easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

autotheist

copartnery

combatted

barnyards

venedocia

pranav

unbeauteous

multitudinal

telluret

messily

carzon

accideroque

oscan

edwardb

feriveratque

vocimotor

theotherapy

zeuglodonta


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: quererer
cipher variations:
rvfsfsfs swgtgtgt txhuhuhu uyiviviv vzjwjwjw
wakxkxkx xblylyly ycmzmzmz zdnanana aeobobob
bfpcpcpc cgqdqdqd dhrerere eisfsfsf fjtgtgtg
gkuhuhuh hlvivivi imwjwjwj jnxkxkxk koylylyl
lpzmzmzm mqananan nrbobobo oscpcpcp ptdqdqdq

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: quererer
Cipher: jfvivivi

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: quererer
Cipher: ABBBB BAABB AABAA BAAAA AABAA BAAAA AABAA BAAAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: quererer
cipher variations:
rvfsfsfsxjnananadxvivivijldqdqdqpzlylylyvntgtgtghpjwjwjwndrerere
trzmzmzmzfhuhuhuftpcpcpclhxkxkxkswgtgtgtykobobobeywjwjwjkmererer
qamzmzmzwouhuhuhiqkxkxkxoesfsfsfusanananagivivivguqdqdqdmiylylyl
txhuhuhuzlpcpcpcfzxkxkxklnfsfsfsrbnananaxpvivivijrlylylypftgtgtg
vtbobobobhjwjwjwhvrererenjzmzmzmuyivivivamqdqdqdgaylylylmogtgtgt
scobobobyqwjwjwjksmzmzmzqguhuhuhwucpcpcpcikxkxkxiwsfsfsfokananan
vzjwjwjwbnrererehbzmzmzmnphuhuhutdpcpcpczrxkxkxkltnananarhvivivi
xvdqdqdqdjlylylyjxtgtgtgplbobobowakxkxkxcosfsfsficanananoqiviviv
ueqdqdqdasylylylmuobobobsiwjwjwjywerererekmzmzmzkyuhuhuhqmcpcpcp
xblylylydptgtgtgjdboboboprjwjwjwvfrererebtzmzmzmnvpcpcpctjxkxkxk
zxfsfsfsflnananalzvivivirndqdqdqycmzmzmzequhuhuhkecpcpcpqskxkxkx
wgsfsfsfcuanananowqdqdqdukylylylaygtgtgtgmobobobmawjwjwjsoererer
zdnananafrvivivilfdqdqdqrtlylylyxhtgtgtgdvbobobopxrererevlzmzmzm
bzhuhuhuhnpcpcpcnbxkxkxktpfsfsfsaeobobobgswjwjwjmgererersumzmzmz
yiuhuhuhewcpcpcpqysfsfsfwmananancaivivivioqdqdqdocylylyluqgtgtgt
bfpcpcpchtxkxkxknhfsfsfstvnananazjvivivifxdqdqdqrztgtgtgxnbobobo
dbjwjwjwjprererepdzmzmzmvrhuhuhucgqdqdqdiuylylyloigtgtgtuwobobob
akwjwjwjgyererersauhuhuhyocpcpcpeckxkxkxkqsfsfsfqeanananwsiviviv
dhrererejvzmzmzmpjhuhuhuvxpcpcpcblxkxkxkhzfsfsfstbvivivizpdqdqdq
fdlylylylrtgtgtgrfboboboxtjwjwjweisfsfsfkwanananqkivivivwyqdqdqd
cmylylyliagtgtgtucwjwjwjaqererergemzmzmzmsuhuhuhsgcpcpcpyukxkxkx
fjtgtgtglxboboborljwjwjwxzrererednzmzmzmjbhuhuhuvdxkxkxkbrfsfsfs
hfnananantvivivithdqdqdqzvlylylygkuhuhuhmycpcpcpsmkxkxkxyasfsfsf
eoananankcivivivweylylylcsgtgtgtigobobobouwjwjwjuierererawmzmzmz
hlvivivinzdqdqdqtnlylylyzbtgtgtgfpboboboldjwjwjwxfzmzmzmdthuhuhu
jhpcpcpcpvxkxkxkvjfsfsfsbxnananaimwjwjwjoaerereruomzmzmzacuhuhuh
gqcpcpcpmekxkxkxyganananeuivivivkiqdqdqdqwylylylwkgtgtgtcyobobob
jnxkxkxkpbfsfsfsvpnananabdvivivihrdqdqdqnflylylyzhbobobofvjwjwjw
ljrerererxzmzmzmxlhuhuhudzpcpcpckoylylylqcgtgtgtwqobobobcewjwjwj
iserererogmzmzmzaicpcpcpgwkxkxkxmksfsfsfsyanananymiviviveaqdqdqd
lpzmzmzmrdhuhuhuxrpcpcpcdfxkxkxkjtfsfsfsphnananabjdqdqdqhxlylyly
nltgtgtgtzboboboznjwjwjwfbrereremqanananseivivivysqdqdqdegylylyl
kugtgtgtqiobobobckerereriymzmzmzomuhuhuhuacpcpcpaokxkxkxgcsfsfsf
nrbobobotfjwjwjwztrererefhzmzmzmlvhuhuhurjpcpcpcdlfsfsfsjznanana
pnvivivivbdqdqdqbplylylyhdtgtgtgoscpcpcpugkxkxkxausfsfsfgiananan
mwivivivskqdqdqdemgtgtgtkaobobobqowjwjwjwcererercqmzmzmzieuhuhuh
ptdqdqdqvhlylylybvtgtgtghjbobobonxjwjwjwtlrererefnhuhuhulbpcpcpc
rpxkxkxkxdfsfsfsdrnananajfviviviquerererwimzmzmzcwuhuhuhikcpcpcp
oykxkxkxumsfsfsfgoivivivmcqdqdqdsqylylylyegtgtgtesobobobkgwjwjwj

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: quererer
Cipher: dhrerere

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: quererer
Cipher: 1454512451245124

Extended Methods:
Method #1

Plaintext: quererer
method variations:
vzkwkwkwaepbpbpbfkuguguglpzmzmzm

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
q u e r e r e r 
1 5 5 2 5 2 5 2 
4 4 1 4 1 4 1 4 
They are then read out in rows:
1552525244141414
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: quererer
Cipher: vkkktqqq

Read more ...
Method #3

Plaintext: quererer
method variations:
yyfyfyfd yfyfyfdy fyfyfdyy
yfyfdyyf fyfdyyfy yfdyyfyf
fdyyfyfy dyyfyfyf

