easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

rickt

polytheist

greensville

antproof

indolence

cupietis

prehepatic

linker

villoid

tingey

biotaxy

necroticism

ordinatio

rienda

moluccas

unmovingly

villamil

islanded


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: rainie
cipher variations:
sbjojf tckpkg udlqlh vemrmi wfnsnj
xgotok yhpupl ziqvqm ajrwrn bksxso
cltytp dmuzuq envavr fowbws gpxcxt
hqydyu irzezv jsafaw ktbgbx luchcy
mvdidz nwejea oxfkfb pyglgc qzhmhd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: rainie
Cipher: izrmrv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: rainie
Cipher: BAAAA AAAAA ABAAA ABBAA ABAAA AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: rainie
cipher variations:
sbjojfabzoznibpopvqbfofdybvovlgbloltwbrorjebhohr
mbxoxzubnonhcbdodpkbtotxtckpkgbcapaojcqpqwrcgpge
zcwpwmhcmpmuxcspskfcipisncypyavcopoidcepeqlcupuy
udlqlhcdbqbpkdrqrxsdhqhfadxqxnidnqnvydtqtlgdjqjt
odzqzbwdpqpjedfqfrmdvqvzvemrmidecrcqlesrsyteirig
beyryojeorowzeurumhekrkupearacxeqrqkfegrgsnewrwa
wfnsnjefdsdrmftstzufjsjhcfzszpkfpspxafvsvniflslv
qfbsbdyfrsrlgfhshtofxsxbxgotokfgetesngutuavgktki
dgataqlgqtqybgwtwojgmtmwrgctcezgstsmhgitiupgytyc
yhpuplghfuftohvuvbwhluljehbubrmhrurzchxuxpkhnunx
shdudfahtutnihjujvqhzuzdziqvqmhigvgupiwvwcximvmk
ficvcsnisvsadiyvyqliovoytievegbiuvuojikvkwriavae
ajrwrnijhwhvqjxwxdyjnwnlgjdwdtojtwtbejzwzrmjpwpz
ujfwfhcjvwvpkjlwlxsjbwbfbksxsojkixiwrkyxyezkoxom
hkexeupkuxucfkaxasnkqxqavkgxgidkwxwqlkmxmytkcxcg
cltytpkljyjxslzyzfalpypnilfyfvqlvyvdglbybtolryrb
wlhyhjelxyxrmlnynzuldydhdmuzuqlmkzkytmazagbmqzqo
jmgzgwrmwzwehmczcupmszscxmizikfmyzysnmozoavmezei
envavrmnlalzunbabhcnrarpknhahxsnxaxfindadvqntatd
ynjajlgnzaztonpapbwnfafjfowbwsnombmavocbcidosbsq
loibiytoybygjoebewroubuezokbkmhoabaupoqbqcxogbgk
gpxcxtopncnbwpdcdjeptctrmpjcjzupzczhkpfcfxspvcvf
aplclnipbcbvqprcrdyphchlhqydyupqodocxqedekfqudus
nqkdkavqadailqgdgytqwdwgbqmdmojqcdcwrqsdsezqidim
irzezvqrpepdyrfeflgrvevtorlelbwrbebjmrhehzurxexh
crnenpkrdedxsrtetfarjejnjsafawrsqfqezsgfgmhswfwu
psmfmcxscfcknsifiavsyfyidsofoqlsefeytsufugbskfko
ktbgbxstrgrfathghnitxgxvqtngndytdgdlotjgjbwtzgzj
etpgprmtfgfzutvgvhctlglpluchcytushsgbuihiojuyhyw
ruohoezuehempukhkcxuahakfuqhqsnughgavuwhwidumhmq
mvdidzuvtithcvjijpkvzizxsvpipfavfifnqvlildyvbibl
gvrirtovhihbwvxixjevninrnwejeavwujuidwkjkqlwajay
twqjqgbwgjgorwmjmezwcjcmhwsjsupwijicxwyjykfwojos
oxfkfbwxvkvjexlklrmxbkbzuxrkrhcxhkhpsxnknfaxdkdn
ixtktvqxjkjdyxzkzlgxpkptpyglgcxywlwkfymlmsnyclca
vyslsidyiliqtyologbyeleojyuluwryklkezyalamhyqlqu
qzhmhdyzxmxlgznmntozdmdbwztmtjezjmjruzpmphczfmfp
kzvmvxszlmlfazbmbnizrmrvrainiezaynymhaonoupaenec
xaunukfaknksvaqnqidagngqlawnwytamnmgbacncojasnsw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: rainie
Cipher: envavr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: rainie
Cipher: 241142334251

Extended Methods:
Method #1

Plaintext: rainie
method variations:
wfosokbltxtpgqycyumvdhdz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
r a i n i e 
2 1 4 3 4 5 
4 1 2 3 2 1 
They are then read out in rows:
214345412321
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: rainie
Cipher: boydmb

