easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

tikhov

aftosa

crystolon

proexporting

lignosulphonate

stilgar

orotinan

burning

timbersome

saudiarabia

heterozygotic

piccinini

tentmaker

tudor

slummy

impellerem

vagaries

thinly


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: prepended
cipher variations:
qsfqfoefe rtgrgpfgf suhshqghg tvitirhih uwjujsiji
vxkvktjkj wylwluklk xzmxmvlml yanynwmnm zbozoxnon
acpapyopo bdqbqzpqp cercraqrq dfsdsbrsr egtetcsts
fhufudtut givgveuvu hjwhwfvwv ikxixgwxw jlyjyhxyx
kmzkziyzy lnalajzaz mobmbkaba npcnclbcb oqdodmcdc

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: prepended
Cipher: kivkvmwvw

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: prepended
Cipher: ABBBA BAAAA AABAA ABBBA AABAA ABBAA AAABB AABAA AAABB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: prepended
cipher variations:
qsfqfoefeuanunoknkyivyvoqvqcqdcdowdwgylgloclckgtktoitiswjsjoujuwerwroara
amzazogzgeuhehomhmicpipospsmkxmxoyxyrtgrgpfgfvbovoplolzjwzwprwrdredepxex
hzmhmpdmdlhulupjujtxktkpvkvxfsxspbsbbnabaphahfvifipninjdqjqptqtnlynypzyz
suhshqghgwcpwpqmpmakxaxqsxsesfefqyfyianinqenemivmvqkvkuylulqwlwygtytqctc
cobcbqibigwjgjqojokerkrquruomzozqazatvitirhihxdqxqrnqnblybyrtytftgfgrzgz
jbojorfofnjwnwrlwlvzmvmrxmxzhuzurduddpcdcrjcjhxkhkrpkplfslsrvsvpnaparbab
uwjujsijiyeryrsorocmzczsuzuguhghsahakcpkpsgpgokxoxsmxmwanwnsynyaivavseve
eqdedskdkiylilsqlqmgtmtswtwqobqbscbcvxkvktjkjzfszstpspdnadatvavhvihitbib
ldqlqthqhplypytnynxboxotzozbjwbwtfwffrefetleljzmjmtrmrnhunutxuxrpcrctdcd
wylwluklkagtatuqtqeobebuwbwiwjijucjcmermruiriqmzqzuozoycpypuapackxcxugxg
gsfgfumfmkanknusnsoivovuyvysqdsduedexzmxmvlmlbhubuvrurfpcfcvxcxjxkjkvdkd
nfsnsvjsjrnaravpapzdqzqvbqbdlydyvhyhhtghgvngnlbolovtotpjwpwvzwztretevfef
yanynwmnmcivcvwsvsgqdgdwydykylklweleogtotwktksobsbwqbqaerarwcrcemzezwizi
iuhihwohomcpmpwupuqkxqxwaxausfufwgfgzbozoxnondjwdwxtwthrehexzezlzmlmxfmf
phupuxlultpctcxrcrbfsbsxdsdfnafaxjajjvijixpipndqnqxvqvrlyryxbybvtgvgxhgh
acpapyopoekxexyuxuisfifyafamanmnygngqivqvymvmuqdudysdscgtctyetegobgbykbk
kwjkjyqjqoerorywrwsmzszyczcwuhwhyihibdqbqzpqpflyfyzvyvjtgjgzbgbnbonozhoh
rjwrwznwnvreveztetdhuduzfufhpchczlcllxklkzrkrpfspszxsxtnatazdadxvixizjij
cercraqrqgmzgzawzwkuhkhachcocpopaipiskxsxaoxowsfwfaufueivevagvgiqdidamdm
mylmlaslsqgtqtaytyuobubaebeywjyjakjkdfsdsbrsrhnahabxaxlvilibdidpdqpqbjqj
tlytybpypxtgxgbvgvfjwfwbhwhjrejebnennzmnmbtmtrhurubzuzvpcvcbfcfzxkzkblkl
egtetcstsiobibcybymwjmjcejeqerqrckrkumzuzcqzqyuhyhcwhwgkxgxcixiksfkfcofo
oanoncunusivsvcavawqdwdcgdgaylalcmlmfhufudtutjpcjcdzcznxknkdfkfrfsrsdlsl
vnavadrarzvizidxixhlyhydjyjltglgdpgppbopodvovtjwtwdbwbxrexedhehbzmbmdnmn
givgveuvukqdkdeadaoyloleglgsgtstemtmwobwbesbsawjajeyjyimzizekzkmuhmheqhq
qcpqpewpwukxuxecxcysfyfeificancneonohjwhwfvwvlrelefbebpzmpmfhmhthutufnun
xpcxcftctbxkbkfzkzjnajaflalnvinifrirrdqrqfxqxvlyvyfdydztgzgfjgjdbodofpop
ikxixgwxwmsfmfgcfcqanqnginiuivuvgovoyqdydguducylclgalakobkbgmbmowjojgsjs
sersrgyrywmzwzgezeauhahgkhkecpepgqpqjlyjyhxyxntgnghdgdrborohjojvjwvwhpwp
zrezehvevdzmdmhbmblpclchncnpxkpkhtkttfstshzszxnaxahfafbvibihlilfdqfqhrqr
kmzkziyzyouhohiehescpspikpkwkxwxiqxqasfafiwfweanenicncmqdmdiodoqylqliulu
ugtutiatayobybigbgcwjcjimjmgergrisrslnalajzazpvipijfiftdqtqjlqlxlyxyjryr
btgbgjxgxfbofojdodnrenejpeprzmrmjvmvvhuvujbubzpczcjhchdxkdkjnknhfshsjtst
mobmbkabaqwjqjkgjguerurkmrmymzyzkszscuhchkyhygcpgpkepeosfofkqfqsansnkwnw
wivwvkcvcaqdadkidieylelkoloigtitkutunpcnclbcbrxkrklhkhvfsvslnsnznazaltat
dvidilzizhdqhqlfqfptgpglrgrtbotolxoxxjwxwldwdbrebeljejfzmfmlpmpjhujulvuv
oqdodmcdcsylslmiliwgtwtmotoaobabmubuewjejmajaierirmgrgquhqhmshsucpupmypy
ykxyxmexecsfcfmkfkgangnmqnqkivkvmwvwprependedtzmtmnjmjxhuxunpupbpcbcnvcv
fxkfknbkbjfsjsnhshrvirintitvdqvqnzqzzlyzynfyfdtgdgnlglhbohonrorljwlwnxwx

