereesdd reresded reresdde
reresedd reresedd reresded reresdde rerdedes rerdedse rerdeeds rerdeesd rerdesed rerdesde rerddees
rerddese rerddees rerddese rerddsee rerddsee rerdedes rerdedse rerdeeds rerdeesd rerdesed rerdesde
rerdsdee rerdsdee rerdsede rerdseed rerdseed rerdsede rereedds rereedsd rereedds rereedsd rereesdd
rereesdd rerededs reredesd rereddes rereddse reredsde reredsed rereddes rereddse rerededs reredesd
reredsed reredsde reresdde reresded reresdde reresded reresedd reresedd rerseded rersedde rerseedd
rerseedd rerseded rersedde rersdeed rersdede rersdeed rersdede rersddee rersddee rerseded rersedde
rerseedd rerseedd rerseded rersedde rersddee rersddee rersdede rersdeed rersdeed rersdede reederds
reedersd reededrs reededsr reedesdr reedesrd reedreds reedresd reedrdes reedrdse reedrsde reedrsed
reeddres reeddrse reedders reeddesr reeddser reeddsre reedsrde reedsred reedsdre reedsder reedsedr
reedserd reeedrds reeedrsd reeeddrs reeeddsr reeedsdr reeedsrd reeerdds reeerdsd reeerdds reeerdsd
reeersdd reeersdd reeedrds reeedrsd reeeddrs reeeddsr reeedsdr reeedsrd reeesrdd reeesrdd reeesdrd
reeesddr reeesddr reeesdrd reeredds reeredsd reeredds reeredsd reeresdd reeresdd reerdeds reerdesd
reerddes reerddse reerdsde reerdsed reerddes reerddse reerdeds reerdesd reerdsed reerdsde reersdde
reersded reersdde reersded reersedd reersedd reederds reedersd reededrs reededsr reedesdr reedesrd
reedreds reedresd reedrdes reedrdse reedrsde reedrsed reeddres reeddrse reedders reeddesr reeddser
reeddsre reedsrde reedsred reedsdre reedsder reedsedr reedserd reeserdd reeserdd reesedrd reeseddr
reeseddr reesedrd reesredd reesredd reesrded reesrdde reesrdde reesrded reesdred reesdrde reesderd
reesdedr reesdder reesddre reesdrde reesdred reesddre reesdder reesdedr reesderd resdered resderde
resdeerd resdeedr resdeder resdedre resdreed resdrede resdreed resdrede resdrdee resdrdee resdered
resderde resdeerd resdeedr resdeder resdedre resddree resddree resddere resddeer resddeer resddere
resedred resedrde resederd resededr resedder reseddre reserded reserdde reseredd reseredd reserded
reserdde reseerdd reseerdd reseedrd reseeddr reseeddr reseedrd resedred resedrde resederd resededr
resedder reseddre resreded resredde resreedd resreedd resreded resredde resrdeed resrdede resrdeed
resrdede resrddee resrddee resreded resredde resreedd resreedd resreded resredde resrddee resrddee
resrdede resrdeed resrdeed resrdede reseerdd reseerdd reseedrd reseeddr reseeddr reseedrd reseredd
reseredd reserded reserdde reserdde reserded resedred resedrde resederd resededr resedder reseddre
resedrde resedred reseddre resedder resededr resederd resdered resderde resdeerd resdeedr resdeder
resdedre resdreed resdrede resdreed resdrede resdrdee resdrdee resdered resderde resdeerd resdeedr
resdeder resdedre resddree resddree resddere resddeer resddeer resddere rsdderee rsdderee rsddeere
rsddeeer rsddeeer rsddeere rsddreee rsddreee rsddreee rsddreee rsddreee rsddreee rsdderee rsdderee
rsddeere rsddeeer rsddeeer rsddeere rsdderee rsdderee rsddeere rsddeeer rsddeeer rsddeere rsdedree