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: quererer

first 5040 cipher variations(40320 total)
quererer quererre quereerr quereerr quererer quererre querreer querrere querreer querrere querrree
querrree quererer quererre quereerr quereerr quererer quererre querrree querrree querrere querreer
querreer querrere queerrer queerrre queererr queererr queerrer queerrre queerrer queerrre queererr
queererr queerrer queerrre queeerrr queeerrr queeerrr queeerrr queeerrr queeerrr queerrer queerrre
queererr queererr queerrer queerrre quererer quererre quereerr quereerr quererer quererre querreer
querrere querreer querrere querrree querrree quererer quererre quereerr quereerr quererer quererre
querrree querrree querrere querreer querreer querrere queeerrr queeerrr queeerrr queeerrr queeerrr
queeerrr queererr queererr queerrer queerrre queerrre queerrer queerrer queerrre queererr queererr
queerrer queerrre queerrre queerrer queerrre queerrer queererr queererr quererer quererre quereerr
quereerr quererer quererre querreer querrere querreer querrere querrree querrree quererer quererre
quereerr quereerr quererer quererre querrree querrree querrere querreer querreer querrere qureerer
qureerre qureeerr qureeerr qureerer qureerre qurereer qurerere qurereer qurerere qurerree qurerree
qureerer qureerre qureeerr qureeerr qureerer qureerre qurerree qurerree qurerere qurereer qurereer
qurerere qureerer qureerre qureeerr qureeerr qureerer qureerre qurereer qurerere qurereer qurerere
qurerree qurerree qureerer qureerre qureeerr qureeerr qureerer qureerre qurerree qurerree qurerere
qurereer qurereer qurerere qurreeer qurreere qurreeer qurreere qurreree qurreree qurreeer qurreere
qurreeer qurreere qurreree qurreree qurreeer qurreere qurreeer qurreere qurreree qurreree qurrreee
qurrreee qurrreee qurrreee qurrreee qurrreee qureerer qureerre qureeerr qureeerr qureerer qureerre
qurereer qurerere qurereer qurerere qurerree qurerree qureerer qureerre qureeerr qureeerr qureerer
qureerre qurerree qurerree qurerere qurereer qurereer qurerere qurreree qurreree qurreere qurreeer
qurreeer qurreere qurrreee qurrreee qurrreee qurrreee qurrreee qurrreee qurreree qurreree qurreere
qurreeer qurreeer qurreere qurreree qurreree qurreere qurreeer qurreeer qurreere quererer quererre
quereerr quereerr quererer quererre querreer querrere querreer querrere querrree querrree quererer
quererre quereerr quereerr quererer quererre querrree querrree querrere querreer querreer querrere
queerrer queerrre queererr queererr queerrer queerrre queerrer queerrre queererr queererr queerrer
queerrre queeerrr queeerrr queeerrr queeerrr queeerrr queeerrr queerrer queerrre queererr queererr
queerrer queerrre quererer quererre quereerr quereerr quererer quererre querreer querrere querreer
querrere querrree querrree quererer quererre quereerr quereerr quererer quererre querrree querrree
querrere querreer querreer querrere queeerrr queeerrr queeerrr queeerrr queeerrr queeerrr queererr
queererr queerrer queerrre queerrre queerrer queerrer queerrre queererr queererr queerrer queerrre
queerrre queerrer queerrre queerrer queererr queererr quererer quererre quereerr quereerr quererer
quererre querreer querrere querreer querrere querrree querrree quererer quererre quereerr quereerr
quererer quererre querrree querrree querrere querreer querreer querrere qurreeer qurreere qurreeer
qurreere qurreree qurreree qurreeer qurreere qurreeer qurreere qurreree qurreree qurreeer qurreere
qurreeer qurreere qurreree qurreree qurrreee qurrreee qurrreee qurrreee qurrreee qurrreee qurereer
qurerere qurereer qurerere qurerree qurerree qureerer qureerre qureeerr qureeerr qureerer qureerre
qureeerr qureeerr qureerer qureerre qureerre qureerer qurereer qurerere qurereer qurerere qurerree
qurerree qureerer qureerre qureeerr qureeerr qureerer qureerre qurereer qurerere qurereer qurerere
qurerree qurerree qureerer qureerre qureeerr qureeerr qureerer qureerre qurerree qurerree qurerere
qurereer qurereer qurerere qureeerr qureeerr qureerer qureerre qureerre qureerer qureeerr qureeerr
qureerer qureerre qureerre qureerer qurereer qurerere qurereer qurerere qurerree qurerree qurerere
qurereer qurerree qurerree qurerere qurereer qurreeer qurreere qurreeer qurreere qurreree qurreree
qurreeer qurreere qurreeer qurreere qurreree qurreree qurreeer qurreere qurreeer qurreere qurreree
qurreree qurrreee qurrreee qurrreee qurrreee qurrreee qurrreee quererer quererre quereerr quereerr
quererer quererre querreer querrere querreer querrere querrree querrree quererer quererre quereerr
quereerr quererer quererre querrree querrree querrere querreer querreer querrere queerrer queerrre
queererr queererr queerrer queerrre queerrer queerrre queererr queererr queerrer queerrre queeerrr
queeerrr queeerrr queeerrr queeerrr queeerrr queerrer queerrre queererr queererr queerrer queerrre
quererer quererre quereerr quereerr quererer quererre querreer querrere querreer querrere querrree
querrree quererer quererre quereerr quereerr quererer quererre querrree querrree querrere querreer
querreer querrere queeerrr queeerrr queeerrr queeerrr queeerrr queeerrr queererr queererr queerrer
queerrre queerrre queerrer queerrer queerrre queererr queererr queerrer queerrre queerrre queerrer
queerrre queerrer queererr queererr quererer quererre quereerr quereerr quererer quererre querreer
querrere querreer querrere querrree querrree quererer quererre quereerr quereerr quererer quererre
querrree querrree querrere querreer querreer querrere qurreree qurreree qurreere qurreeer qurreeer
qurreere qurrreee qurrreee qurrreee qurrreee qurrreee qurrreee qurreree qurreree qurreere qurreeer
qurreeer qurreere qurreree qurreree qurreere qurreeer qurreeer qurreere qurerree qurerree qurerere
qurereer qurereer qurerere qurerree qurerree qurerere qurereer qurereer qurerere qureerre qureerer
qureerre qureerer qureeerr qureeerr qureerer qureerre qureeerr qureeerr qureerer qureerre qurreree
qurreree qurreere qurreeer qurreeer qurreere qurrreee qurrreee qurrreee qurrreee qurrreee qurrreee
qurreree qurreree qurreere qurreeer qurreeer qurreere qurreree qurreree qurreere qurreeer qurreeer
qurreere qureerre qureerer qureerre qureerer qureeerr qureeerr qurerere qurereer qurerree qurerree
qurerere qurereer qurerree qurerree qurerere qurereer qurereer qurerere qureerre qureerer qureerre
qureerer qureeerr qureeerr qureerer qureerre qureeerr qureeerr qureerer qureerre qurereer qurerere
qurereer qurerere qurerree qurerree qureerer qureerre qureeerr qureeerr qureerer qureerre qurerree
