easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

economizes

brachycnemic

dongiovanni

cycloidally

sniveling

readingcenter

roser

brushproof

gloryless

sigil

automatonlike

aftersend

badawi

praetexatisque

accesserit

unpartisan

mouching

excommunicable


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: prigger
cipher variations:
qsjhhfs rtkiigt suljjhu tvmkkiv uwnlljw
vxommkx wypnnly xzqoomz yarppna zbsqqob
actrrpc bdussqd cevttre dfwuusf egxvvtg
fhywwuh gizxxvi hjayywj ikbzzxk jlcaayl
kmdbbzm lneccan mofddbo npgeecp oqhffdq

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: prigger
Cipher: kirttvi

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: prigger
Cipher: ABBBA BAAAA ABAAA AABBA AABBA AABAA BAAAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: prigger
cipher variations:
qsjhhfsuazttnayipffvicqfrrdqgyvddlykglpptgswrnnjwwehzzre
amxllzmeunxxhuicdjjpcmktvvxkrtkiigtvbauuobzjqggwjdrgsser
hzweemzlhmqquhtxsookxxfiaasfbnymmanfvoyyivjdekkqdnluwwyl
suljjhuwcbvvpcakrhhxkeshttfsiaxffnaminrrviuytpplyygjbbtg
coznnbogwpzzjwkefllreomvxxzmtvmkkivxdcwwqdblsiiylftiuugt
jbyggobnjosswjvzuqqmzzhkccuhdpaoocphxqaakxlfgmmsfpnwyyan
uwnlljwyedxxrecmtjjzmgujvvhukczhhpcokpttxkwavrrnaailddvi
eqbppdqiyrbblymghnntgqoxzzbovxommkxzfeyysfdnukkanhvkwwiv
ldaiiqdplquuylxbwssobbjmeewjfrcqqerjzsccmznhioouhrpyaacp
wypnnlyagfzztgeovllboiwlxxjwmebjjreqmrvvzmycxttpccknffxk
gsdrrfskatddnaoijppvisqzbbdqxzqoomzbhgaauhfpwmmcpjxmyykx
nfckksfrnswwanzdyuuqddloggylhtessgtlbueeobpjkqqwjtraccer
yarppnacihbbvigqxnndqkynzzlyogdlltgsotxxboaezvvreemphhzm
iuftthumcvffpcqklrrxkusbddfszbsqqobdjiccwjhryooerlzoaamz
phemmuhtpuyycpbfawwsffnqiianjvguuivndwggqdrlmssylvtceegt
actrrpcekjddxkiszppfsmapbbnaqifnnviuqvzzdqcgbxxtggorjjbo
kwhvvjwoexhhresmnttzmwudffhubdussqdflkeeyljtaqqgtnbqccob
rjgoowjvrwaaerdhcyyuhhpskkcplxiwwkxpfyiisftnouuanxveggiv
cevttregmlffzmkubrrhuocrddpcskhppxkwsxbbfseidzzviiqtlldq
myjxxlyqgzjjtguopvvboywfhhjwdfwuusfhnmgganlvcssivpdseeqd
tliqqylxtyccgtfjeaawjjrummernzkyymzrhakkuhvpqwwcpzxgiikx
egxvvtgionhhbomwdttjwqetffreumjrrzmyuzddhugkfbbxkksvnnfs
oalzznasibllviwqrxxdqayhjjlyfhywwuhjpoiicpnxeuukxrfuggsf
vnkssanzvaeeivhlgccylltwoogtpbmaaobtjcmmwjxrsyyerbzikkmz
gizxxvikqpjjdqoyfvvlysgvhhtgwolttboawbffjwimhddzmmuxpphu
qcnbbpcukdnnxkystzzfscajllnahjayywjlrqkkerpzgwwmzthwiiuh
xpmuucpbxcggkxjnieeannvyqqivrdoccqdvleooylztuaagtdbkmmob
ikbzzxkmsrllfsqahxxnauixjjviyqnvvdqcydhhlykojffboowzrrjw
sepddrewmfppzmauvbbhueclnnpcjlcaaylntsmmgtrbiyyobvjykkwj
zrowwerdzeiimzlpkggcppxasskxtfqeesfxngqqanbvwccivfdmooqd
kmdbbzmoutnnhuscjzzpcwkzllxkaspxxfseafjjnamqlhhdqqybttly
ugrfftgyohrrbocwxddjwgenpprelneccanpvuooivtdkaaqdxlammyl
btqyygtfbgkkobnrmiierrzcuumzvhsgguhzpisscpdxyeekxhfoqqsf
mofddboqwvppjwuelbbreymbnnzmcurzzhugchllpcosnjjfssadvvna
withhviaqjttdqeyzfflyigprrtgnpgeecprxwqqkxvfmccsfzncooan
dvsaaivhdimmqdptokkgttbewwobxjuiiwjbrkuuerfzaggmzjhqssuh
oqhffdqsyxrrlywgnddtgaodppboewtbbjwiejnnrequpllhuucfxxpc
ykvjjxkcslvvfsgabhhnakirttvipriggertzyssmzxhoeeuhbpeqqcp
fxucckxjfkoosfrvqmmivvdgyyqdzlwkkyldtmwwgthbciiobljsuuwj

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: prigger
Cipher: cevttre

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: prigger
Cipher: 53244222225124

Extended Methods:
Method #1

Plaintext: prigger
method variations:
uwommkwzbtrrpbegywwugkmdbbzm

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
p r i g g e r 
5 2 4 2 2 5 2 
3 4 2 2 2 1 4 
They are then read out in rows:
52422523422214
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: prigger
Cipher: kiwmigq

Read more ...
Method #3

Plaintext: prigger
method variations:
htggwfy tggwfyh ggwfyht
gwfyhtg wfyhtgg fyhtggw
yhtggwf

