easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

noncyclical

goldwax

tabuteau

horsily

drowningly

postulaveritis

disponantque

vinck

yeagle

triplumbic

tourneys

transprt

musteline

freeing

deditione

volviebamque

neoterics

unfurnish


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: rangda
cipher variations:
sboheb tcpifc udqjgd verkhe wfslif
xgtmjg yhunkh zivoli ajwpmj bkxqnk
clyrol dmzspm enatqn foburo gpcvsp
hqdwtq irexur jsfyvs ktgzwt luhaxu
mvibyv nwjczw oxkdax pyleby qzmfcz

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: rangda
Cipher: izmtwz

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: rangda
Cipher: BAAAA AAAAA ABBAA AABBA AAABB AAAAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: rangda
cipher variations:
sbohebabotkbibofqbqborwbybodcbgbopibwbonubebozab
mbolgbuboxmbcbojsbkbovybtcpifcbcpulcjcpgrcrcpsxc
zcpedchcpqjcxcpovcfcpabcncpmhcvcpyncdcpktclcpwzc
udqjgdcdqvmdkdqhsdsdqtydadqfedidqrkdydqpwdgdqbcd
odqnidwdqzodedqludmdqxadverkhederwneleriteteruze
bergfejerslezerqxehercdeperojexerapefermvenerybe
wfslifefsxofmfsjufufsvafcfshgfkfstmfafsryfifsdef
qfspkfyfsbqfgfsnwfofszcfxgtmjgfgtypgngtkvgvgtwbg
dgtihglgtungbgtszgjgtefgrgtqlgzgtcrghgtoxgpgtadg
yhunkhghuzqhohulwhwhuxchehujihmhuvohchutahkhufgh
shurmhahudshihupyhqhubehzivolihivaripivmxixivydi
fivkjinivwpidivubilivghitivsnibivetijivqzirivcfi
ajwpmjijwbsjqjwnyjyjwzejgjwlkjojwxqjejwvcjmjwhij
ujwtojcjwfujkjwrajsjwdgjbkxqnkjkxctkrkxozkzkxafk
hkxmlkpkxyrkfkxwdknkxijkvkxupkdkxgvklkxsbktkxehk
clyrolklydulslypalalybglilynmlqlyzslglyxelolyjkl
wlyvqlelyhwlmlytclulyfildmzspmlmzevmtmzqbmbmzchm
jmzonmrmzatmhmzyfmpmzklmxmzwrmfmzixmnmzudmvmzgjm
enatqnmnafwnunarcncnadinknaponsnabuninazgnqnalmn
ynaxsngnajynonavenwnahknfoburonobgxovobsdodobejo
lobqpotobcvojobahorobmnozobytohobkzopobwfoxobilo
gpcvspopchypwpctepepcfkpmpcrqpupcdwpkpcbipspcnop
apczupipclapqpcxgpypcjmphqdwtqpqdizqxqdufqfqdglq
nqdsrqvqdexqlqdcjqtqdopqbqdavqjqdmbqrqdyhqzqdknq
irexurqrejaryrevgrgrehmroretsrwrefyrmredkrurepqr
crebwrkrencrsrezirarelorjsfyvsrsfkbszsfwhshsfins
psfutsxsfgzsnsfelsvsfqrsdsfcxslsfodstsfajsbsfmps
ktgzwtstglctatgxititgjotqtgvutytghatotgfmtwtgrst
etgdytmtgpetutgbktctgnqtluhaxutuhmdubuhyjujuhkpu
ruhwvuzuhibupuhgnuxuhstufuhezunuhqfuvuhcluduhoru
mvibyvuvinevcvizkvkvilqvsvixwvavijcvqvihovyvituv
gvifavovirgvwvidmvevipsvnwjczwvwjofwdwjalwlwjmrw
twjyxwbwjkdwrwjipwzwjuvwhwjgbwpwjshwxwjenwfwjqtw
oxkdaxwxkpgxexkbmxmxknsxuxkzyxcxklexsxkjqxaxkvwx
ixkhcxqxktixyxkfoxgxkruxpylebyxylqhyfylcnynyloty
vylazydylmfytylkrybylwxyjylidyrylujyzylgpyhylsvy
qzmfczyzmrizgzmdozozmpuzwzmbazezmngzuzmlszczmxyz
kzmjezszmvkzazmhqzizmtwzrangdazansjahanepapanqva
xancbafanohavanmtadanyzalankfatanwlabanirajanuxa