Read more ...
Method #3

Plaintext: rainie
method variations:
dqmswf qmswfd mswfdq
swfdqm wfdqms fdqmsw

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: rainie

all 720 cipher variations:
rainie rainei raiine raiien raiein raieni raniie raniei raniie raniei raneii
raneii rainie rainei raiine raiien raiein raieni raenii raenii raeini raeiin
raeiin raeini rianie rianei riaine riaien riaein riaeni rinaie rinaei riniae
riniea rineia rineai riinae riinea riiane riiaen riiean riiena rienia rienai
rieina rieian rieain rieani rniaie rniaei rniiae rniiea rnieia rnieai rnaiie
rnaiei rnaiie rnaiei rnaeii rnaeii rniaie rniaei rniiae rniiea rnieia rnieai
rneaii rneaii rneiai rneiia rneiia rneiai riinae riinea riiane riiaen riiean
riiena riniae riniea rinaie rinaei rineai rineia rianie rianei riaine riaien
riaein riaeni rienai rienia rieani rieain rieian rieina reinia reinai reiina
reiian reiain reiani reniia reniai reniia reniai renaii renaii reinia reinai
reiina reiian reiain reiani reanii reanii reaini reaiin reaiin reaini arinie
arinei ariine ariien ariein arieni arniie arniei arniie arniei arneii arneii
arinie arinei ariine ariien ariein arieni arenii arenii areini areiin areiin
areini airnie airnei airine airien airein aireni ainrie ainrei ainire ainier
aineir aineri aiinre aiiner aiirne aiiren aiiern aiienr aienir aienri aieinr
aieirn aierin aierni anirie anirei aniire aniier anieir anieri anriie anriei
anriie anriei anreii anreii anirie anirei aniire aniier anieir anieri anerii
anerii aneiri aneiir aneiir aneiri aiinre aiiner aiirne aiiren aiiern aiienr
ainire ainier ainrie ainrei aineri aineir airnie airnei airine airien airein
aireni aienri aienir aierni aierin aieirn aieinr aeinir aeinri aeiinr aeiirn
aeirin aeirni aeniir aeniri aeniir aeniri aenrii aenrii aeinir aeinri aeiinr
aeiirn aeirin aeirni aernii aernii aerini aeriin aeriin aerini iarnie iarnei
iarine iarien iarein iareni ianrie ianrei ianire ianier ianeir ianeri iainre
iainer iairne iairen iaiern iaienr iaenir iaenri iaeinr iaeirn iaerin iaerni
iranie iranei iraine iraien iraein iraeni irnaie irnaei irniae irniea irneia
irneai irinae irinea iriane iriaen iriean iriena irenia irenai ireina ireian
ireain ireani inraie inraei inriae inriea inreia inreai inarie inarei inaire
inaier inaeir inaeri iniare iniaer inirae inirea iniera iniear ineair ineari
ineiar ineira ineria inerai iirnae iirnea iirane iiraen iirean iirena iinrae
iinrea iinare iinaer iinear iinera iianre iianer iiarne iiaren iiaern iiaenr
iienar iienra iieanr iiearn iieran iierna iernia iernai ierina ierian ierain
ierani ienria ienrai ienira ieniar ienair ienari ieinra ieinar ieirna ieiran
ieiarn ieianr ieanir ieanri ieainr ieairn iearin iearni nairie nairei naiire
naiier naieir naieri nariie nariei nariie nariei nareii nareii nairie nairei
naiire naiier naieir naieri naerii naerii naeiri naeiir naeiir naeiri niarie
niarei niaire niaier niaeir niaeri niraie niraei niriae niriea nireia nireai
niirae niirea niiare niiaer niiear niiera nieria nierai nieira nieiar nieair
nieari nriaie nriaei nriiae nriiea nrieia nrieai nraiie nraiei nraiie nraiei
nraeii nraeii nriaie nriaei nriiae nriiea nrieia nrieai nreaii nreaii nreiai
nreiia nreiia nreiai niirae niirea niiare niiaer niiear niiera niriae niriea
niraie niraei nireai nireia niarie niarei niaire niaier niaeir niaeri nierai
nieria nieari nieair nieiar nieira neiria neirai neiira neiiar neiair neiari
neriia neriai neriia neriai neraii neraii neiria neirai neiira neiiar neiair
neiari nearii nearii neairi neaiir neaiir neairi iainre iainer iairne iairen
iaiern iaienr ianire ianier ianrie ianrei ianeri ianeir iarnie iarnei iarine
iarien iarein iareni iaenri iaenir iaerni iaerin iaeirn iaeinr iianre iianer
iiarne iiaren iiaern iiaenr iinare iinaer iinrae iinrea iinera iinear iirnae
iirnea iirane iiraen iirean iirena iienra iienar iierna iieran iiearn iieanr
iniare iniaer inirae inirea iniera iniear inaire inaier inarie inarei inaeri
inaeir inraie inraei inriae inriea inreia inreai ineari ineair inerai ineria
ineira ineiar irinae irinea iriane iriaen iriean iriena irniae irniea irnaie
irnaei irneai irneia iranie iranei iraine iraien iraein iraeni irenai irenia
ireani ireain ireian ireina ieinra ieinar ieirna ieiran ieiarn ieianr ienira
ieniar ienria ienrai ienari ienair iernia iernai ierina ierian ierain ierani
ieanri ieanir iearni iearin ieairn ieainr eainir eainri eaiinr eaiirn eairin
eairni eaniir eaniri eaniir eaniri eanrii eanrii eainir eainri eaiinr eaiirn
eairin eairni earnii earnii earini eariin eariin earini eianir eianri eiainr
eiairn eiarin eiarni einair einari einiar einira einria einrai eiinar eiinra
eiianr eiiarn eiiran eiirna eirnia eirnai eirina eirian eirain eirani eniair
eniari eniiar eniira eniria enirai enaiir enairi enaiir enairi enarii enarii
eniair eniari eniiar eniira eniria enirai enraii enraii enriai enriia enriia
enriai eiinar eiinra eiianr eiiarn eiiran eiirna einiar einira einair einari
einrai einria eianir eianri eiainr eiairn eiarin eiarni eirnai eirnia eirani
eirain eirian eirina erinia erinai eriina eriian eriain eriani erniia erniai
erniia erniai ernaii ernaii erinia erinai eriina eriian eriain eriani eranii
eranii eraini eraiin eraiin eraini

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us