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: prigger

all 5040 cipher variations:
prigger priggre prigegr prigerg prigreg prigrge prigger priggre prigegr prigerg prigreg
prigrge prieggr priegrg prieggr priegrg priergg priergg prirgeg prirgge priregg priregg
prirgeg prirgge prgiger prgigre prgiegr prgierg prgireg prgirge prggier prggire prggeir
prggeri prggrei prggrie prgegir prgegri prgeigr prgeirg prgerig prgergi prgrgei prgrgie
prgregi prgreig prgrieg prgrige prggier prggire prggeir prggeri prggrei prggrie prgiger
prgigre prgiegr prgierg prgireg prgirge prgeigr prgeirg prgegir prgegri prgergi prgerig
prgrieg prgrige prgreig prgregi prgrgei prgrgie preggir preggri pregigr pregirg pregrig
pregrgi preggir preggri pregigr pregirg pregrig pregrgi preiggr preigrg preiggr preigrg
preirgg preirgg prergig prerggi prerigg prerigg prergig prerggi prrggei prrggie prrgegi
prrgeig prrgieg prrgige prrggei prrggie prrgegi prrgeig prrgieg prrgige prreggi prregig
prreggi prregig prreigg prreigg prrigeg prrigge prriegg prriegg prrigeg prrigge pirgger
pirggre pirgegr pirgerg pirgreg pirgrge pirgger pirggre pirgegr pirgerg pirgreg pirgrge
pireggr piregrg pireggr piregrg pirergg pirergg pirrgeg pirrgge pirregg pirregg pirrgeg
pirrgge pigrger pigrgre pigregr pigrerg pigrreg pigrrge piggrer piggrre piggerr piggerr
piggrer piggrre pigegrr pigegrr pigergr pigerrg pigerrg pigergr pigrger pigrgre pigregr
pigrerg pigrreg pigrrge piggrer piggrre piggerr piggerr piggrer piggrre pigrger pigrgre
pigregr pigrerg pigrreg pigrrge pigergr pigerrg pigegrr pigegrr pigergr pigerrg pigrreg
pigrrge pigrerg pigregr pigrger pigrgre pieggrr pieggrr piegrgr piegrrg piegrrg piegrgr
pieggrr pieggrr piegrgr piegrrg piegrrg piegrgr pierggr piergrg pierggr piergrg pierrgg
pierrgg piergrg pierggr pierrgg pierrgg piergrg pierggr pirgger pirggre pirgegr pirgerg
pirgreg pirgrge pirgger pirggre pirgegr pirgerg pirgreg pirgrge pireggr piregrg pireggr
piregrg pirergg pirergg pirrgeg pirrgge pirregg pirregg pirrgeg pirrgge pgirger pgirgre
pgiregr pgirerg pgirreg pgirrge pgigrer pgigrre pgigerr pgigerr pgigrer pgigrre pgiegrr
pgiegrr pgiergr pgierrg pgierrg pgiergr pgirger pgirgre pgiregr pgirerg pgirreg pgirrge
pgriger pgrigre pgriegr pgrierg pgrireg pgrirge pgrgier pgrgire pgrgeir pgrgeri pgrgrei
pgrgrie pgregir pgregri pgreigr pgreirg pgrerig pgrergi pgrrgei pgrrgie pgrregi pgrreig
pgrrieg pgrrige pggrier pggrire pggreir pggreri pggrrei pggrrie pggirer pggirre pggierr
pggierr pggirer pggirre pggeirr pggeirr pggerir pggerri pggerri pggerir pggrier pggrire
pggreir pggreri pggrrei pggrrie pgergir pgergri pgerigr pgerirg pgerrig pgerrgi pgegrir
pgegrri pgegirr pgegirr pgegrir pgegrri pgeigrr pgeigrr pgeirgr pgeirrg pgeirrg pgeirgr
pgergir pgergri pgerigr pgerirg pgerrig pgerrgi pgrrgei pgrrgie pgrregi pgrreig pgrrieg
pgrrige pgrgrei pgrgrie pgrgeri pgrgeir pgrgier pgrgire pgregri pgregir pgrergi pgrerig
pgreirg pgreigr pgriger pgrigre pgriegr pgrierg pgrireg pgrirge pgigrer pgigrre pgigerr
pgigerr pgigrer pgigrre pgirger pgirgre pgiregr pgirerg pgirreg pgirrge pgiergr pgierrg
pgiegrr pgiegrr pgiergr pgierrg pgirreg pgirrge pgirerg pgiregr pgirger pgirgre pggirer
pggirre pggierr pggierr pggirer pggirre pggrier pggrire pggreir pggreri pggrrei pggrrie
pggerir pggerri pggeirr pggeirr pggerir pggerri pggrrei pggrrie pggreri pggreir pggrier
pggrire pgrgier pgrgire pgrgeir pgrgeri pgrgrei pgrgrie pgriger pgrigre pgriegr pgrierg
pgrireg pgrirge pgreigr pgreirg pgregir pgregri pgrergi pgrerig pgrrieg pgrrige pgrreig
pgrregi pgrrgei pgrrgie pgegrir pgegrri pgegirr pgegirr pgegrir pgegrri pgergir pgergri
pgerigr pgerirg pgerrig pgerrgi pgeirgr pgeirrg pgeigrr pgeigrr pgeirgr pgeirrg pgerrig
pgerrgi pgerirg pgerigr pgergir pgergri pgrgrei pgrgrie pgrgeri pgrgeir pgrgier pgrgire
pgrrgei pgrrgie pgrregi pgrreig pgrrieg pgrrige pgrergi pgrerig pgregri pgregir pgreigr
pgreirg pgrireg pgrirge pgrierg pgriegr pgriger pgrigre peiggrr peiggrr peigrgr peigrrg
peigrrg peigrgr peiggrr peiggrr peigrgr peigrrg peigrrg peigrgr peirggr peirgrg peirggr
peirgrg peirrgg peirrgg peirgrg peirggr peirrgg peirrgg peirgrg peirggr pegigrr pegigrr
pegirgr pegirrg pegirrg pegirgr peggirr peggirr peggrir peggrri peggrri peggrir pegrgir
pegrgri pegrigr pegrirg pegrrig pegrrgi pegrgri pegrgir pegrrgi pegrrig pegrirg pegrigr
peggirr peggirr peggrir peggrri peggrri peggrir pegigrr pegigrr pegirgr pegirrg pegirrg
pegirgr pegrigr pegrirg pegrgir pegrgri pegrrgi pegrrig pegrirg pegrigr pegrrig pegrrgi
pegrgri pegrgir perggir perggri pergigr pergirg pergrig pergrgi perggir perggri pergigr
pergirg pergrig pergrgi periggr perigrg periggr perigrg perirgg perirgg perrgig perrggi
perrigg perrigg perrgig perrggi perggri perggir pergrgi pergrig pergirg pergigr perggri
perggir pergrgi pergrig pergirg pergigr perrggi perrgig perrggi perrgig perrigg perrigg
perigrg periggr perirgg perirgg perigrg periggr prigger priggre prigegr prigerg prigreg
prigrge prigger priggre prigegr prigerg prigreg prigrge prieggr priegrg prieggr priegrg
priergg priergg prirgeg prirgge priregg priregg prirgeg prirgge prgiger prgigre prgiegr
prgierg prgireg prgirge prggier prggire prggeir prggeri prggrei prggrie prgegir prgegri
prgeigr prgeirg prgerig prgergi prgrgei prgrgie prgregi prgreig prgrieg prgrige prggier
prggire prggeir prggeri prggrei prggrie prgiger prgigre prgiegr prgierg prgireg prgirge
prgeigr prgeirg prgegir prgegri prgergi prgerig prgrieg prgrige prgreig prgregi prgrgei
prgrgie preggir preggri pregigr pregirg pregrig pregrgi preggir preggri pregigr pregirg
pregrig pregrgi preiggr preigrg preiggr preigrg preirgg preirgg prergig prerggi prerigg
prerigg prergig prerggi prrggei prrggie prrgegi prrgeig prrgieg prrgige prrggei prrggie
prrgegi prrgeig prrgieg prrgige prreggi prregig prreggi prregig prreigg prreigg prrigeg