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: rangda
Cipher: enatqn

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: rangda
Cipher: 241133224111

Extended Methods:
Method #1

Plaintext: rangda
method variations:
wfsmifblxrolgqcwtqmvhbyv

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
r a n g d a 
2 1 3 2 4 1 
4 1 3 2 1 1 
They are then read out in rows:
213241413211
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: rangda
Cipher: bhddha

Read more ...
Method #3

Plaintext: rangda
method variations:
dlhraf lhrafd hrafdl
rafdlh afdlhr fdlhra

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: rangda

all 720 cipher variations:
rangda rangad randga randag ranadg ranagd ragnda ragnad ragdna ragdan ragadn
ragand radgna radgan radnga radnag radang radagn raagdn raagnd raadgn raadng
raandg raangd rnagda rnagad rnadga rnadag rnaadg rnaagd rngada rngaad rngdaa
rngdaa rngada rngaad rndgaa rndgaa rndaga rndaag rndaag rndaga rnagda rnagad
rnadga rnadag rnaadg rnaagd rgnada rgnaad rgndaa rgndaa rgnada rgnaad rganda
rganad rgadna rgadan rgaadn rgaand rgdana rgdaan rgdnaa rgdnaa rgdana rgdaan
rgaadn rgaand rgadan rgadna rganda rganad rdngaa rdngaa rdnaga rdnaag rdnaag
rdnaga rdgnaa rdgnaa rdgana rdgaan rdgaan rdgana rdagna rdagan rdanga rdanag
rdaang rdaagn rdagan rdagna rdaagn rdaang rdanag rdanga rangda rangad randga
randag ranadg ranagd ragnda ragnad ragdna ragdan ragadn ragand radgna radgan
radnga radnag radang radagn raagdn raagnd raadgn raadng raandg raangd arngda
arngad arndga arndag arnadg arnagd argnda argnad argdna argdan argadn argand
ardgna ardgan ardnga ardnag ardang ardagn aragdn aragnd aradgn aradng arandg
arangd anrgda anrgad anrdga anrdag anradg anragd angrda angrad angdra angdar
angadr angard andgra andgar andrga andrag andarg andagr anagdr anagrd anadgr
anadrg anardg anargd agnrda agnrad agndra agndar agnadr agnard agrnda agrnad
agrdna agrdan agradn agrand agdrna agdran agdnra agdnar agdanr agdarn agardn
agarnd agadrn agadnr agandr aganrd adngra adngar adnrga adnrag adnarg adnagr
adgnra adgnar adgrna adgran adgarn adganr adrgna adrgan adrnga adrnag adrang
adragn adagrn adagnr adargn adarng adanrg adangr aangdr aangrd aandgr aandrg
aanrdg aanrgd aagndr aagnrd aagdnr aagdrn aagrdn aagrnd aadgnr aadgrn aadngr
aadnrg aadrng aadrgn aargdn aargnd aardgn aardng aarndg aarngd nargda nargad
nardga nardag naradg naragd nagrda nagrad nagdra nagdar nagadr nagard nadgra
nadgar nadrga nadrag nadarg nadagr naagdr naagrd naadgr naadrg naardg naargd
nragda nragad nradga nradag nraadg nraagd nrgada nrgaad nrgdaa nrgdaa nrgada
nrgaad nrdgaa nrdgaa nrdaga nrdaag nrdaag nrdaga nragda nragad nradga nradag
nraadg nraagd ngrada ngraad ngrdaa ngrdaa ngrada ngraad ngarda ngarad ngadra
ngadar ngaadr ngaard ngdara ngdaar ngdraa ngdraa ngdara ngdaar ngaadr ngaard
ngadar ngadra ngarda ngarad ndrgaa ndrgaa ndraga ndraag ndraag ndraga ndgraa