qurerree qurerere qurereer qurereer qurerere qeurerer qeurerre qeureerr qeureerr qeurerer qeurerre
qeurreer qeurrere qeurreer qeurrere qeurrree qeurrree qeurerer qeurerre qeureerr qeureerr qeurerer
qeurerre qeurrree qeurrree qeurrere qeurreer qeurreer qeurrere qeuerrer qeuerrre qeuererr qeuererr
qeuerrer qeuerrre qeuerrer qeuerrre qeuererr qeuererr qeuerrer qeuerrre qeueerrr qeueerrr qeueerrr
qeueerrr qeueerrr qeueerrr qeuerrer qeuerrre qeuererr qeuererr qeuerrer qeuerrre qeurerer qeurerre
qeureerr qeureerr qeurerer qeurerre qeurreer qeurrere qeurreer qeurrere qeurrree qeurrree qeurerer
qeurerre qeureerr qeureerr qeurerer qeurerre qeurrree qeurrree qeurrere qeurreer qeurreer qeurrere
qeueerrr qeueerrr qeueerrr qeueerrr qeueerrr qeueerrr qeuererr qeuererr qeuerrer qeuerrre qeuerrre
qeuerrer qeuerrer qeuerrre qeuererr qeuererr qeuerrer qeuerrre qeuerrre qeuerrer qeuerrre qeuerrer
qeuererr qeuererr qeurerer qeurerre qeureerr qeureerr qeurerer qeurerre qeurreer qeurrere qeurreer
qeurrere qeurrree qeurrree qeurerer qeurerre qeureerr qeureerr qeurerer qeurerre qeurrree qeurrree
qeurrere qeurreer qeurreer qeurrere qeruerer qeruerre qerueerr qerueerr qeruerer qeruerre qerureer
qerurere qerureer qerurere qerurree qerurree qeruerer qeruerre qerueerr qerueerr qeruerer qeruerre
qerurree qerurree qerurere qerureer qerureer qerurere qereurer qereurre qereuerr qereuerr qereurer
qereurre qereruer qererure qerereur qerereru qererreu qererrue qereerur qereerru qereeurr qereeurr
qereerur qereerru qererreu qererrue qerereru qerereur qereruer qererure qerreuer qerreure qerreeur
qerreeru qerrereu qerrerue qerrueer qerruere qerrueer qerruere qerruree qerruree qerreuer qerreure
qerreeur qerreeru qerrereu qerrerue qerrruee qerrruee qerrreue qerrreeu qerrreeu qerrreue qereerur
qereerru qereeurr qereeurr qereerur qereerru qerereur qerereru qereruer qererure qererrue qererreu
qereurer qereurre qereuerr qereuerr qereurer qereurre qererrue qererreu qererure qereruer qerereur
qerereru qerrereu qerrerue qerreeru qerreeur qerreuer qerreure qerrreeu qerrreue qerrreeu qerrreue
qerrruee qerrruee qerrereu qerrerue qerreeru qerreeur qerreuer qerreure qerruree qerruree qerruere
qerrueer qerrueer qerruere qeerurer qeerurre qeeruerr qeeruerr qeerurer qeerurre qeerruer qeerrure
qeerreur qeerreru qeerrreu qeerrrue qeererur qeererru qeereurr qeereurr qeererur qeererru qeerrreu
qeerrrue qeerreru qeerreur qeerruer qeerrure qeeurrer qeeurrre qeeurerr qeeurerr qeeurrer qeeurrre
qeeurrer qeeurrre qeeurerr qeeurerr qeeurrer qeeurrre qeeuerrr qeeuerrr qeeuerrr qeeuerrr qeeuerrr
qeeuerrr qeeurrer qeeurrre qeeurerr qeeurerr qeeurrer qeeurrre qeerurer qeerurre qeeruerr qeeruerr
qeerurer qeerurre qeerruer qeerrure qeerreur qeerreru qeerrreu qeerrrue qeererur qeererru qeereurr
qeereurr qeererur qeererru qeerrreu qeerrrue qeerreru qeerreur qeerruer qeerrure qeeeurrr qeeeurrr
qeeeurrr qeeeurrr qeeeurrr qeeeurrr qeeerurr qeeerurr qeeerrur qeeerrru qeeerrru qeeerrur qeeerrur
qeeerrru qeeerurr qeeerurr qeeerrur qeeerrru qeeerrru qeeerrur qeeerrru qeeerrur qeeerurr qeeerurr
qeerurer qeerurre qeeruerr qeeruerr qeerurer qeerurre qeerruer qeerrure qeerreur qeerreru qeerrreu
qeerrrue qeererur qeererru qeereurr qeereurr qeererur qeererru qeerrreu qeerrrue qeerreru qeerreur
qeerruer qeerrure qerreuer qerreure qerreeur qerreeru qerrereu qerrerue qerrueer qerruere qerrueer
qerruere qerruree qerruree qerreuer qerreure qerreeur qerreeru qerrereu qerrerue qerrruee qerrruee
qerrreue qerrreeu qerrreeu qerrreue qereruer qererure qerereur qerereru qererreu qererrue qereurer
qereurre qereuerr qereuerr qereurer qereurre qereeurr qereeurr qereerur qereerru qereerru qereerur
qereruer qererure qerereur qerereru qererreu qererrue qeruerer qeruerre qerueerr qerueerr qeruerer
qeruerre qerureer qerurere qerureer qerurere qerurree qerurree qeruerer qeruerre qerueerr qerueerr
qeruerer qeruerre qerurree qerurree qerurere qerureer qerureer qerurere qereeurr qereeurr qereerur
qereerru qereerru qereerur qereuerr qereuerr qereurer qereurre qereurre qereurer qereruer qererure
qerereur qerereru qererreu qererrue qererure qereruer qererrue qererreu qerereru qerereur qerreuer
qerreure qerreeur qerreeru qerrereu qerrerue qerrueer qerruere qerrueer qerruere qerruree qerruree
qerreuer qerreure qerreeur qerreeru qerrereu qerrerue qerrruee qerrruee qerrreue qerrreeu qerrreeu
qerrreue qeererur qeererru qeereurr qeereurr qeererur qeererru qeerreur qeerreru qeerruer qeerrure
qeerrrue qeerrreu qeerurer qeerurre qeeruerr qeeruerr qeerurer qeerurre qeerrrue qeerrreu qeerrure
qeerruer qeerreur qeerreru qeeerrur qeeerrru qeeerurr qeeerurr qeeerrur qeeerrru qeeerrur qeeerrru
qeeerurr qeeerurr qeeerrur qeeerrru qeeeurrr qeeeurrr qeeeurrr qeeeurrr qeeeurrr qeeeurrr qeeerrur
qeeerrru qeeerurr qeeerurr qeeerrur qeeerrru qeererur qeererru qeereurr qeereurr qeererur qeererru
qeerreur qeerreru qeerruer qeerrure qeerrrue qeerrreu qeerurer qeerurre qeeruerr qeeruerr qeerurer
qeerurre qeerrrue qeerrreu qeerrure qeerruer qeerreur qeerreru qeeuerrr qeeuerrr qeeuerrr qeeuerrr
qeeuerrr qeeuerrr qeeurerr qeeurerr qeeurrer qeeurrre qeeurrre qeeurrer qeeurrer qeeurrre qeeurerr
qeeurerr qeeurrer qeeurrre qeeurrre qeeurrer qeeurrre qeeurrer qeeurerr qeeurerr qeererur qeererru
qeereurr qeereurr qeererur qeererru qeerreur qeerreru qeerruer qeerrure qeerrrue qeerrreu qeerurer
qeerurre qeeruerr qeeruerr qeerurer qeerurre qeerrrue qeerrreu qeerrure qeerruer qeerreur qeerreru
qerrereu qerrerue qerreeru qerreeur qerreuer qerreure qerrreeu qerrreue qerrreeu qerrreue qerrruee
qerrruee qerrereu qerrerue qerreeru qerreeur qerreuer qerreure qerruree qerruree qerruere qerrueer
qerrueer qerruere qererreu qererrue qerereru qerereur qereruer qererure qererreu qererrue qerereru
qerereur qereruer qererure qereerru qereerur qereerru qereerur qereeurr qereeurr qereurer qereurre
qereuerr qereuerr qereurer qereurre qerrereu qerrerue qerreeru qerreeur qerreuer qerreure qerrreeu
qerrreue qerrreeu qerrreue qerrruee qerrruee qerrereu qerrerue qerreeru qerreeur qerreuer qerreure
qerruree qerruree qerruere qerrueer qerrueer qerruere qereerru qereerur qereerru qereerur qereeurr
qereeurr qerereru qerereur qererreu qererrue qererure qereruer qererreu qererrue qerereru qerereur
qereruer qererure qereurre qereurer qereurre qereurer qereuerr qereuerr qeruerer qeruerre qerueerr
qerueerr qeruerer qeruerre qerureer qerurere qerureer qerurere qerurree qerurree qeruerer qeruerre