prrigge prriegg prriegg prrigeg prrigge rpigger rpiggre rpigegr rpigerg rpigreg rpigrge
rpigger rpiggre rpigegr rpigerg rpigreg rpigrge rpieggr rpiegrg rpieggr rpiegrg rpiergg
rpiergg rpirgeg rpirgge rpiregg rpiregg rpirgeg rpirgge rpgiger rpgigre rpgiegr rpgierg
rpgireg rpgirge rpggier rpggire rpggeir rpggeri rpggrei rpggrie rpgegir rpgegri rpgeigr
rpgeirg rpgerig rpgergi rpgrgei rpgrgie rpgregi rpgreig rpgrieg rpgrige rpggier rpggire
rpggeir rpggeri rpggrei rpggrie rpgiger rpgigre rpgiegr rpgierg rpgireg rpgirge rpgeigr
rpgeirg rpgegir rpgegri rpgergi rpgerig rpgrieg rpgrige rpgreig rpgregi rpgrgei rpgrgie
rpeggir rpeggri rpegigr rpegirg rpegrig rpegrgi rpeggir rpeggri rpegigr rpegirg rpegrig
rpegrgi rpeiggr rpeigrg rpeiggr rpeigrg rpeirgg rpeirgg rpergig rperggi rperigg rperigg
rpergig rperggi rprggei rprggie rprgegi rprgeig rprgieg rprgige rprggei rprggie rprgegi
rprgeig rprgieg rprgige rpreggi rpregig rpreggi rpregig rpreigg rpreigg rprigeg rprigge
rpriegg rpriegg rprigeg rprigge ripgger ripggre ripgegr ripgerg ripgreg ripgrge ripgger
ripggre ripgegr ripgerg ripgreg ripgrge ripeggr ripegrg ripeggr ripegrg ripergg ripergg
riprgeg riprgge ripregg ripregg riprgeg riprgge rigpger rigpgre rigpegr rigperg rigpreg
rigprge riggper riggpre riggepr riggerp riggrep riggrpe rigegpr rigegrp rigepgr rigeprg
rigerpg rigergp rigrgep rigrgpe rigregp rigrepg rigrpeg rigrpge riggper riggpre riggepr
riggerp riggrep riggrpe rigpger rigpgre rigpegr rigperg rigpreg rigprge rigepgr rigeprg
rigegpr rigegrp rigergp rigerpg rigrpeg rigrpge rigrepg rigregp rigrgep rigrgpe rieggpr
rieggrp riegpgr riegprg riegrpg riegrgp rieggpr rieggrp riegpgr riegprg riegrpg riegrgp
riepggr riepgrg riepggr riepgrg rieprgg rieprgg riergpg rierggp rierpgg rierpgg riergpg
rierggp rirggep rirggpe rirgegp rirgepg rirgpeg rirgpge rirggep rirggpe rirgegp rirgepg
rirgpeg rirgpge rireggp riregpg rireggp riregpg rirepgg rirepgg rirpgeg rirpgge rirpegg
rirpegg rirpgeg rirpgge rgipger rgipgre rgipegr rgiperg rgipreg rgiprge rgigper rgigpre
rgigepr rgigerp rgigrep rgigrpe rgiegpr rgiegrp rgiepgr rgieprg rgierpg rgiergp rgirgep
rgirgpe rgiregp rgirepg rgirpeg rgirpge rgpiger rgpigre rgpiegr rgpierg rgpireg rgpirge
rgpgier rgpgire rgpgeir rgpgeri rgpgrei rgpgrie rgpegir rgpegri rgpeigr rgpeirg rgperig
rgpergi rgprgei rgprgie rgpregi rgpreig rgprieg rgprige rggpier rggpire rggpeir rggperi
rggprei rggprie rggiper rggipre rggiepr rggierp rggirep rggirpe rggeipr rggeirp rggepir
rggepri rggerpi rggerip rggriep rggripe rggreip rggrepi rggrpei rggrpie rgepgir rgepgri
rgepigr rgepirg rgeprig rgeprgi rgegpir rgegpri rgegipr rgegirp rgegrip rgegrpi rgeigpr
rgeigrp rgeipgr rgeiprg rgeirpg rgeirgp rgergip rgergpi rgerigp rgeripg rgerpig rgerpgi
rgrpgei rgrpgie rgrpegi rgrpeig rgrpieg rgrpige rgrgpei rgrgpie rgrgepi rgrgeip rgrgiep
rgrgipe rgregpi rgregip rgrepgi rgrepig rgreipg rgreigp rgrigep rgrigpe rgriegp rgriepg
rgripeg rgripge rgigper rgigpre rgigepr rgigerp rgigrep rgigrpe rgipger rgipgre rgipegr
rgiperg rgipreg rgiprge rgiepgr rgieprg rgiegpr rgiegrp rgiergp rgierpg rgirpeg rgirpge
rgirepg rgiregp rgirgep rgirgpe rggiper rggipre rggiepr rggierp rggirep rggirpe rggpier
rggpire rggpeir rggperi rggprei rggprie rggepir rggepri rggeipr rggeirp rggerip rggerpi
rggrpei rggrpie rggrepi rggreip rggriep rggripe rgpgier rgpgire rgpgeir rgpgeri rgpgrei
rgpgrie rgpiger rgpigre rgpiegr rgpierg rgpireg rgpirge rgpeigr rgpeirg rgpegir rgpegri
rgpergi rgperig rgprieg rgprige rgpreig rgpregi rgprgei rgprgie rgegpir rgegpri rgegipr
rgegirp rgegrip rgegrpi rgepgir rgepgri rgepigr rgepirg rgeprig rgeprgi rgeipgr rgeiprg
rgeigpr rgeigrp rgeirgp rgeirpg rgerpig rgerpgi rgeripg rgerigp rgergip rgergpi rgrgpei
rgrgpie rgrgepi rgrgeip rgrgiep rgrgipe rgrpgei rgrpgie rgrpegi rgrpeig rgrpieg rgrpige
rgrepgi rgrepig rgregpi rgregip rgreigp rgreipg rgripeg rgripge rgriepg rgriegp rgrigep
rgrigpe reiggpr reiggrp reigpgr reigprg reigrpg reigrgp reiggpr reiggrp reigpgr reigprg
reigrpg reigrgp reipggr reipgrg reipggr reipgrg reiprgg reiprgg reirgpg reirggp reirpgg
reirpgg reirgpg reirggp regigpr regigrp regipgr regiprg regirpg regirgp reggipr reggirp
reggpir reggpri reggrpi reggrip regpgir regpgri regpigr regpirg regprig regprgi regrgpi
regrgip regrpgi regrpig regripg regrigp reggipr reggirp reggpir reggpri reggrpi reggrip
regigpr regigrp regipgr regiprg regirpg regirgp regpigr regpirg regpgir regpgri regprgi
regprig regripg regrigp regrpig regrpgi regrgpi regrgip repggir repggri repgigr repgirg
repgrig repgrgi repggir repggri repgigr repgirg repgrig repgrgi repiggr repigrg repiggr
repigrg repirgg repirgg reprgig reprggi reprigg reprigg reprgig reprggi rerggpi rerggip
rergpgi rergpig rergipg rergigp rerggpi rerggip rergpgi rergpig rergipg rergigp rerpggi
rerpgig rerpggi rerpgig rerpigg rerpigg rerigpg reriggp reripgg reripgg rerigpg reriggp
rriggep rriggpe rrigegp rrigepg rrigpeg rrigpge rriggep rriggpe rrigegp rrigepg rrigpeg
rrigpge rrieggp rriegpg rrieggp rriegpg rriepgg rriepgg rripgeg rripgge rripegg rripegg
rripgeg rripgge rrgigep rrgigpe rrgiegp rrgiepg rrgipeg rrgipge rrggiep rrggipe rrggeip
rrggepi rrggpei rrggpie rrgegip rrgegpi rrgeigp rrgeipg rrgepig rrgepgi rrgpgei rrgpgie
rrgpegi rrgpeig rrgpieg rrgpige rrggiep rrggipe rrggeip rrggepi rrggpei rrggpie rrgigep
rrgigpe rrgiegp rrgiepg rrgipeg rrgipge rrgeigp rrgeipg rrgegip rrgegpi rrgepgi rrgepig
rrgpieg rrgpige rrgpeig rrgpegi rrgpgei rrgpgie rreggip rreggpi rregigp rregipg rregpig
rregpgi rreggip rreggpi rregigp rregipg rregpig rregpgi rreiggp rreigpg rreiggp rreigpg
rreipgg rreipgg rrepgig rrepggi rrepigg rrepigg rrepgig rrepggi rrpggei rrpggie rrpgegi
rrpgeig rrpgieg rrpgige rrpggei rrpggie rrpgegi rrpgeig rrpgieg rrpgige rrpeggi rrpegig