ndgraa ndgara ndgaar ndgaar ndgara ndagra ndagar ndarga ndarag ndaarg ndaagr
ndagar ndagra ndaagr ndaarg ndarag ndarga nargda nargad nardga nardag naradg
naragd nagrda nagrad nagdra nagdar nagadr nagard nadgra nadgar nadrga nadrag
nadarg nadagr naagdr naagrd naadgr naadrg naardg naargd ganrda ganrad gandra
gandar ganadr ganard garnda garnad gardna gardan garadn garand gadrna gadran
gadnra gadnar gadanr gadarn gaardn gaarnd gaadrn gaadnr gaandr gaanrd gnarda
gnarad gnadra gnadar gnaadr gnaard gnrada gnraad gnrdaa gnrdaa gnrada gnraad
gndraa gndraa gndara gndaar gndaar gndara gnarda gnarad gnadra gnadar gnaadr
gnaard grnada grnaad grndaa grndaa grnada grnaad granda granad gradna gradan
graadn graand grdana grdaan grdnaa grdnaa grdana grdaan graadn graand gradan
gradna granda granad gdnraa gdnraa gdnara gdnaar gdnaar gdnara gdrnaa gdrnaa
gdrana gdraan gdraan gdrana gdarna gdaran gdanra gdanar gdaanr gdaarn gdaran
gdarna gdaarn gdaanr gdanar gdanra ganrda ganrad gandra gandar ganadr ganard
garnda garnad gardna gardan garadn garand gadrna gadran gadnra gadnar gadanr
gadarn gaardn gaarnd gaadrn gaadnr gaandr gaanrd dangra dangar danrga danrag
danarg danagr dagnra dagnar dagrna dagran dagarn daganr dargna dargan darnga
darnag darang daragn daagrn daagnr daargn daarng daanrg daangr dnagra dnagar
dnarga dnarag dnaarg dnaagr dngara dngaar dngraa dngraa dngara dngaar dnrgaa
dnrgaa dnraga dnraag dnraag dnraga dnagra dnagar dnarga dnarag dnaarg dnaagr
dgnara dgnaar dgnraa dgnraa dgnara dgnaar dganra dganar dgarna dgaran dgaarn
dgaanr dgrana dgraan dgrnaa dgrnaa dgrana dgraan dgaarn dgaanr dgaran dgarna
dganra dganar drngaa drngaa drnaga drnaag drnaag drnaga drgnaa drgnaa drgana
drgaan drgaan drgana dragna dragan dranga dranag draang draagn dragan dragna
draagn draang dranag dranga dangra dangar danrga danrag danarg danagr dagnra
dagnar dagrna dagran dagarn daganr dargna dargan darnga darnag darang daragn
daagrn daagnr daargn daarng daanrg daangr aangdr aangrd aandgr aandrg aanrdg
aanrgd aagndr aagnrd aagdnr aagdrn aagrdn aagrnd aadgnr aadgrn aadngr aadnrg
aadrng aadrgn aargdn aargnd aardgn aardng aarndg aarngd anagdr anagrd anadgr
anadrg anardg anargd angadr angard angdar angdra angrda angrad andgar andgra
andagr andarg andrag andrga anrgda anrgad anrdga anrdag anradg anragd agnadr
agnard agndar agndra agnrda agnrad agandr aganrd agadnr agadrn agardn agarnd
agdanr agdarn agdnar agdnra agdrna agdran agradn agrand agrdan agrdna agrnda
agrnad adngar adngra adnagr adnarg adnrag adnrga adgnar adgnra adganr adgarn
adgran adgrna adagnr adagrn adangr adanrg adarng adargn adrgan adrgna adragn
adrang adrnag adrnga arngda arngad arndga arndag arnadg arnagd argnda argnad
argdna argdan argadn argand ardgna ardgan ardnga ardnag ardang ardagn aragdn
aragnd aradgn aradng arandg arangd

Read more ...[1] , [2] , [3]

History of cryptography
© 2011 Easy Ciphers. All rights reserved. contact us