qerueerr qerueerr qeruerer qeruerre qerurree qerurree qerurere qerureer qerureer qerurere qreuerer
qreuerre qreueerr qreueerr qreuerer qreuerre qreureer qreurere qreureer qreurere qreurree qreurree
qreuerer qreuerre qreueerr qreueerr qreuerer qreuerre qreurree qreurree qreurere qreureer qreureer
qreurere qreeurer qreeurre qreeuerr qreeuerr qreeurer qreeurre qreeruer qreerure qreereur qreereru
qreerreu qreerrue qreeerur qreeerru qreeeurr qreeeurr qreeerur qreeerru qreerreu qreerrue qreereru
qreereur qreeruer qreerure qrereuer qrereure qrereeur qrereeru qrerereu qrererue qrerueer qreruere
qrerueer qreruere qreruree qreruree qrereuer qrereure qrereeur qrereeru qrerereu qrererue qrerruee
qrerruee qrerreue qrerreeu qrerreeu qrerreue qreeerur qreeerru qreeeurr qreeeurr qreeerur qreeerru
qreereur qreereru qreeruer qreerure qreerrue qreerreu qreeurer qreeurre qreeuerr qreeuerr qreeurer
qreeurre qreerrue qreerreu qreerure qreeruer qreereur qreereru qrerereu qrererue qrereeru qrereeur
qrereuer qrereure qrerreeu qrerreue qrerreeu qrerreue qrerruee qrerruee qrerereu qrererue qrereeru
qrereeur qrereuer qrereure qreruree qreruree qreruere qrerueer qrerueer qreruere qrueerer qrueerre
qrueeerr qrueeerr qrueerer qrueerre qruereer qruerere qruereer qruerere qruerree qruerree qrueerer
qrueerre qrueeerr qrueeerr qrueerer qrueerre qruerree qruerree qruerere qruereer qruereer qruerere
qrueerer qrueerre qrueeerr qrueeerr qrueerer qrueerre qruereer qruerere qruereer qruerere qruerree
qruerree qrueerer qrueerre qrueeerr qrueeerr qrueerer qrueerre qruerree qruerree qruerere qruereer
qruereer qruerere qrureeer qrureere qrureeer qrureere qrureree qrureree qrureeer qrureere qrureeer
qrureere qrureree qrureree qrureeer qrureere qrureeer qrureere qrureree qrureree qrurreee qrurreee
qrurreee qrurreee qrurreee qrurreee qrueerer qrueerre qrueeerr qrueeerr qrueerer qrueerre qruereer
qruerere qruereer qruerere qruerree qruerree qrueerer qrueerre qrueeerr qrueeerr qrueerer qrueerre
qruerree qruerree qruerere qruereer qruereer qruerere qrureree qrureree qrureere qrureeer qrureeer
qrureere qrurreee qrurreee qrurreee qrurreee qrurreee qrurreee qrureree qrureree qrureere qrureeer
qrureeer qrureere qrureree qrureree qrureere qrureeer qrureeer qrureere qreuerer qreuerre qreueerr
qreueerr qreuerer qreuerre qreureer qreurere qreureer qreurere qreurree qreurree qreuerer qreuerre
qreueerr qreueerr qreuerer qreuerre qreurree qreurree qreurere qreureer qreureer qreurere qreeurer
qreeurre qreeuerr qreeuerr qreeurer qreeurre qreeruer qreerure qreereur qreereru qreerreu qreerrue
qreeerur qreeerru qreeeurr qreeeurr qreeerur qreeerru qreerreu qreerrue qreereru qreereur qreeruer
qreerure qrereuer qrereure qrereeur qrereeru qrerereu qrererue qrerueer qreruere qrerueer qreruere
qreruree qreruree qrereuer qrereure qrereeur qrereeru qrerereu qrererue qrerruee qrerruee qrerreue
qrerreeu qrerreeu qrerreue qreeerur qreeerru qreeeurr qreeeurr qreeerur qreeerru qreereur qreereru
qreeruer qreerure qreerrue qreerreu qreeurer qreeurre qreeuerr qreeuerr qreeurer qreeurre qreerrue
qreerreu qreerure qreeruer qreereur qreereru qrerereu qrererue qrereeru qrereeur qrereuer qrereure
qrerreeu qrerreue qrerreeu qrerreue qrerruee qrerruee qrerereu qrererue qrereeru qrereeur qrereuer
qrereure qreruree qreruree qreruere qrerueer qrerueer qreruere qrrueeer qrrueere qrrueeer qrrueere
qrrueree qrrueree qrrueeer qrrueere qrrueeer qrrueere qrrueree qrrueree qrrueeer qrrueere qrrueeer
qrrueere qrrueree qrrueree qrrureee qrrureee qrrureee qrrureee qrrureee qrrureee qrreueer qrreuere
qrreueer qrreuere qrreuree qrreuree qrreeuer qrreeure qrreeeur qrreeeru qrreereu qrreerue qrreeeur
qrreeeru qrreeuer qrreeure qrreerue qrreereu qrrereeu qrrereue qrrereeu qrrereue qrreruee qrreruee
qrreeuer qrreeure qrreeeur qrreeeru qrreereu qrreerue qrreueer qrreuere qrreueer qrreuere qrreuree
qrreuree qrreeuer qrreeure qrreeeur qrreeeru qrreereu qrreerue qrreruee qrreruee qrrereue qrrereeu
qrrereeu qrrereue qrreeeur qrreeeru qrreeuer qrreeure qrreerue qrreereu qrreeeur qrreeeru qrreeuer
qrreeure qrreerue qrreereu qrreueer qrreuere qrreueer qrreuere qrreuree qrreuree qrrereue qrrereeu
qrreruee qrreruee qrrereue qrrereeu qrrreeeu qrrreeue qrrreeeu qrrreeue qrrreuee qrrreuee qrrreeeu
qrrreeue qrrreeeu qrrreeue qrrreuee qrrreuee qrrreeeu qrrreeue qrrreeeu qrrreeue qrrreuee qrrreuee
qrrrueee qrrrueee qrrrueee qrrrueee qrrrueee qrrrueee qreuerer qreuerre qreueerr qreueerr qreuerer
qreuerre qreureer qreurere qreureer qreurere qreurree qreurree qreuerer qreuerre qreueerr qreueerr
qreuerer qreuerre qreurree qreurree qreurere qreureer qreureer qreurere qreeurer qreeurre qreeuerr
qreeuerr qreeurer qreeurre qreeruer qreerure qreereur qreereru qreerreu qreerrue qreeerur qreeerru
qreeeurr qreeeurr qreeerur qreeerru qreerreu qreerrue qreereru qreereur qreeruer qreerure qrereuer
qrereure qrereeur qrereeru qrerereu qrererue qrerueer qreruere qrerueer qreruere qreruree qreruree
qrereuer qrereure qrereeur qrereeru qrerereu qrererue qrerruee qrerruee qrerreue qrerreeu qrerreeu
qrerreue qreeerur qreeerru qreeeurr qreeeurr qreeerur qreeerru qreereur qreereru qreeruer qreerure
qreerrue qreerreu qreeurer qreeurre qreeuerr qreeuerr qreeurer qreeurre qreerrue qreerreu qreerure
qreeruer qreereur qreereru qrerereu qrererue qrereeru qrereeur qrereuer qrereure qrerreeu qrerreue
qrerreeu qrerreue qrerruee qrerruee qrerereu qrererue qrereeru qrereeur qrereuer qrereure qreruree
qreruree qreruere qrerueer qrerueer qreruere qrrueree qrrueree qrrueere qrrueeer qrrueeer qrrueere
qrrureee qrrureee qrrureee qrrureee qrrureee qrrureee qrrueree qrrueree qrrueere qrrueeer qrrueeer
qrrueere qrrueree qrrueree qrrueere qrrueeer qrrueeer qrrueere qrreuree qrreuree qrreuere qrreueer
qrreueer qrreuere qrreruee qrreruee qrrereue qrrereeu qrrereeu qrrereue qrreerue qrreereu qrreeure
qrreeuer qrreeeur qrreeeru qrreereu qrreerue qrreeeru qrreeeur qrreeuer qrreeure qrrreuee qrrreuee
qrrreeue qrrreeeu qrrreeeu qrrreeue qrrrueee qrrrueee qrrrueee qrrrueee qrrrueee qrrrueee qrrreuee
qrrreuee qrrreeue qrrreeeu qrrreeeu qrrreeue qrrreuee qrrreuee qrrreeue qrrreeeu qrrreeeu qrrreeue
qrreerue qrreereu qrreeure qrreeuer qrreeeur qrreeeru qrrereue qrrereeu qrreruee qrreruee qrrereue
qrrereeu qrreuree qrreuree qrreuere qrreueer qrreueer qrreuere qrreerue qrreereu qrreeure qrreeuer
qrreeeur qrreeeru qrreereu qrreerue qrreeeru qrreeeur qrreeuer qrreeure qrrereeu qrrereue qrrereeu
qrrereue qrreruee qrreruee qrreereu qrreerue qrreeeru qrreeeur qrreeuer qrreeure qrreuree qrreuree