rrpeggi rrpegig rrpeigg rrpeigg rrpigeg rrpigge rrpiegg rrpiegg rrpigeg rrpigge irpgger
irpggre irpgegr irpgerg irpgreg irpgrge irpgger irpggre irpgegr irpgerg irpgreg irpgrge
irpeggr irpegrg irpeggr irpegrg irpergg irpergg irprgeg irprgge irpregg irpregg irprgeg
irprgge irgpger irgpgre irgpegr irgperg irgpreg irgprge irggper irggpre irggepr irggerp
irggrep irggrpe irgegpr irgegrp irgepgr irgeprg irgerpg irgergp irgrgep irgrgpe irgregp
irgrepg irgrpeg irgrpge irggper irggpre irggepr irggerp irggrep irggrpe irgpger irgpgre
irgpegr irgperg irgpreg irgprge irgepgr irgeprg irgegpr irgegrp irgergp irgerpg irgrpeg
irgrpge irgrepg irgregp irgrgep irgrgpe ireggpr ireggrp iregpgr iregprg iregrpg iregrgp
ireggpr ireggrp iregpgr iregprg iregrpg iregrgp irepggr irepgrg irepggr irepgrg ireprgg
ireprgg irergpg irerggp irerpgg irerpgg irergpg irerggp irrggep irrggpe irrgegp irrgepg
irrgpeg irrgpge irrggep irrggpe irrgegp irrgepg irrgpeg irrgpge irreggp irregpg irreggp
irregpg irrepgg irrepgg irrpgeg irrpgge irrpegg irrpegg irrpgeg irrpgge iprgger iprggre
iprgegr iprgerg iprgreg iprgrge iprgger iprggre iprgegr iprgerg iprgreg iprgrge ipreggr
ipregrg ipreggr ipregrg iprergg iprergg iprrgeg iprrgge iprregg iprregg iprrgeg iprrgge
ipgrger ipgrgre ipgregr ipgrerg ipgrreg ipgrrge ipggrer ipggrre ipggerr ipggerr ipggrer
ipggrre ipgegrr ipgegrr ipgergr ipgerrg ipgerrg ipgergr ipgrger ipgrgre ipgregr ipgrerg
ipgrreg ipgrrge ipggrer ipggrre ipggerr ipggerr ipggrer ipggrre ipgrger ipgrgre ipgregr
ipgrerg ipgrreg ipgrrge ipgergr ipgerrg ipgegrr ipgegrr ipgergr ipgerrg ipgrreg ipgrrge
ipgrerg ipgregr ipgrger ipgrgre ipeggrr ipeggrr ipegrgr ipegrrg ipegrrg ipegrgr ipeggrr
ipeggrr ipegrgr ipegrrg ipegrrg ipegrgr iperggr ipergrg iperggr ipergrg iperrgg iperrgg
ipergrg iperggr iperrgg iperrgg ipergrg iperggr iprgger iprggre iprgegr iprgerg iprgreg
iprgrge iprgger iprggre iprgegr iprgerg iprgreg iprgrge ipreggr ipregrg ipreggr ipregrg
iprergg iprergg iprrgeg iprrgge iprregg iprregg iprrgeg iprrgge igprger igprgre igpregr
igprerg igprreg igprrge igpgrer igpgrre igpgerr igpgerr igpgrer igpgrre igpegrr igpegrr
igpergr igperrg igperrg igpergr igprger igprgre igpregr igprerg igprreg igprrge igrpger
igrpgre igrpegr igrperg igrpreg igrprge igrgper igrgpre igrgepr igrgerp igrgrep igrgrpe
igregpr igregrp igrepgr igreprg igrerpg igrergp igrrgep igrrgpe igrregp igrrepg igrrpeg
igrrpge iggrper iggrpre iggrepr iggrerp iggrrep iggrrpe iggprer iggprre iggperr iggperr
iggprer iggprre iggeprr iggeprr iggerpr iggerrp iggerrp iggerpr iggrper iggrpre iggrepr
iggrerp iggrrep iggrrpe igergpr igergrp igerpgr igerprg igerrpg igerrgp igegrpr igegrrp
igegprr igegprr igegrpr igegrrp igepgrr igepgrr igeprgr igeprrg igeprrg igeprgr igergpr
igergrp igerpgr igerprg igerrpg igerrgp igrrgep igrrgpe igrregp igrrepg igrrpeg igrrpge
igrgrep igrgrpe igrgerp igrgepr igrgper igrgpre igregrp igregpr igrergp igrerpg igreprg
igrepgr igrpger igrpgre igrpegr igrperg igrpreg igrprge igpgrer igpgrre igpgerr igpgerr
igpgrer igpgrre igprger igprgre igpregr igprerg igprreg igprrge igpergr igperrg igpegrr
igpegrr igpergr igperrg igprreg igprrge igprerg igpregr igprger igprgre iggprer iggprre
iggperr iggperr iggprer iggprre iggrper iggrpre iggrepr iggrerp iggrrep iggrrpe iggerpr
iggerrp iggeprr iggeprr iggerpr iggerrp iggrrep iggrrpe iggrerp iggrepr iggrper iggrpre
igrgper igrgpre igrgepr igrgerp igrgrep igrgrpe igrpger igrpgre igrpegr igrperg igrpreg
igrprge igrepgr igreprg igregpr igregrp igrergp igrerpg igrrpeg igrrpge igrrepg igrregp
igrrgep igrrgpe igegrpr igegrrp igegprr igegprr igegrpr igegrrp igergpr igergrp igerpgr
igerprg igerrpg igerrgp igeprgr igeprrg igepgrr igepgrr igeprgr igeprrg igerrpg igerrgp
igerprg igerpgr igergpr igergrp igrgrep igrgrpe igrgerp igrgepr igrgper igrgpre igrrgep
igrrgpe igrregp igrrepg igrrpeg igrrpge igrergp igrerpg igregrp igregpr igrepgr igreprg
igrpreg igrprge igrperg igrpegr igrpger igrpgre iepggrr iepggrr iepgrgr iepgrrg iepgrrg
iepgrgr iepggrr iepggrr iepgrgr iepgrrg iepgrrg iepgrgr ieprggr ieprgrg ieprggr ieprgrg
ieprrgg ieprrgg ieprgrg ieprggr ieprrgg ieprrgg ieprgrg ieprggr iegpgrr iegpgrr iegprgr
iegprrg iegprrg iegprgr ieggprr ieggprr ieggrpr ieggrrp ieggrrp ieggrpr iegrgpr iegrgrp
iegrpgr iegrprg iegrrpg iegrrgp iegrgrp iegrgpr iegrrgp iegrrpg iegrprg iegrpgr ieggprr
ieggprr ieggrpr ieggrrp ieggrrp ieggrpr iegpgrr iegpgrr iegprgr iegprrg iegprrg iegprgr
iegrpgr iegrprg iegrgpr iegrgrp iegrrgp iegrrpg iegrprg iegrpgr iegrrpg iegrrgp iegrgrp
iegrgpr ierggpr ierggrp iergpgr iergprg iergrpg iergrgp ierggpr ierggrp iergpgr iergprg
iergrpg iergrgp ierpggr ierpgrg ierpggr ierpgrg ierprgg ierprgg ierrgpg ierrggp ierrpgg
ierrpgg ierrgpg ierrggp ierggrp ierggpr iergrgp iergrpg iergprg iergpgr ierggrp ierggpr
iergrgp iergrpg iergprg iergpgr ierrggp ierrgpg ierrggp ierrgpg ierrpgg ierrpgg ierpgrg
ierpggr ierprgg ierprgg ierpgrg ierpggr irpgger irpggre irpgegr irpgerg irpgreg irpgrge
irpgger irpggre irpgegr irpgerg irpgreg irpgrge irpeggr irpegrg irpeggr irpegrg irpergg
irpergg irprgeg irprgge irpregg irpregg irprgeg irprgge irgpger irgpgre irgpegr irgperg
irgpreg irgprge irggper irggpre irggepr irggerp irggrep irggrpe irgegpr irgegrp irgepgr
irgeprg irgerpg irgergp irgrgep irgrgpe irgregp irgrepg irgrpeg irgrpge irggper irggpre
irggepr irggerp irggrep irggrpe irgpger irgpgre irgpegr irgperg irgpreg irgprge irgepgr
irgeprg irgegpr irgegrp irgergp irgerpg irgrpeg irgrpge irgrepg irgregp irgrgep irgrgpe
ireggpr ireggrp iregpgr iregprg iregrpg iregrgp ireggpr ireggrp iregpgr iregprg iregrpg
iregrgp irepggr irepgrg irepggr irepgrg ireprgg ireprgg irergpg irerggp irerpgg irerpgg
irergpg irerggp irrggep irrggpe irrgegp irrgepg irrgpeg irrgpge irrggep irrggpe irrgegp
irrgepg irrgpeg irrgpge irreggp irregpg irreggp irregpg irrepgg irrepgg irrpgeg irrpgge