rsdedree rsdedere rsdedeer rsdedeer rsdedere rsderdee rsderdee rsderede rsdereed rsdereed rsderede
rsdeerde rsdeered rsdeedre rsdeeder rsdeeedr rsdeeerd rsdeered rsdeerde rsdeeerd rsdeeedr rsdeeder
rsdeedre rsdredee rsdredee rsdreede rsdreeed rsdreeed rsdreede rsdrdeee rsdrdeee rsdrdeee rsdrdeee
rsdrdeee rsdrdeee rsdredee rsdredee rsdreede rsdreeed rsdreeed rsdreede rsdredee rsdredee rsdreede
rsdreeed rsdreeed rsdreede rsdeerde rsdeered rsdeedre rsdeeder rsdeeedr rsdeeerd rsderede rsdereed
rsderdee rsderdee rsderede rsdereed rsdedree rsdedree rsdedere rsdedeer rsdedeer rsdedere rsdeerde
rsdeered rsdeedre rsdeeder rsdeeedr rsdeeerd rsdeered rsdeerde rsdeeerd rsdeeedr rsdeeder rsdeedre
rsdereed rsderede rsdereed rsderede rsderdee rsderdee rsdeered rsdeerde rsdeeerd rsdeeedr rsdeeder
rsdeedre rsdedree rsdedree rsdedere rsdedeer rsdedeer rsdedere rsdderee rsdderee rsddeere rsddeeer
rsddeeer rsddeere rsddreee rsddreee rsddreee rsddreee rsddreee rsddreee rsdderee rsdderee rsddeere
rsddeeer rsddeeer rsddeere rsdderee rsdderee rsddeere rsddeeer rsddeeer rsddeere rsdedree rsdedree
rsdedere rsdedeer rsdedeer rsdedere rsderdee rsderdee rsderede rsdereed rsdereed rsderede rsdeerde
rsdeered rsdeedre rsdeeder rsdeeedr rsdeeerd rsdeered rsdeerde rsdeeerd rsdeeedr rsdeeder rsdeedre
rsdredee rsdredee rsdreede rsdreeed rsdreeed rsdreede rsdrdeee rsdrdeee rsdrdeee rsdrdeee rsdrdeee
rsdrdeee rsdredee rsdredee rsdreede rsdreeed rsdreeed rsdreede rsdredee rsdredee rsdreede rsdreeed
rsdreeed rsdreede rsdeerde rsdeered rsdeedre rsdeeder rsdeeedr rsdeeerd rsderede rsdereed rsderdee
rsderdee rsderede rsdereed rsdedree rsdedree rsdedere rsdedeer rsdedeer rsdedere rsdeerde rsdeered
rsdeedre rsdeeder rsdeeedr rsdeeerd rsdeered rsdeerde rsdeeerd rsdeeedr rsdeeder rsdeedre rsdereed
rsderede rsdereed rsderede rsderdee rsderdee rsdeered rsdeerde rsdeeerd rsdeeedr rsdeeder rsdeedre
rsdedree rsdedree rsdedere rsdedeer rsdedeer rsdedere rseddree rseddree rseddere rseddeer rseddeer
rseddere rsedrdee rsedrdee rsedrede rsedreed rsedreed rsedrede rsederde rsedered rsededre rsededer
rsedeedr rsedeerd rsedered rsederde rsedeerd rsedeedr rsededer rsededre rseddree rseddree rseddere
rseddeer rseddeer rseddere rsedrdee rsedrdee rsedrede rsedreed rsedreed rsedrede rsederde rsedered
rsededre rsededer rsedeedr rsedeerd rsedered rsederde rsedeerd rsedeedr rsededer rsededre rserddee
rserddee rserdede rserdeed rserdeed rserdede rserddee rserddee rserdede rserdeed rserdeed rserdede
rseredde rsereded rseredde rsereded rsereedd rsereedd rsereded rseredde rsereedd rsereedd rsereded
rseredde rseedrde rseedred rseeddre rseedder rseededr rseederd rseerdde rseerded rseerdde rseerded
rseeredd rseeredd rseedrde rseedred rseeddre rseedder rseededr rseederd rseeerdd rseeerdd rseeedrd
rseeeddr rseeeddr rseeedrd rseedred rseedrde rseederd rseededr rseedder rseeddre rseerded rseerdde
rseeredd rseeredd rseerded rseerdde rseeerdd rseeerdd rseeedrd rseeeddr rseeeddr rseeedrd rseedred
rseedrde rseederd rseededr rseedder rseeddre rsrdedee rsrdedee rsrdeede rsrdeeed rsrdeeed rsrdeede
rsrddeee rsrddeee rsrddeee rsrddeee rsrddeee rsrddeee rsrdedee rsrdedee rsrdeede rsrdeeed rsrdeeed