qrreuere qrreueer qrreueer qrreuere qeerurer qeerurre qeeruerr qeeruerr qeerurer qeerurre qeerruer
qeerrure qeerreur qeerreru qeerrreu qeerrrue qeererur qeererru qeereurr qeereurr qeererur qeererru
qeerrreu qeerrrue qeerreru qeerreur qeerruer qeerrure qeeurrer qeeurrre qeeurerr qeeurerr qeeurrer
qeeurrre qeeurrer qeeurrre qeeurerr qeeurerr qeeurrer qeeurrre qeeuerrr qeeuerrr qeeuerrr qeeuerrr
qeeuerrr qeeuerrr qeeurrer qeeurrre qeeurerr qeeurerr qeeurrer qeeurrre qeerurer qeerurre qeeruerr
qeeruerr qeerurer qeerurre qeerruer qeerrure qeerreur qeerreru qeerrreu qeerrrue qeererur qeererru
qeereurr qeereurr qeererur qeererru qeerrreu qeerrrue qeerreru qeerreur qeerruer qeerrure qeeeurrr
qeeeurrr qeeeurrr qeeeurrr qeeeurrr qeeeurrr qeeerurr qeeerurr qeeerrur qeeerrru qeeerrru qeeerrur
qeeerrur qeeerrru qeeerurr qeeerurr qeeerrur qeeerrru qeeerrru qeeerrur qeeerrru qeeerrur qeeerurr
qeeerurr qeerurer qeerurre qeeruerr qeeruerr qeerurer qeerurre qeerruer qeerrure qeerreur qeerreru
qeerrreu qeerrrue qeererur qeererru qeereurr qeereurr qeererur qeererru qeerrreu qeerrrue qeerreru
qeerreur qeerruer qeerrure qereurer qereurre qereuerr qereuerr qereurer qereurre qereruer qererure
qerereur qerereru qererreu qererrue qereerur qereerru qereeurr qereeurr qereerur qereerru qererreu
qererrue qerereru qerereur qereruer qererure qeruerer qeruerre qerueerr qerueerr qeruerer qeruerre
qerureer qerurere qerureer qerurere qerurree qerurree qeruerer qeruerre qerueerr qerueerr qeruerer
qeruerre qerurree qerurree qerurere qerureer qerureer qerurere qerrueer qerruere qerrueer qerruere
qerruree qerruree qerreuer qerreure qerreeur qerreeru qerrereu qerrerue qerreeur qerreeru qerreuer
qerreure qerrerue qerrereu qerrreeu qerrreue qerrreeu qerrreue qerrruee qerrruee qereurer qereurre
qereuerr qereuerr qereurer qereurre qereruer qererure qerereur qerereru qererreu qererrue qereerur
qereerru qereeurr qereeurr qereerur qereerru qererreu qererrue qerereru qerereur qereruer qererure
qerruree qerruree qerruere qerrueer qerrueer qerruere qerrruee qerrruee qerrreue qerrreeu qerrreeu
qerrreue qerrerue qerrereu qerreure qerreuer qerreeur qerreeru qerrereu qerrerue qerreeru qerreeur
qerreuer qerreure qeurerer qeurerre qeureerr qeureerr qeurerer qeurerre qeurreer qeurrere qeurreer
qeurrere qeurrree qeurrree qeurerer qeurerre qeureerr qeureerr qeurerer qeurerre qeurrree qeurrree
qeurrere qeurreer qeurreer qeurrere qeuerrer qeuerrre qeuererr qeuererr qeuerrer qeuerrre qeuerrer
qeuerrre qeuererr qeuererr qeuerrer qeuerrre qeueerrr qeueerrr qeueerrr qeueerrr qeueerrr qeueerrr
qeuerrer qeuerrre qeuererr qeuererr qeuerrer qeuerrre qeurerer qeurerre qeureerr qeureerr qeurerer
qeurerre qeurreer qeurrere qeurreer qeurrere qeurrree qeurrree qeurerer qeurerre qeureerr qeureerr
qeurerer qeurerre qeurrree qeurrree qeurrere qeurreer qeurreer qeurrere qeueerrr qeueerrr qeueerrr
qeueerrr qeueerrr qeueerrr qeuererr qeuererr qeuerrer qeuerrre qeuerrre qeuerrer qeuerrer qeuerrre
qeuererr qeuererr qeuerrer qeuerrre qeuerrre qeuerrer qeuerrre qeuerrer qeuererr qeuererr qeurerer
qeurerre qeureerr qeureerr qeurerer qeurerre qeurreer qeurrere qeurreer qeurrere qeurrree qeurrree
qeurerer qeurerre qeureerr qeureerr qeurerer qeurerre qeurrree qeurrree qeurrere qeurreer qeurreer
qeurrere qerrueer qerruere qerrueer qerruere qerruree qerruree qerreuer qerreure qerreeur qerreeru
qerrereu qerrerue qerreeur qerreeru qerreuer qerreure qerrerue qerrereu qerrreeu qerrreue qerrreeu
qerrreue qerrruee qerrruee qerureer qerurere qerureer qerurere qerurree qerurree qeruerer qeruerre
qerueerr qerueerr qeruerer qeruerre qerueerr qerueerr qeruerer qeruerre qeruerre qeruerer qerureer
qerurere qerureer qerurere qerurree qerurree qereurer qereurre qereuerr qereuerr qereurer qereurre
qereruer qererure qerereur qerereru qererreu qererrue qereerur qereerru qereeurr qereeurr qereerur
qereerru qererreu qererrue qerereru qerereur qereruer qererure qereuerr qereuerr qereurer qereurre
qereurre qereurer qereeurr qereeurr qereerur qereerru qereerru qereerur qerereur qerereru qereruer
qererure qererrue qererreu qerereru qerereur qererreu qererrue qererure qereruer qerrueer qerruere
qerrueer qerruere qerruree qerruree qerreuer qerreure qerreeur qerreeru qerrereu qerrerue qerreeur
qerreeru qerreuer qerreure qerrerue qerrereu qerrreeu qerrreue qerrreeu qerrreue qerrruee qerrruee
qeerurer qeerurre qeeruerr qeeruerr qeerurer qeerurre qeerruer qeerrure qeerreur qeerreru qeerrreu
qeerrrue qeererur qeererru qeereurr qeereurr qeererur qeererru qeerrreu qeerrrue qeerreru qeerreur
qeerruer qeerrure qeeurrer qeeurrre qeeurerr qeeurerr qeeurrer qeeurrre qeeurrer qeeurrre qeeurerr
qeeurerr qeeurrer qeeurrre qeeuerrr qeeuerrr qeeuerrr qeeuerrr qeeuerrr qeeuerrr qeeurrer qeeurrre
qeeurerr qeeurerr qeeurrer qeeurrre qeerurer qeerurre qeeruerr qeeruerr qeerurer qeerurre qeerruer
qeerrure qeerreur qeerreru qeerrreu qeerrrue qeererur qeererru qeereurr qeereurr qeererur qeererru
qeerrreu qeerrrue qeerreru qeerreur qeerruer qeerrure qeeeurrr qeeeurrr qeeeurrr qeeeurrr qeeeurrr
qeeeurrr qeeerurr qeeerurr qeeerrur qeeerrru qeeerrru qeeerrur qeeerrur qeeerrru qeeerurr qeeerurr
qeeerrur qeeerrru qeeerrru qeeerrur qeeerrru qeeerrur qeeerurr qeeerurr qeerurer qeerurre qeeruerr
qeeruerr qeerurer qeerurre qeerruer qeerrure qeerreur qeerreru qeerrreu qeerrrue qeererur qeererru
qeereurr qeereurr qeererur qeererru qeerrreu qeerrrue qeerreru qeerreur qeerruer qeerrure qerruree
qerruree qerruere qerrueer qerrueer qerruere qerrruee qerrruee qerrreue qerrreeu qerrreeu qerrreue
qerrerue qerrereu qerreure qerreuer qerreeur qerreeru qerrereu qerrerue qerreeru qerreeur qerreuer
qerreure qerurree qerurree qerurere qerureer qerureer qerurere qerurree qerurree qerurere qerureer
qerureer qerurere qeruerre qeruerer qeruerre qeruerer qerueerr qerueerr qeruerer qeruerre qerueerr
qerueerr qeruerer qeruerre qerruree qerruree qerruere qerrueer qerrueer qerruere qerrruee qerrruee
qerrreue qerrreeu qerrreeu qerrreue qerrerue qerrereu qerreure qerreuer qerreeur qerreeru qerrereu
qerrerue qerreeru qerreeur qerreuer qerreure qereurre qereurer qereurre qereurer qereuerr qereuerr
qererure qereruer qererrue qererreu qerereru qerereur qererrue qererreu qererure qereruer qerereur
qerereru qereerru qereerur qereerru qereerur qereeurr qereeurr qereurer qereurre qereuerr qereuerr
qereurer qereurre qereruer qererure qerereur qerereru qererreu qererrue qereerur qereerru qereeurr
qereeurr qereerur qereerru qererreu qererrue qerereru qerereur qereruer qererure qrereuer qrereure