irrpegg irrpegg irrpgeg irrpgge gripger gripgre gripegr griperg gripreg griprge grigper
grigpre grigepr grigerp grigrep grigrpe griegpr griegrp griepgr grieprg grierpg griergp
grirgep grirgpe griregp grirepg grirpeg grirpge grpiger grpigre grpiegr grpierg grpireg
grpirge grpgier grpgire grpgeir grpgeri grpgrei grpgrie grpegir grpegri grpeigr grpeirg
grperig grpergi grprgei grprgie grpregi grpreig grprieg grprige grgpier grgpire grgpeir
grgperi grgprei grgprie grgiper grgipre grgiepr grgierp grgirep grgirpe grgeipr grgeirp
grgepir grgepri grgerpi grgerip grgriep grgripe grgreip grgrepi grgrpei grgrpie grepgir
grepgri grepigr grepirg greprig greprgi gregpir gregpri gregipr gregirp gregrip gregrpi
greigpr greigrp greipgr greiprg greirpg greirgp grergip grergpi grerigp greripg grerpig
grerpgi grrpgei grrpgie grrpegi grrpeig grrpieg grrpige grrgpei grrgpie grrgepi grrgeip
grrgiep grrgipe grregpi grregip grrepgi grrepig grreipg grreigp grrigep grrigpe grriegp
grriepg grripeg grripge girpger girpgre girpegr girperg girpreg girprge girgper girgpre
girgepr girgerp girgrep girgrpe giregpr giregrp girepgr gireprg girerpg girergp girrgep
girrgpe girregp girrepg girrpeg girrpge giprger giprgre gipregr giprerg giprreg giprrge
gipgrer gipgrre gipgerr gipgerr gipgrer gipgrre gipegrr gipegrr gipergr giperrg giperrg
gipergr giprger giprgre gipregr giprerg giprreg giprrge gigprer gigprre gigperr gigperr
gigprer gigprre gigrper gigrpre gigrepr gigrerp gigrrep gigrrpe gigerpr gigerrp gigeprr
gigeprr gigerpr gigerrp gigrrep gigrrpe gigrerp gigrepr gigrper gigrpre giepgrr giepgrr
gieprgr gieprrg gieprrg gieprgr giegprr giegprr giegrpr giegrrp giegrrp giegrpr giergpr
giergrp gierpgr gierprg gierrpg gierrgp giergrp giergpr gierrgp gierrpg gierprg gierpgr
girpger girpgre girpegr girperg girpreg girprge girgper girgpre girgepr girgerp girgrep
girgrpe giregpr giregrp girepgr gireprg girerpg girergp girrgep girrgpe girregp girrepg
girrpeg girrpge gpirger gpirgre gpiregr gpirerg gpirreg gpirrge gpigrer gpigrre gpigerr
gpigerr gpigrer gpigrre gpiegrr gpiegrr gpiergr gpierrg gpierrg gpiergr gpirger gpirgre
gpiregr gpirerg gpirreg gpirrge gpriger gprigre gpriegr gprierg gprireg gprirge gprgier
gprgire gprgeir gprgeri gprgrei gprgrie gpregir gpregri gpreigr gpreirg gprerig gprergi
gprrgei gprrgie gprregi gprreig gprrieg gprrige gpgrier gpgrire gpgreir gpgreri gpgrrei
gpgrrie gpgirer gpgirre gpgierr gpgierr gpgirer gpgirre gpgeirr gpgeirr gpgerir gpgerri
gpgerri gpgerir gpgrier gpgrire gpgreir gpgreri gpgrrei gpgrrie gpergir gpergri gperigr
gperirg gperrig gperrgi gpegrir gpegrri gpegirr gpegirr gpegrir gpegrri gpeigrr gpeigrr
gpeirgr gpeirrg gpeirrg gpeirgr gpergir gpergri gperigr gperirg gperrig gperrgi gprrgei
gprrgie gprregi gprreig gprrieg gprrige gprgrei gprgrie gprgeri gprgeir gprgier gprgire
gpregri gpregir gprergi gprerig gpreirg gpreigr gpriger gprigre gpriegr gprierg gprireg
gprirge ggiprer ggiprre ggiperr ggiperr ggiprer ggiprre ggirper ggirpre ggirepr ggirerp
ggirrep ggirrpe ggierpr ggierrp ggieprr ggieprr ggierpr ggierrp ggirrep ggirrpe ggirerp
ggirepr ggirper ggirpre ggpirer ggpirre ggpierr ggpierr ggpirer ggpirre ggprier ggprire
ggpreir ggpreri ggprrei ggprrie ggperir ggperri ggpeirr ggpeirr ggperir ggperri ggprrei
ggprrie ggpreri ggpreir ggprier ggprire ggrpier ggrpire ggrpeir ggrperi ggrprei ggrprie
ggriper ggripre ggriepr ggrierp ggrirep ggrirpe ggreipr ggreirp ggrepir ggrepri ggrerpi
ggrerip ggrriep ggrripe ggrreip ggrrepi ggrrpei ggrrpie ggeprir ggeprri ggepirr ggepirr
ggeprir ggeprri ggerpir ggerpri ggeripr ggerirp ggerrip ggerrpi ggeirpr ggeirrp ggeiprr
ggeiprr ggeirpr ggeirrp ggerrip ggerrpi ggerirp ggeripr ggerpir ggerpri ggrprei ggrprie
ggrperi ggrpeir ggrpier ggrpire ggrrpei ggrrpie ggrrepi ggrreip ggrriep ggrripe ggrerpi
ggrerip ggrepri ggrepir ggreipr ggreirp ggrirep ggrirpe ggrierp ggriepr ggriper ggripre
geipgrr geipgrr geiprgr geiprrg geiprrg geiprgr geigprr geigprr geigrpr geigrrp geigrrp
geigrpr geirgpr geirgrp geirpgr geirprg geirrpg geirrgp geirgrp geirgpr geirrgp geirrpg
geirprg geirpgr gepigrr gepigrr gepirgr gepirrg gepirrg gepirgr gepgirr gepgirr gepgrir
gepgrri gepgrri gepgrir geprgir geprgri geprigr geprirg geprrig geprrgi geprgri geprgir
geprrgi geprrig geprirg geprigr gegpirr gegpirr gegprir gegprri gegprri gegprir gegiprr
gegiprr gegirpr gegirrp gegirrp gegirpr gegripr gegrirp gegrpir gegrpri gegrrpi gegrrip
gegrirp gegripr gegrrip gegrrpi gegrpri gegrpir gerpgir gerpgri gerpigr gerpirg gerprig
gerprgi gergpir gergpri gergipr gergirp gergrip gergrpi gerigpr gerigrp geripgr geriprg
gerirpg gerirgp gerrgip gerrgpi gerrigp gerripg gerrpig gerrpgi gerpgri gerpgir gerprgi
gerprig gerpirg gerpigr gergpri gergpir gergrpi gergrip gergirp gergipr gerrgpi gerrgip
gerrpgi gerrpig gerripg gerrigp gerigrp gerigpr gerirgp gerirpg geriprg geripgr gripger
gripgre gripegr griperg gripreg griprge grigper grigpre grigepr grigerp grigrep grigrpe
griegpr griegrp griepgr grieprg grierpg griergp grirgep grirgpe griregp grirepg grirpeg
grirpge grpiger grpigre grpiegr grpierg grpireg grpirge grpgier grpgire grpgeir grpgeri
grpgrei grpgrie grpegir grpegri grpeigr grpeirg grperig grpergi grprgei grprgie grpregi
grpreig grprieg grprige grgpier grgpire grgpeir grgperi grgprei grgprie grgiper grgipre
grgiepr grgierp grgirep grgirpe grgeipr grgeirp grgepir grgepri grgerpi grgerip grgriep
grgripe grgreip grgrepi grgrpei grgrpie grepgir grepgri grepigr grepirg greprig greprgi
gregpir gregpri gregipr gregirp gregrip gregrpi greigpr greigrp greipgr greiprg greirpg
greirgp grergip grergpi grerigp greripg grerpig grerpgi grrpgei grrpgie grrpegi grrpeig
grrpieg grrpige grrgpei grrgpie grrgepi grrgeip grrgiep grrgipe grregpi grregip grrepgi
grrepig grreipg grreigp grrigep grrigpe grriegp grriepg grripeg grripge grigper grigpre