rsrdeede rsrdedee rsrdedee rsrdeede rsrdeeed rsrdeeed rsrdeede rsreddee rsreddee rsredede rsredeed
rsredeed rsredede rsreddee rsreddee rsredede rsredeed rsredeed rsredede rsreedde rsreeded rsreedde
rsreeded rsreeedd rsreeedd rsreeded rsreedde rsreeedd rsreeedd rsreeded rsreedde rsrdedee rsrdedee
rsrdeede rsrdeeed rsrdeeed rsrdeede rsrddeee rsrddeee rsrddeee rsrddeee rsrddeee rsrddeee rsrdedee
rsrdedee rsrdeede rsrdeeed rsrdeeed rsrdeede rsrdedee rsrdedee rsrdeede rsrdeeed rsrdeeed rsrdeede
rsreedde rsreeded rsreedde rsreeded rsreeedd rsreeedd rsredede rsredeed rsreddee rsreddee rsredede
rsredeed rsreddee rsreddee rsredede rsredeed rsredeed rsredede rsreedde rsreeded rsreedde rsreeded
rsreeedd rsreeedd rsreeded rsreedde rsreeedd rsreeedd rsreeded rsreedde rsredeed rsredede rsredeed
rsredede rsreddee rsreddee rsreeded rsreedde rsreeedd rsreeedd rsreeded rsreedde rsreddee rsreddee
rsredede rsredeed rsredeed rsredede rsederde rsedered rsededre rsededer rsedeedr rsedeerd rsedrede
rsedreed rsedrdee rsedrdee rsedrede rsedreed rseddree rseddree rseddere rseddeer rseddeer rseddere
rsederde rsedered rsededre rsededer rsedeedr rsedeerd rseedrde rseedred rseeddre rseedder rseededr
rseederd rseerdde rseerded rseerdde rseerded rseeredd rseeredd rseedrde rseedred rseeddre rseedder
rseededr rseederd rseeerdd rseeerdd rseeedrd rseeeddr rseeeddr rseeedrd rseredde rsereded rseredde
rsereded rsereedd rsereedd rserdede rserdeed rserddee rserddee rserdede rserdeed rserddee rserddee
rserdede rserdeed rserdeed rserdede rseredde rsereded rseredde rsereded rsereedd rsereedd rsederde
rsedered rsededre rsededer rsedeedr rsedeerd rsedrede rsedreed rsedrdee rsedrdee rsedrede rsedreed
rseddree rseddree rseddere rseddeer rseddeer rseddere rsederde rsedered rsededre rsededer rsedeedr
rsedeerd rseeerdd rseeerdd rseeedrd rseeeddr rseeeddr rseeedrd rseeredd rseeredd rseerded rseerdde
rseerdde rseerded rseedred rseedrde rseederd rseededr rseedder rseeddre rseedrde rseedred rseeddre
rseedder rseededr rseederd rsedered rsederde rsedeerd rsedeedr rsededer rsededre rsedreed rsedrede
rsedreed rsedrede rsedrdee rsedrdee rsedered rsederde rsedeerd rsedeedr rsededer rsededre rseddree
rseddree rseddere rseddeer rseddeer rseddere rseedred rseedrde rseederd rseededr rseedder rseeddre
rseerded rseerdde rseeredd rseeredd rseerded rseerdde rseeerdd rseeerdd rseeedrd rseeeddr rseeeddr
rseeedrd rseedred rseedrde rseederd rseededr rseedder rseeddre rsereded rseredde rsereedd rsereedd
rsereded rseredde rserdeed rserdede rserdeed rserdede rserddee rserddee rsereded rseredde rsereedd
rsereedd rsereded rseredde rserddee rserddee rserdede rserdeed rserdeed rserdede rseeerdd rseeerdd
rseeedrd rseeeddr rseeeddr rseeedrd rseeredd rseeredd rseerded rseerdde rseerdde rseerded rseedred
rseedrde rseederd rseededr rseedder rseeddre rseedrde rseedred rseeddre rseedder rseededr rseederd
rsedered rsederde rsedeerd rsedeedr rsededer rsededre rsedreed rsedrede rsedreed rsedrede rsedrdee
rsedrdee rsedered rsederde rsedeerd rsedeedr rsededer rsededre rseddree rseddree rseddere rseddeer
rseddeer rseddere

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us