qrereeur qrereeru qrerereu qrererue qrerueer qreruere qrerueer qreruere qreruree qreruree qrereuer
qrereure qrereeur qrereeru qrerereu qrererue qrerruee qrerruee qrerreue qrerreeu qrerreeu qrerreue
qreeruer qreerure qreereur qreereru qreerreu qreerrue qreeurer qreeurre qreeuerr qreeuerr qreeurer
qreeurre qreeeurr qreeeurr qreeerur qreeerru qreeerru qreeerur qreeruer qreerure qreereur qreereru
qreerreu qreerrue qreuerer qreuerre qreueerr qreueerr qreuerer qreuerre qreureer qreurere qreureer
qreurere qreurree qreurree qreuerer qreuerre qreueerr qreueerr qreuerer qreuerre qreurree qreurree
qreurere qreureer qreureer qreurere qreeeurr qreeeurr qreeerur qreeerru qreeerru qreeerur qreeuerr
qreeuerr qreeurer qreeurre qreeurre qreeurer qreeruer qreerure qreereur qreereru qreerreu qreerrue
qreerure qreeruer qreerrue qreerreu qreereru qreereur qrereuer qrereure qrereeur qrereeru qrerereu
qrererue qrerueer qreruere qrerueer qreruere qreruree qreruree qrereuer qrereure qrereeur qrereeru
qrerereu qrererue qrerruee qrerruee qrerreue qrerreeu qrerreeu qrerreue qrreeuer qrreeure qrreeeur
qrreeeru qrreereu qrreerue qrreueer qrreuere qrreueer qrreuere qrreuree qrreuree qrreeuer qrreeure
qrreeeur qrreeeru qrreereu qrreerue qrreruee qrreruee qrrereue qrrereeu qrrereeu qrrereue qrreeuer
qrreeure qrreeeur qrreeeru qrreereu qrreerue qrreueer qrreuere qrreueer qrreuere qrreuree qrreuree
qrreeuer qrreeure qrreeeur qrreeeru qrreereu qrreerue qrreruee qrreruee qrrereue qrrereeu qrrereeu
qrrereue qrrueeer qrrueere qrrueeer qrrueere qrrueree qrrueree qrrueeer qrrueere qrrueeer qrrueere
qrrueree qrrueree qrrueeer qrrueere qrrueeer qrrueere qrrueree qrrueree qrrureee qrrureee qrrureee
qrrureee qrrureee qrrureee qrreeuer qrreeure qrreeeur qrreeeru qrreereu qrreerue qrreueer qrreuere
qrreueer qrreuere qrreuree qrreuree qrreeuer qrreeure qrreeeur qrreeeru qrreereu qrreerue qrreruee
qrreruee qrrereue qrrereeu qrrereeu qrrereue qrrreuee qrrreuee qrrreeue qrrreeeu qrrreeeu qrrreeue
qrrrueee qrrrueee qrrrueee qrrrueee qrrrueee qrrrueee qrrreuee qrrreuee qrrreeue qrrreeeu qrrreeeu
qrrreeue qrrreuee qrrreuee qrrreeue qrrreeeu qrrreeeu qrrreeue qrereuer qrereure qrereeur qrereeru
qrerereu qrererue qrerueer qreruere qrerueer qreruere qreruree qreruree qrereuer qrereure qrereeur
qrereeru qrerereu qrererue qrerruee qrerruee qrerreue qrerreeu qrerreeu qrerreue qreeruer qreerure
qreereur qreereru qreerreu qreerrue qreeurer qreeurre qreeuerr qreeuerr qreeurer qreeurre qreeeurr
qreeeurr qreeerur qreeerru qreeerru qreeerur qreeruer qreerure qreereur qreereru qreerreu qreerrue
qreuerer qreuerre qreueerr qreueerr qreuerer qreuerre qreureer qreurere qreureer qreurere qreurree
qreurree qreuerer qreuerre qreueerr qreueerr qreuerer qreuerre qreurree qreurree qreurere qreureer
qreureer qreurere qreeeurr qreeeurr qreeerur qreeerru qreeerru qreeerur qreeuerr qreeuerr qreeurer
qreeurre qreeurre qreeurer qreeruer qreerure qreereur qreereru qreerreu qreerrue qreerure qreeruer
qreerrue qreerreu qreereru qreereur qrereuer qrereure qrereeur qrereeru qrerereu qrererue qrerueer
qreruere qrerueer qreruere qreruree qreruree qrereuer qrereure qrereeur qrereeru qrerereu qrererue
qrerruee qrerruee qrerreue qrerreeu qrerreeu qrerreue qrureeer qrureere qrureeer qrureere qrureree
qrureree qrureeer qrureere qrureeer qrureere qrureree qrureree qrureeer qrureere qrureeer qrureere
qrureree qrureree qrurreee qrurreee qrurreee qrurreee qrurreee qrurreee qruereer qruerere qruereer
qruerere qruerree qruerree qrueerer qrueerre qrueeerr qrueeerr qrueerer qrueerre qrueeerr qrueeerr
qrueerer qrueerre qrueerre qrueerer qruereer qruerere qruereer qruerere qruerree qruerree qrueerer
qrueerre qrueeerr qrueeerr qrueerer qrueerre qruereer qruerere qruereer qruerere qruerree qruerree
qrueerer qrueerre qrueeerr qrueeerr qrueerer qrueerre qruerree qruerree qruerere qruereer qruereer
qruerere qrueeerr qrueeerr qrueerer qrueerre qrueerre qrueerer qrueeerr qrueeerr qrueerer qrueerre
qrueerre qrueerer qruereer qruerere qruereer qruerere qruerree qruerree qruerere qruereer qruerree
qruerree qruerere qruereer qrureeer qrureere qrureeer qrureere qrureree qrureree qrureeer qrureere
qrureeer qrureere qrureree qrureree qrureeer qrureere qrureeer qrureere qrureree qrureree qrurreee
qrurreee qrurreee qrurreee qrurreee qrurreee qrereuer qrereure qrereeur qrereeru qrerereu qrererue
qrerueer qreruere qrerueer qreruere qreruree qreruree qrereuer qrereure qrereeur qrereeru qrerereu
qrererue qrerruee qrerruee qrerreue qrerreeu qrerreeu qrerreue qreeruer qreerure qreereur qreereru
qreerreu qreerrue qreeurer qreeurre qreeuerr qreeuerr qreeurer qreeurre qreeeurr qreeeurr qreeerur
qreeerru qreeerru qreeerur qreeruer qreerure qreereur qreereru qreerreu qreerrue qreuerer qreuerre
qreueerr qreueerr qreuerer qreuerre qreureer qreurere qreureer qreurere qreurree qreurree qreuerer
qreuerre qreueerr qreueerr qreuerer qreuerre qreurree qreurree qreurere qreureer qreureer qreurere
qreeeurr qreeeurr qreeerur qreeerru qreeerru qreeerur qreeuerr qreeuerr qreeurer qreeurre qreeurre
qreeurer qreeruer qreerure qreereur qreereru qreerreu qreerrue qreerure qreeruer qreerrue qreerreu
qreereru qreereur qrereuer qrereure qrereeur qrereeru qrerereu qrererue qrerueer qreruere qrerueer
qreruere qreruree qreruree qrereuer qrereure qrereeur qrereeru qrerereu qrererue qrerruee qrerruee
qrerreue qrerreeu qrerreeu qrerreue qrrreuee qrrreuee qrrreeue qrrreeeu qrrreeeu qrrreeue qrrrueee
qrrrueee qrrrueee qrrrueee qrrrueee qrrrueee qrrreuee qrrreuee qrrreeue qrrreeeu qrrreeeu qrrreeue
qrrreuee qrrreuee qrrreeue qrrreeeu qrrreeeu qrrreeue qrreruee qrreruee qrrereue qrrereeu qrrereeu
qrrereue qrreuree qrreuree qrreuere qrreueer qrreueer qrreuere qrreeure qrreeuer qrreerue qrreereu
qrreeeru qrreeeur qrreeuer qrreeure qrreeeur qrreeeru qrreereu qrreerue qrrueree qrrueree qrrueere
qrrueeer qrrueeer qrrueere qrrureee qrrureee qrrureee qrrureee qrrureee qrrureee qrrueree qrrueree
qrrueere qrrueeer qrrueeer qrrueere qrrueree qrrueree qrrueere qrrueeer qrrueeer qrrueere qrreeure
qrreeuer qrreerue qrreereu qrreeeru qrreeeur qrreuere qrreueer qrreuree qrreuree qrreuere qrreueer
qrreruee qrreruee qrrereue qrrereeu qrrereeu qrrereue qrreeure qrreeuer qrreerue qrreereu qrreeeru
qrreeeur qrreeuer qrreeure qrreeeur qrreeeru qrreereu qrreerue qrreueer qrreuere qrreueer qrreuere
qrreuree qrreuree qrreeuer qrreeure qrreeeur qrreeeru qrreereu qrreerue qrreruee qrreruee qrrereue