grigepr grigerp grigrep grigrpe gripger gripgre gripegr griperg gripreg griprge griepgr
grieprg griegpr griegrp griergp grierpg grirpeg grirpge grirepg griregp grirgep grirgpe
grgiper grgipre grgiepr grgierp grgirep grgirpe grgpier grgpire grgpeir grgperi grgprei
grgprie grgepir grgepri grgeipr grgeirp grgerip grgerpi grgrpei grgrpie grgrepi grgreip
grgriep grgripe grpgier grpgire grpgeir grpgeri grpgrei grpgrie grpiger grpigre grpiegr
grpierg grpireg grpirge grpeigr grpeirg grpegir grpegri grpergi grperig grprieg grprige
grpreig grpregi grprgei grprgie gregpir gregpri gregipr gregirp gregrip gregrpi grepgir
grepgri grepigr grepirg greprig greprgi greipgr greiprg greigpr greigrp greirgp greirpg
grerpig grerpgi greripg grerigp grergip grergpi grrgpei grrgpie grrgepi grrgeip grrgiep
grrgipe grrpgei grrpgie grrpegi grrpeig grrpieg grrpige grrepgi grrepig grregpi grregip
grreigp grreipg grripeg grripge grriepg grriegp grrigep grrigpe girgper girgpre girgepr
girgerp girgrep girgrpe girpger girpgre girpegr girperg girpreg girprge girepgr gireprg
giregpr giregrp girergp girerpg girrpeg girrpge girrepg girregp girrgep girrgpe gigrper
gigrpre gigrepr gigrerp gigrrep gigrrpe gigprer gigprre gigperr gigperr gigprer gigprre
gigeprr gigeprr gigerpr gigerrp gigerrp gigerpr gigrper gigrpre gigrepr gigrerp gigrrep
gigrrpe gipgrer gipgrre gipgerr gipgerr gipgrer gipgrre giprger giprgre gipregr giprerg
giprreg giprrge gipergr giperrg gipegrr gipegrr gipergr giperrg giprreg giprrge giprerg
gipregr giprger giprgre giegprr giegprr giegrpr giegrrp giegrrp giegrpr giepgrr giepgrr
gieprgr gieprrg gieprrg gieprgr gierpgr gierprg giergpr giergrp gierrgp gierrpg gierprg
gierpgr gierrpg gierrgp giergrp giergpr girgper girgpre girgepr girgerp girgrep girgrpe
girpger girpgre girpegr girperg girpreg girprge girepgr gireprg giregpr giregrp girergp
girerpg girrpeg girrpge girrepg girregp girrgep girrgpe ggirper ggirpre ggirepr ggirerp
ggirrep ggirrpe ggiprer ggiprre ggiperr ggiperr ggiprer ggiprre ggieprr ggieprr ggierpr
ggierrp ggierrp ggierpr ggirper ggirpre ggirepr ggirerp ggirrep ggirrpe ggriper ggripre
ggriepr ggrierp ggrirep ggrirpe ggrpier ggrpire ggrpeir ggrperi ggrprei ggrprie ggrepir
ggrepri ggreipr ggreirp ggrerip ggrerpi ggrrpei ggrrpie ggrrepi ggrreip ggrriep ggrripe
ggprier ggprire ggpreir ggpreri ggprrei ggprrie ggpirer ggpirre ggpierr ggpierr ggpirer
ggpirre ggpeirr ggpeirr ggperir ggperri ggperri ggperir ggprier ggprire ggpreir ggpreri
ggprrei ggprrie ggerpir ggerpri ggeripr ggerirp ggerrip ggerrpi ggeprir ggeprri ggepirr
ggepirr ggeprir ggeprri ggeiprr ggeiprr ggeirpr ggeirrp ggeirrp ggeirpr ggerpir ggerpri
ggeripr ggerirp ggerrip ggerrpi ggrrpei ggrrpie ggrrepi ggrreip ggrriep ggrripe ggrprei
ggrprie ggrperi ggrpeir ggrpier ggrpire ggrepri ggrepir ggrerpi ggrerip ggreirp ggreipr
ggriper ggripre ggriepr ggrierp ggrirep ggrirpe gpigrer gpigrre gpigerr gpigerr gpigrer
gpigrre gpirger gpirgre gpiregr gpirerg gpirreg gpirrge gpiergr gpierrg gpiegrr gpiegrr
gpiergr gpierrg gpirreg gpirrge gpirerg gpiregr gpirger gpirgre gpgirer gpgirre gpgierr
gpgierr gpgirer gpgirre gpgrier gpgrire gpgreir gpgreri gpgrrei gpgrrie gpgerir gpgerri
gpgeirr gpgeirr gpgerir gpgerri gpgrrei gpgrrie gpgreri gpgreir gpgrier gpgrire gprgier
gprgire gprgeir gprgeri gprgrei gprgrie gpriger gprigre gpriegr gprierg gprireg gprirge
gpreigr gpreirg gpregir gpregri gprergi gprerig gprrieg gprrige gprreig gprregi gprrgei
gprrgie gpegrir gpegrri gpegirr gpegirr gpegrir gpegrri gpergir gpergri gperigr gperirg
gperrig gperrgi gpeirgr gpeirrg gpeigrr gpeigrr gpeirgr gpeirrg gperrig gperrgi gperirg
gperigr gpergir gpergri gprgrei gprgrie gprgeri gprgeir gprgier gprgire gprrgei gprrgie
gprregi gprreig gprrieg gprrige gprergi gprerig gpregri gpregir gpreigr gpreirg gprireg
gprirge gprierg gpriegr gpriger gprigre geigprr geigprr geigrpr geigrrp geigrrp geigrpr
geipgrr geipgrr geiprgr geiprrg geiprrg geiprgr geirpgr geirprg geirgpr geirgrp geirrgp
geirrpg geirprg geirpgr geirrpg geirrgp geirgrp geirgpr gegiprr gegiprr gegirpr gegirrp
gegirrp gegirpr gegpirr gegpirr gegprir gegprri gegprri gegprir gegrpir gegrpri gegripr
gegrirp gegrrip gegrrpi gegrpri gegrpir gegrrpi gegrrip gegrirp gegripr gepgirr gepgirr
gepgrir gepgrri gepgrri gepgrir gepigrr gepigrr gepirgr gepirrg gepirrg gepirgr geprigr
geprirg geprgir geprgri geprrgi geprrig geprirg geprigr geprrig geprrgi geprgri geprgir
gergpir gergpri gergipr gergirp gergrip gergrpi gerpgir gerpgri gerpigr gerpirg gerprig
gerprgi geripgr geriprg gerigpr gerigrp gerirgp gerirpg gerrpig gerrpgi gerripg gerrigp
gerrgip gerrgpi gergpri gergpir gergrpi gergrip gergirp gergipr gerpgri gerpgir gerprgi
gerprig gerpirg gerpigr gerrpgi gerrpig gerrgpi gerrgip gerrigp gerripg geriprg geripgr
gerirpg gerirgp gerigrp gerigpr grigper grigpre grigepr grigerp grigrep grigrpe gripger
gripgre gripegr griperg gripreg griprge griepgr grieprg griegpr griegrp griergp grierpg
grirpeg grirpge grirepg griregp grirgep grirgpe grgiper grgipre grgiepr grgierp grgirep
grgirpe grgpier grgpire grgpeir grgperi grgprei grgprie grgepir grgepri grgeipr grgeirp
grgerip grgerpi grgrpei grgrpie grgrepi grgreip grgriep grgripe grpgier grpgire grpgeir
grpgeri grpgrei grpgrie grpiger grpigre grpiegr grpierg grpireg grpirge grpeigr grpeirg
grpegir grpegri grpergi grperig grprieg grprige grpreig grpregi grprgei grprgie gregpir
gregpri gregipr gregirp gregrip gregrpi grepgir grepgri grepigr grepirg greprig greprgi
greipgr greiprg greigpr greigrp greirgp greirpg grerpig grerpgi greripg grerigp grergip
grergpi grrgpei grrgpie grrgepi grrgeip grrgiep grrgipe grrpgei grrpgie grrpegi grrpeig
grrpieg grrpige grrepgi grrepig grregpi grregip grreigp grreipg grripeg grripge grriepg
grriegp grrigep grrigpe eriggpr eriggrp erigpgr erigprg erigrpg erigrgp eriggpr eriggrp
erigpgr erigprg erigrpg erigrgp eripggr eripgrg eripggr eripgrg eriprgg eriprgg erirgpg
erirggp erirpgg erirpgg erirgpg erirggp ergigpr ergigrp ergipgr ergiprg ergirpg ergirgp
erggipr erggirp erggpir erggpri erggrpi erggrip ergpgir ergpgri ergpigr ergpirg ergprig
ergprgi ergrgpi ergrgip ergrpgi ergrpig ergripg ergrigp erggipr erggirp erggpir erggpri
erggrpi erggrip ergigpr ergigrp ergipgr ergiprg ergirpg ergirgp ergpigr ergpirg ergpgir
ergpgri ergprgi ergprig ergripg ergrigp ergrpig ergrpgi ergrgpi ergrgip erpggir erpggri
erpgigr erpgirg erpgrig erpgrgi erpggir erpggri erpgigr erpgirg erpgrig erpgrgi erpiggr
erpigrg erpiggr erpigrg erpirgg erpirgg erprgig erprggi erprigg erprigg erprgig erprggi
errggpi errggip errgpgi errgpig errgipg errgigp errggpi errggip errgpgi errgpig errgipg
errgigp errpggi errpgig errpggi errpgig errpigg errpigg errigpg erriggp erripgg erripgg
errigpg erriggp eirggpr eirggrp eirgpgr eirgprg eirgrpg eirgrgp eirggpr eirggrp eirgpgr
eirgprg eirgrpg eirgrgp eirpggr eirpgrg eirpggr eirpgrg eirprgg eirprgg eirrgpg eirrggp
eirrpgg eirrpgg eirrgpg eirrggp eigrgpr eigrgrp eigrpgr eigrprg eigrrpg eigrrgp eiggrpr
eiggrrp eiggprr eiggprr eiggrpr eiggrrp eigpgrr eigpgrr eigprgr eigprrg eigprrg eigprgr
eigrgpr eigrgrp eigrpgr eigrprg eigrrpg eigrrgp eiggrpr eiggrrp eiggprr eiggprr eiggrpr
eiggrrp eigrgpr eigrgrp eigrpgr eigrprg eigrrpg eigrrgp eigprgr eigprrg eigpgrr eigpgrr
eigprgr eigprrg eigrrpg eigrrgp eigrprg eigrpgr eigrgpr eigrgrp eipggrr eipggrr eipgrgr
eipgrrg eipgrrg eipgrgr eipggrr eipggrr eipgrgr eipgrrg eipgrrg eipgrgr eiprggr eiprgrg
eiprggr eiprgrg eiprrgg eiprrgg eiprgrg eiprggr eiprrgg eiprrgg eiprgrg eiprggr eirggpr
eirggrp eirgpgr eirgprg eirgrpg eirgrgp eirggpr eirggrp eirgpgr eirgprg eirgrpg eirgrgp
eirpggr eirpgrg eirpggr eirpgrg eirprgg eirprgg eirrgpg eirrggp eirrpgg eirrpgg eirrgpg
eirrggp egirgpr egirgrp egirpgr egirprg egirrpg egirrgp egigrpr egigrrp egigprr egigprr
egigrpr egigrrp egipgrr egipgrr egiprgr egiprrg egiprrg egiprgr egirgpr egirgrp egirpgr
egirprg egirrpg egirrgp egrigpr egrigrp egripgr egriprg egrirpg egrirgp egrgipr egrgirp
egrgpir egrgpri egrgrpi egrgrip egrpgir egrpgri egrpigr egrpirg egrprig egrprgi egrrgpi
egrrgip egrrpgi egrrpig egrripg egrrigp eggripr eggrirp eggrpir eggrpri eggrrpi eggrrip
eggirpr eggirrp eggiprr eggiprr eggirpr eggirrp eggpirr eggpirr eggprir eggprri eggprri
eggprir eggripr eggrirp eggrpir eggrpri eggrrpi eggrrip egprgir egprgri egprigr egprirg
egprrig egprrgi egpgrir egpgrri egpgirr egpgirr egpgrir egpgrri egpigrr egpigrr egpirgr
egpirrg egpirrg egpirgr egprgir egprgri egprigr egprirg egprrig egprrgi egrrgpi egrrgip
egrrpgi egrrpig egrripg egrrigp egrgrpi egrgrip egrgpri egrgpir egrgipr egrgirp egrpgri
egrpgir egrprgi egrprig egrpirg egrpigr egrigpr egrigrp egripgr egriprg egrirpg egrirgp
egigrpr egigrrp egigprr egigprr egigrpr egigrrp egirgpr egirgrp egirpgr egirprg egirrpg
egirrgp egiprgr egiprrg egipgrr egipgrr egiprgr egiprrg egirrpg egirrgp egirprg egirpgr
egirgpr egirgrp eggirpr eggirrp eggiprr eggiprr eggirpr eggirrp eggripr eggrirp eggrpir
eggrpri eggrrpi eggrrip eggprir eggprri eggpirr eggpirr eggprir eggprri eggrrpi eggrrip
eggrpri eggrpir eggripr eggrirp egrgipr egrgirp egrgpir egrgpri egrgrpi egrgrip egrigpr
egrigrp egripgr egriprg egrirpg egrirgp egrpigr egrpirg egrpgir egrpgri egrprgi egrprig
egrripg egrrigp egrrpig egrrpgi egrrgpi egrrgip egpgrir egpgrri egpgirr egpgirr egpgrir
egpgrri egprgir egprgri egprigr egprirg egprrig egprrgi egpirgr egpirrg egpigrr egpigrr
egpirgr egpirrg egprrig egprrgi egprirg egprigr egprgir egprgri egrgrpi egrgrip egrgpri
egrgpir egrgipr egrgirp egrrgpi egrrgip egrrpgi egrrpig egrripg egrrigp egrprgi egrprig
egrpgri egrpgir egrpigr egrpirg egrirpg egrirgp egriprg egripgr egrigpr egrigrp epiggrr
epiggrr epigrgr epigrrg epigrrg epigrgr epiggrr epiggrr epigrgr epigrrg epigrrg epigrgr
epirggr epirgrg epirggr epirgrg epirrgg epirrgg epirgrg epirggr epirrgg epirrgg epirgrg
epirggr epgigrr epgigrr epgirgr epgirrg epgirrg epgirgr epggirr epggirr epggrir epggrri
epggrri epggrir epgrgir epgrgri epgrigr epgrirg epgrrig epgrrgi epgrgri epgrgir epgrrgi
epgrrig epgrirg epgrigr epggirr epggirr epggrir epggrri epggrri epggrir epgigrr epgigrr
epgirgr epgirrg epgirrg epgirgr epgrigr epgrirg epgrgir epgrgri epgrrgi epgrrig epgrirg
epgrigr epgrrig epgrrgi epgrgri epgrgir eprggir eprggri eprgigr eprgirg eprgrig eprgrgi
eprggir eprggri eprgigr eprgirg eprgrig eprgrgi epriggr eprigrg epriggr eprigrg eprirgg
eprirgg eprrgig eprrggi eprrigg eprrigg eprrgig eprrggi eprggri eprggir eprgrgi eprgrig
eprgirg eprgigr eprggri eprggir eprgrgi eprgrig eprgirg eprgigr eprrggi eprrgig eprrggi
eprrgig eprrigg eprrigg eprigrg epriggr eprirgg eprirgg eprigrg epriggr eriggpr eriggrp
erigpgr erigprg erigrpg erigrgp eriggpr eriggrp erigpgr erigprg erigrpg erigrgp eripggr
eripgrg eripggr eripgrg eriprgg eriprgg erirgpg erirggp erirpgg erirpgg erirgpg erirggp
ergigpr ergigrp ergipgr ergiprg ergirpg ergirgp erggipr erggirp erggpir erggpri erggrpi
erggrip ergpgir ergpgri ergpigr ergpirg ergprig ergprgi ergrgpi ergrgip ergrpgi ergrpig
ergripg ergrigp erggipr erggirp erggpir erggpri erggrpi erggrip ergigpr ergigrp ergipgr
ergiprg ergirpg ergirgp ergpigr ergpirg ergpgir ergpgri ergprgi ergprig ergripg ergrigp
ergrpig ergrpgi ergrgpi ergrgip erpggir erpggri erpgigr erpgirg erpgrig erpgrgi erpggir
erpggri erpgigr erpgirg erpgrig erpgrgi erpiggr erpigrg erpiggr erpigrg erpirgg erpirgg
erprgig erprggi erprigg erprigg erprgig erprggi errggpi errggip errgpgi errgpig errgipg
errgigp errggpi errggip errgpgi errgpig errgipg errgigp errpggi errpgig errpggi errpgig
errpigg errpigg errigpg erriggp erripgg erripgg errigpg erriggp rriggep rriggpe rrigegp