qrrereeu qrrereeu qrrereue qeererur qeererru qeereurr qeereurr qeererur qeererru qeerreur qeerreru
qeerruer qeerrure qeerrrue qeerrreu qeerurer qeerurre qeeruerr qeeruerr qeerurer qeerurre qeerrrue
qeerrreu qeerrure qeerruer qeerreur qeerreru qeeerrur qeeerrru qeeerurr qeeerurr qeeerrur qeeerrru
qeeerrur qeeerrru qeeerurr qeeerurr qeeerrur qeeerrru qeeeurrr qeeeurrr qeeeurrr qeeeurrr qeeeurrr
qeeeurrr qeeerrur qeeerrru qeeerurr qeeerurr qeeerrur qeeerrru qeererur qeererru qeereurr qeereurr
qeererur qeererru qeerreur qeerreru qeerruer qeerrure qeerrrue qeerrreu qeerurer qeerurre qeeruerr
qeeruerr qeerurer qeerurre qeerrrue qeerrreu qeerrure qeerruer qeerreur qeerreru qeeuerrr qeeuerrr
qeeuerrr qeeuerrr qeeuerrr qeeuerrr qeeurerr qeeurerr qeeurrer qeeurrre qeeurrre qeeurrer qeeurrer
qeeurrre qeeurerr qeeurerr qeeurrer qeeurrre qeeurrre qeeurrer qeeurrre qeeurrer qeeurerr qeeurerr
qeererur qeererru qeereurr qeereurr qeererur qeererru qeerreur qeerreru qeerruer qeerrure qeerrrue
qeerrreu qeerurer qeerurre qeeruerr qeeruerr qeerurer qeerurre qeerrrue qeerrreu qeerrure qeerruer
qeerreur qeerreru qereerur qereerru qereeurr qereeurr qereerur qereerru qerereur qerereru qereruer
qererure qererrue qererreu qereurer qereurre qereuerr qereuerr qereurer qereurre qererrue qererreu
qererure qereruer qerereur qerereru qereerur qereerru qereeurr qereeurr qereerur qereerru qerereur
qerereru qereruer qererure qererrue qererreu qereurer qereurre qereuerr qereuerr qereurer qereurre
qererrue qererreu qererure qereruer qerereur qerereru qerreeur qerreeru qerreuer qerreure qerrerue
qerrereu qerreeur qerreeru qerreuer qerreure qerrerue qerrereu qerrueer qerruere qerrueer qerruere
qerruree qerruree qerrreue qerrreeu qerrruee qerrruee qerrreue qerrreeu qeruerer qeruerre qerueerr
qerueerr qeruerer qeruerre qerureer qerurere qerureer qerurere qerurree qerurree qeruerer qeruerre
qerueerr qerueerr qeruerer qeruerre qerurree qerurree qerurere qerureer qerureer qerurere qerrerue
qerrereu qerreure qerreuer qerreeur qerreeru qerrreue qerrreeu qerrruee qerrruee qerrreue qerrreeu
qerruree qerruree qerruere qerrueer qerrueer qerruere qerrerue qerrereu qerreure qerreuer qerreeur
qerreeru qeererur qeererru qeereurr qeereurr qeererur qeererru qeerreur qeerreru qeerruer qeerrure
qeerrrue qeerrreu qeerurer qeerurre qeeruerr qeeruerr qeerurer qeerurre qeerrrue qeerrreu qeerrure
qeerruer qeerreur qeerreru qeeerrur qeeerrru qeeerurr qeeerurr qeeerrur qeeerrru qeeerrur qeeerrru
qeeerurr qeeerurr qeeerrur qeeerrru qeeeurrr qeeeurrr qeeeurrr qeeeurrr qeeeurrr qeeeurrr qeeerrur
qeeerrru qeeerurr qeeerurr qeeerrur qeeerrru qeererur qeererru qeereurr qeereurr qeererur qeererru
qeerreur qeerreru qeerruer qeerrure qeerrrue qeerrreu qeerurer qeerurre qeeruerr qeeruerr qeerurer
qeerurre qeerrrue qeerrreu qeerrure qeerruer qeerreur qeerreru qeeuerrr qeeuerrr qeeuerrr qeeuerrr
qeeuerrr qeeuerrr qeeurerr qeeurerr qeeurrer qeeurrre qeeurrre qeeurrer qeeurrer qeeurrre qeeurerr
qeeurerr qeeurrer qeeurrre qeeurrre qeeurrer qeeurrre qeeurrer qeeurerr qeeurerr qeererur qeererru
qeereurr qeereurr qeererur qeererru qeerreur qeerreru qeerruer qeerrure qeerrrue qeerrreu qeerurer
qeerurre qeeruerr qeeruerr qeerurer qeerurre qeerrrue qeerrreu qeerrure qeerruer qeerreur qeerreru
qerreeur qerreeru qerreuer qerreure qerrerue qerrereu qerreeur qerreeru qerreuer qerreure qerrerue
qerrereu qerrueer qerruere qerrueer qerruere qerruree qerruree qerrreue qerrreeu qerrruee qerrruee
qerrreue qerrreeu qerereur qerereru qereruer qererure qererrue qererreu qereerur qereerru qereeurr
qereeurr qereerur qereerru qereuerr qereuerr qereurer qereurre qereurre qereurer qerereur qerereru
qereruer qererure qererrue qererreu qereerur qereerru qereeurr qereeurr qereerur qereerru qerereur
qerereru qereruer qererure qererrue qererreu qereurer qereurre qereuerr qereuerr qereurer qereurre
qererrue qererreu qererure qereruer qerereur qerereru qerueerr qerueerr qeruerer qeruerre qeruerre
qeruerer qerueerr qerueerr qeruerer qeruerre qeruerre qeruerer qerureer qerurere qerureer qerurere
qerurree qerurree qerurere qerureer qerurree qerurree qerurere qerureer qerreeur qerreeru qerreuer
qerreure qerrerue qerrereu qerreeur qerreeru qerreuer qerreure qerrerue qerrereu qerrueer qerruere
qerrueer qerruere qerruree qerruree qerrreue qerrreeu qerrruee qerrruee qerrreue qerrreeu qeurerer
qeurerre qeureerr qeureerr qeurerer qeurerre qeurreer qeurrere qeurreer qeurrere qeurrree qeurrree
qeurerer qeurerre qeureerr qeureerr qeurerer qeurerre qeurrree qeurrree qeurrere qeurreer qeurreer
qeurrere qeuerrer qeuerrre qeuererr qeuererr qeuerrer qeuerrre qeuerrer qeuerrre qeuererr qeuererr
qeuerrer qeuerrre qeueerrr qeueerrr qeueerrr qeueerrr qeueerrr qeueerrr qeuerrer qeuerrre qeuererr
qeuererr qeuerrer qeuerrre qeurerer qeurerre qeureerr qeureerr qeurerer qeurerre qeurreer qeurrere
qeurreer qeurrere qeurrree qeurrree qeurerer qeurerre qeureerr qeureerr qeurerer qeurerre qeurrree
qeurrree qeurrere qeurreer qeurreer qeurrere qeueerrr qeueerrr qeueerrr qeueerrr qeueerrr qeueerrr
qeuererr qeuererr qeuerrer qeuerrre qeuerrre qeuerrer qeuerrer qeuerrre qeuererr qeuererr qeuerrer
qeuerrre qeuerrre qeuerrer qeuerrre qeuerrer qeuererr qeuererr qeurerer qeurerre qeureerr qeureerr
qeurerer qeurerre qeurreer qeurrere qeurreer qeurrere qeurrree qeurrree qeurerer qeurerre qeureerr
qeureerr qeurerer qeurerre qeurrree qeurrree qeurrere qeurreer qeurreer qeurrere qerrerue qerrereu
qerreure qerreuer qerreeur qerreeru qerrreue qerrreeu qerrruee qerrruee qerrreue qerrreeu qerruree
qerruree qerruere qerrueer qerrueer qerruere qerrerue qerrereu qerreure qerreuer qerreeur qerreeru
qererrue qererreu qererure qereruer qerereur qerereru qererrue qererreu qererure qereruer qerereur
qerereru qereurre qereurer qereurre qereurer qereuerr qereuerr qereerur qereerru qereeurr qereeurr
qereerur qereerru qerrerue qerrereu qerreure qerreuer qerreeur qerreeru qerrreue qerrreeu qerrruee
qerrruee qerrreue qerrreeu qerruree qerruree qerruere qerrueer qerrueer qerruere qerrerue qerrereu
qerreure qerreuer qerreeur qerreeru qeruerre qeruerer qeruerre qeruerer qerueerr qerueerr qerurere
qerureer qerurree qerurree qerurere qerureer qerurree qerurree qerurere qerureer qerureer qerurere
qeruerre qeruerer qeruerre qeruerer qerueerr qerueerr qereerur qereerru qereeurr qereeurr qereerur
qereerru qerereur qerereru qereruer qererure qererrue qererreu qereurer qereurre qereuerr qereuerr
qereurer qereurre qererrue qererreu qererure qereruer qerereur qerereru qrerereu qrererue qrereeru