rrigepg rrigpeg rrigpge rriggep rriggpe rrigegp rrigepg rrigpeg rrigpge rrieggp rriegpg
rrieggp rriegpg rriepgg rriepgg rripgeg rripgge rripegg rripegg rripgeg rripgge rrgigep
rrgigpe rrgiegp rrgiepg rrgipeg rrgipge rrggiep rrggipe rrggeip rrggepi rrggpei rrggpie
rrgegip rrgegpi rrgeigp rrgeipg rrgepig rrgepgi rrgpgei rrgpgie rrgpegi rrgpeig rrgpieg
rrgpige rrggiep rrggipe rrggeip rrggepi rrggpei rrggpie rrgigep rrgigpe rrgiegp rrgiepg
rrgipeg rrgipge rrgeigp rrgeipg rrgegip rrgegpi rrgepgi rrgepig rrgpieg rrgpige rrgpeig
rrgpegi rrgpgei rrgpgie rreggip rreggpi rregigp rregipg rregpig rregpgi rreggip rreggpi
rregigp rregipg rregpig rregpgi rreiggp rreigpg rreiggp rreigpg rreipgg rreipgg rrepgig
rrepggi rrepigg rrepigg rrepgig rrepggi rrpggei rrpggie rrpgegi rrpgeig rrpgieg rrpgige
rrpggei rrpggie rrpgegi rrpgeig rrpgieg rrpgige rrpeggi rrpegig rrpeggi rrpegig rrpeigg
rrpeigg rrpigeg rrpigge rrpiegg rrpiegg rrpigeg rrpigge rirggep rirggpe rirgegp rirgepg
rirgpeg rirgpge rirggep rirggpe rirgegp rirgepg rirgpeg rirgpge rireggp riregpg rireggp
riregpg rirepgg rirepgg rirpgeg rirpgge rirpegg rirpegg rirpgeg rirpgge rigrgep rigrgpe
rigregp rigrepg rigrpeg rigrpge riggrep riggrpe riggerp riggepr riggper riggpre rigegrp
rigegpr rigergp rigerpg rigeprg rigepgr rigpger rigpgre rigpegr rigperg rigpreg rigprge
riggrep riggrpe riggerp riggepr riggper riggpre rigrgep rigrgpe rigregp rigrepg rigrpeg
rigrpge rigergp rigerpg rigegrp rigegpr rigepgr rigeprg rigpreg rigprge rigperg rigpegr
rigpger rigpgre rieggrp rieggpr riegrgp riegrpg riegprg riegpgr rieggrp rieggpr riegrgp
riegrpg riegprg riegpgr rierggp riergpg rierggp riergpg rierpgg rierpgg riepgrg riepggr
rieprgg rieprgg riepgrg riepggr ripgger ripggre ripgegr ripgerg ripgreg ripgrge ripgger
ripggre ripgegr ripgerg ripgreg ripgrge ripeggr ripegrg ripeggr ripegrg ripergg ripergg
riprgeg riprgge ripregg ripregg riprgeg riprgge rgirgep rgirgpe rgiregp rgirepg rgirpeg
rgirpge rgigrep rgigrpe rgigerp rgigepr rgigper rgigpre rgiegrp rgiegpr rgiergp rgierpg
rgieprg rgiepgr rgipger rgipgre rgipegr rgiperg rgipreg rgiprge rgrigep rgrigpe rgriegp
rgriepg rgripeg rgripge rgrgiep rgrgipe rgrgeip rgrgepi rgrgpei rgrgpie rgregip rgregpi
rgreigp rgreipg rgrepig rgrepgi rgrpgei rgrpgie rgrpegi rgrpeig rgrpieg rgrpige rggriep
rggripe rggreip rggrepi rggrpei rggrpie rggirep rggirpe rggierp rggiepr rggiper rggipre
rggeirp rggeipr rggerip rggerpi rggepri rggepir rggpier rggpire rggpeir rggperi rggprei
rggprie rgergip rgergpi rgerigp rgeripg rgerpig rgerpgi rgegrip rgegrpi rgegirp rgegipr
rgegpir rgegpri rgeigrp rgeigpr rgeirgp rgeirpg rgeiprg rgeipgr rgepgir rgepgri rgepigr
rgepirg rgeprig rgeprgi rgprgei rgprgie rgpregi rgpreig rgprieg rgprige rgpgrei rgpgrie
rgpgeri rgpgeir rgpgier rgpgire rgpegri rgpegir rgpergi rgperig rgpeirg rgpeigr rgpiger
rgpigre rgpiegr rgpierg rgpireg rgpirge rgigrep rgigrpe rgigerp rgigepr rgigper rgigpre
rgirgep rgirgpe rgiregp rgirepg rgirpeg rgirpge rgiergp rgierpg rgiegrp rgiegpr rgiepgr
rgieprg rgipreg rgiprge rgiperg rgipegr rgipger rgipgre rggirep rggirpe rggierp rggiepr
rggiper rggipre rggriep rggripe rggreip rggrepi rggrpei rggrpie rggerip rggerpi rggeirp
rggeipr rggepir rggepri rggprei rggprie rggperi rggpeir rggpier rggpire rgrgiep rgrgipe
rgrgeip rgrgepi rgrgpei rgrgpie rgrigep rgrigpe rgriegp rgriepg rgripeg rgripge rgreigp
rgreipg rgregip rgregpi rgrepgi rgrepig rgrpieg rgrpige rgrpeig rgrpegi rgrpgei rgrpgie
rgegrip rgegrpi rgegirp rgegipr rgegpir rgegpri rgergip rgergpi rgerigp rgeripg rgerpig
rgerpgi rgeirgp rgeirpg rgeigrp rgeigpr rgeipgr rgeiprg rgeprig rgeprgi rgepirg rgepigr
rgepgir rgepgri rgpgrei rgpgrie rgpgeri rgpgeir rgpgier rgpgire rgprgei rgprgie rgpregi
rgpreig rgprieg rgprige rgpergi rgperig rgpegri rgpegir rgpeigr rgpeirg rgpireg rgpirge
rgpierg rgpiegr rgpiger rgpigre reiggrp reiggpr reigrgp reigrpg reigprg reigpgr reiggrp
reiggpr reigrgp reigrpg reigprg reigpgr reirggp reirgpg reirggp reirgpg reirpgg reirpgg
reipgrg reipggr reiprgg reiprgg reipgrg reipggr regigrp regigpr regirgp regirpg regiprg
regipgr reggirp reggipr reggrip reggrpi reggpri reggpir regrgip regrgpi regrigp regripg
regrpig regrpgi regpgri regpgir regprgi regprig regpirg regpigr reggirp reggipr reggrip
reggrpi reggpri reggpir regigrp regigpr regirgp regirpg regiprg regipgr regrigp regripg
regrgip regrgpi regrpgi regrpig regpirg regpigr regprig regprgi regpgri regpgir rerggip
rerggpi rergigp rergipg rergpig rergpgi rerggip rerggpi rergigp rergipg rergpig rergpgi
reriggp rerigpg reriggp rerigpg reripgg reripgg rerpgig rerpggi rerpigg rerpigg rerpgig
rerpggi repggri repggir repgrgi repgrig repgirg repgigr repggri repggir repgrgi repgrig
repgirg repgigr reprggi reprgig reprggi reprgig reprigg reprigg repigrg repiggr repirgg
repirgg repigrg repiggr rpigger rpiggre rpigegr rpigerg rpigreg rpigrge rpigger rpiggre
rpigegr rpigerg rpigreg rpigrge rpieggr rpiegrg rpieggr rpiegrg rpiergg rpiergg rpirgeg
rpirgge rpiregg rpiregg rpirgeg rpirgge rpgiger rpgigre rpgiegr rpgierg rpgireg rpgirge
rpggier rpggire rpggeir rpggeri rpggrei rpggrie rpgegir rpgegri rpgeigr rpgeirg rpgerig
rpgergi rpgrgei rpgrgie rpgregi rpgreig rpgrieg rpgrige rpggier rpggire rpggeir rpggeri
rpggrei rpggrie rpgiger rpgigre rpgiegr rpgierg rpgireg rpgirge rpgeigr rpgeirg rpgegir
rpgegri rpgergi rpgerig rpgrieg rpgrige rpgreig rpgregi rpgrgei rpgrgie rpeggir rpeggri
rpegigr rpegirg rpegrig rpegrgi rpeggir rpeggri rpegigr rpegirg rpegrig rpegrgi rpeiggr
rpeigrg rpeiggr rpeigrg rpeirgg rpeirgg rpergig rperggi rperigg rperigg rpergig rperggi
rprggei rprggie rprgegi rprgeig rprgieg rprgige rprggei rprggie rprgegi rprgeig rprgieg
rprgige rpreggi rpregig rpreggi rpregig rpreigg rpreigg rprigeg rprigge rpriegg rpriegg
rprigeg rprigge

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us