qrereeur qrereuer qrereure qrerreeu qrerreue qrerreeu qrerreue qrerruee qrerruee qrerereu qrererue
qrereeru qrereeur qrereuer qrereure qreruree qreruree qreruere qrerueer qrerueer qreruere qreerreu
qreerrue qreereru qreereur qreeruer qreerure qreerreu qreerrue qreereru qreereur qreeruer qreerure
qreeerru qreeerur qreeerru qreeerur qreeeurr qreeeurr qreeurer qreeurre qreeuerr qreeuerr qreeurer
qreeurre qrerereu qrererue qrereeru qrereeur qrereuer qrereure qrerreeu qrerreue qrerreeu qrerreue
qrerruee qrerruee qrerereu qrererue qrereeru qrereeur qrereuer qrereure qreruree qreruree qreruere
qrerueer qrerueer qreruere qreeerru qreeerur qreeerru qreeerur qreeeurr qreeeurr qreereru qreereur
qreerreu qreerrue qreerure qreeruer qreerreu qreerrue qreereru qreereur qreeruer qreerure qreeurre
qreeurer qreeurre qreeurer qreeuerr qreeuerr qreuerer qreuerre qreueerr qreueerr qreuerer qreuerre
qreureer qreurere qreureer qreurere qreurree qreurree qreuerer qreuerre qreueerr qreueerr qreuerer
qreuerre qreurree qreurree qreurere qreureer qreureer qreurere qrreereu qrreerue qrreeeru qrreeeur
qrreeuer qrreeure qrrereeu qrrereue qrrereeu qrrereue qrreruee qrreruee qrreereu qrreerue qrreeeru
qrreeeur qrreeuer qrreeure qrreuree qrreuree qrreuere qrreueer qrreueer qrreuere qrreereu qrreerue
qrreeeru qrreeeur qrreeuer qrreeure qrrereeu qrrereue qrrereeu qrrereue qrreruee qrreruee qrreereu
qrreerue qrreeeru qrreeeur qrreeuer qrreeure qrreuree qrreuree qrreuere qrreueer qrreueer qrreuere
qrrreeeu qrrreeue qrrreeeu qrrreeue qrrreuee qrrreuee qrrreeeu qrrreeue qrrreeeu qrrreeue qrrreuee
qrrreuee qrrreeeu qrrreeue qrrreeeu qrrreeue qrrreuee qrrreuee qrrrueee qrrrueee qrrrueee qrrrueee
qrrrueee qrrrueee qrreereu qrreerue qrreeeru qrreeeur qrreeuer qrreeure qrrereeu qrrereue qrrereeu
qrrereue qrreruee qrreruee qrreereu qrreerue qrreeeru qrreeeur qrreeuer qrreeure qrreuree qrreuree
qrreuere qrreueer qrreueer qrreuere qrrueree qrrueree qrrueere qrrueeer qrrueeer qrrueere qrrureee
qrrureee qrrureee qrrureee qrrureee qrrureee qrrueree qrrueree qrrueere qrrueeer qrrueeer qrrueere
qrrueree qrrueree qrrueere qrrueeer qrrueeer qrrueere qrerereu qrererue qrereeru qrereeur qrereuer
qrereure qrerreeu qrerreue qrerreeu qrerreue qrerruee qrerruee qrerereu qrererue qrereeru qrereeur
qrereuer qrereure qreruree qreruree qreruere qrerueer qrerueer qreruere qreerreu qreerrue qreereru
qreereur qreeruer qreerure qreerreu qreerrue qreereru qreereur qreeruer qreerure qreeerru qreeerur
qreeerru qreeerur qreeeurr qreeeurr qreeurer qreeurre qreeuerr qreeuerr qreeurer qreeurre qrerereu
qrererue qrereeru qrereeur qrereuer qrereure qrerreeu qrerreue qrerreeu qrerreue qrerruee qrerruee
qrerereu qrererue qrereeru qrereeur qrereuer qrereure qreruree qreruree qreruere qrerueer qrerueer
qreruere qreeerru qreeerur qreeerru qreeerur qreeeurr qreeeurr qreereru qreereur qreerreu qreerrue
qreerure qreeruer qreerreu qreerrue qreereru qreereur qreeruer qreerure qreeurre qreeurer qreeurre
qreeurer qreeuerr qreeuerr qreuerer qreuerre qreueerr qreueerr qreuerer qreuerre qreureer qreurere
qreureer qreurere qreurree qreurree qreuerer qreuerre qreueerr qreueerr qreuerer qreuerre qreurree
qreurree qreurere qreureer qreureer qreurere qrrreeeu qrrreeue qrrreeeu qrrreeue qrrreuee qrrreuee
qrrreeeu qrrreeue qrrreeeu qrrreeue qrrreuee qrrreuee qrrreeeu qrrreeue qrrreeeu qrrreeue qrrreuee
qrrreuee qrrrueee qrrrueee qrrrueee qrrrueee qrrrueee qrrrueee qrrereeu qrrereue qrrereeu qrrereue
qrreruee qrreruee qrreereu qrreerue qrreeeru qrreeeur qrreeuer qrreeure qrreeeru qrreeeur qrreereu
qrreerue qrreeure qrreeuer qrreueer qrreuere qrreueer qrreuere qrreuree qrreuree qrreereu qrreerue
qrreeeru qrreeeur qrreeuer qrreeure qrrereeu qrrereue qrrereeu qrrereue qrreruee qrreruee qrreereu
qrreerue qrreeeru qrreeeur qrreeuer qrreeure qrreuree qrreuree qrreuere qrreueer qrreueer qrreuere
qrreeeru qrreeeur qrreereu qrreerue qrreeure qrreeuer qrreeeru qrreeeur qrreereu qrreerue qrreeure
qrreeuer qrrereeu qrrereue qrrereeu qrrereue qrreruee qrreruee qrreuere qrreueer qrreuree qrreuree
qrreuere qrreueer qrrueeer qrrueere qrrueeer qrrueere qrrueree qrrueree qrrueeer qrrueere qrrueeer
qrrueere qrrueree qrrueree qrrueeer qrrueere qrrueeer qrrueere qrrueree qrrueree qrrureee qrrureee
qrrureee qrrureee qrrureee qrrureee qrerereu qrererue qrereeru qrereeur qrereuer qrereure qrerreeu
qrerreue qrerreeu qrerreue qrerruee qrerruee qrerereu qrererue qrereeru qrereeur qrereuer qrereure
qreruree qreruree qreruere qrerueer qrerueer qreruere qreerreu qreerrue qreereru qreereur qreeruer
qreerure qreerreu qreerrue qreereru qreereur qreeruer qreerure qreeerru qreeerur qreeerru qreeerur
qreeeurr qreeeurr qreeurer qreeurre qreeuerr qreeuerr qreeurer qreeurre qrerereu qrererue qrereeru
qrereeur qrereuer qrereure qrerreeu qrerreue qrerreeu qrerreue qrerruee qrerruee qrerereu qrererue
qrereeru qrereeur qrereuer qrereure qreruree qreruree qreruere qrerueer qrerueer qreruere qreeerru
qreeerur qreeerru qreeerur qreeeurr qreeeurr qreereru qreereur qreerreu qreerrue qreerure qreeruer
qreerreu qreerrue qreereru qreereur qreeruer qreerure qreeurre qreeurer qreeurre qreeurer qreeuerr
qreeuerr qreuerer qreuerre qreueerr qreueerr qreuerer qreuerre qreureer qreurere qreureer qreurere
qreurree qreurree qreuerer qreuerre qreueerr qreueerr qreuerer qreuerre qreurree qreurree qreurere
qreureer qreureer qreurere qrureree qrureree qrureere qrureeer qrureeer qrureere qrurreee qrurreee
qrurreee qrurreee qrurreee qrurreee qrureree qrureree qrureere qrureeer qrureeer qrureere qrureree
qrureree qrureere qrureeer qrureeer qrureere qruerree qruerree qruerere qruereer qruereer qruerere
qruerree qruerree qruerere qruereer qruereer qruerere qrueerre qrueerer qrueerre qrueerer qrueeerr
qrueeerr qrueerer qrueerre qrueeerr qrueeerr qrueerer qrueerre qrureree qrureree qrureere qrureeer
qrureeer qrureere qrurreee qrurreee qrurreee qrurreee qrurreee qrurreee qrureree qrureree qrureere
qrureeer qrureeer qrureere qrureree qrureree qrureere qrureeer qrureeer qrureere qrueerre qrueerer
qrueerre qrueerer qrueeerr qrueeerr qruerere qruereer qruerree qruerree qruerere qruereer qruerree
qruerree qruerere qruereer qruereer qruerere qrueerre qrueerer qrueerre qrueerer qrueeerr qrueeerr
qrueerer qrueerre qrueeerr qrueeerr qrueerer qrueerre qruereer qruerere qruereer qruerere qruerree
qruerree qrueerer qrueerre qrueeerr qrueeerr qrueerer qrueerre qruerree qruerree qruerere qruereer
qruereer qruerere

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us