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: prepended
Cipher: cercraqrq

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: prepended
Cipher: 532451535133415141

Extended Methods:
Method #1

Plaintext: prepended
method variations:
uwkuksikizbpzpxopoegueuctutkmzkzhyzy

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
p r e p e n d e d 
5 2 5 5 5 3 4 5 4 
3 4 1 3 1 3 1 1 1 
They are then read out in rows:
525553454341313111
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: prepended
Cipher: kzpyodcca

Read more ...
Method #3

Plaintext: prepended
method variations:
hyvxlsvqv yvxlsvqvh vxlsvqvhy
xlsvqvhyv lsvqvhyvx svqvhyvxl
vqvhyvxls qvhyvxlsv vhyvxlsvq

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: prepended

first 5040 cipher variations(362880 total)
prepended prependde prepenedd prepenedd prepended prependde prepedned prepednde prepedend prepededn prepedden
prepeddne prepeednd prepeeddn prepeendd prepeendd prepeednd prepeeddn prepedden prepeddne prepededn prepedend
prepedned prepednde prepneded prepnedde prepneedd prepneedd prepneded prepnedde prepndeed prepndede prepndeed
prepndede prepnddee prepnddee prepneded prepnedde prepneedd prepneedd prepneded prepnedde prepnddee prepnddee
prepndede prepndeed prepndeed prepndede prepdneed prepdnede prepdneed prepdnede prepdndee prepdndee prepdened
prepdende prepdeend prepdeedn prepdeden prepdedne prepdeend prepdeedn prepdened prepdende prepdedne prepdeden
prepddeen prepddene prepddeen prepddene prepddnee prepddnee prepended prependde prepenedd prepenedd prepended
prependde prepedned prepednde prepedend prepededn prepedden prepeddne prepeednd prepeeddn prepeendd prepeendd
prepeednd prepeeddn prepedden prepeddne prepededn prepedend prepedned prepednde prepdndee prepdndee prepdnede
prepdneed prepdneed prepdnede prepddnee prepddnee prepddene prepddeen prepddeen prepddene prepdedne prepdeden
prepdende prepdened prepdeend prepdeedn prepdeden prepdedne prepdeedn prepdeend prepdened prepdende preepnded
preepndde preepnedd preepnedd preepnded preepndde preepdned preepdnde preepdend preepdedn preepdden preepddne
preepednd preepeddn preependd preependd preepednd preepeddn preepdden preepddne preepdedn preepdend preepdned
preepdnde preenpded preenpdde preenpedd preenpedd preenpded preenpdde preendped preendpde preendepd preendedp
preenddep preenddpe preenedpd preeneddp preenepdd preenepdd preenedpd preeneddp preenddep preenddpe preendedp
preendepd preendped preendpde preednped preednpde preednepd preednedp preedndep preedndpe preedpned preedpnde
preedpend preedpedn preedpden preedpdne preedepnd preedepdn preedenpd preedendp preedednp preededpn preeddpen
preeddpne preeddepn preeddenp preeddnep preeddnpe preeendpd preeenddp preeenpdd preeenpdd preeendpd preeenddp
preeednpd preeedndp preeedpnd preeedpdn preeeddpn preeeddnp preeepdnd preeepddn preeepndd preeepndd preeepdnd
preeepddn preeeddpn preeeddnp preeedpdn preeedpnd preeednpd preeedndp preedndep preedndpe preednedp preednepd
preednped preednpde preeddnep preeddnpe preeddenp preeddepn preeddpen preeddpne preedednp preededpn preedendp
preedenpd preedepnd preedepdn preedpden preedpdne preedpedn preedpend preedpned preedpnde prenepded prenepdde
prenepedd prenepedd prenepded prenepdde prenedped prenedpde prenedepd prenededp preneddep preneddpe preneedpd
preneeddp preneepdd preneepdd preneedpd preneeddp preneddep preneddpe prenededp prenedepd prenedped prenedpde
prenpeded prenpedde prenpeedd prenpeedd prenpeded prenpedde prenpdeed prenpdede prenpdeed prenpdede prenpddee
prenpddee prenpeded prenpedde prenpeedd prenpeedd prenpeded prenpedde prenpddee prenpddee prenpdede prenpdeed
prenpdeed prenpdede prendpeed prendpede prendpeed prendpede prendpdee prendpdee prendeped prendepde prendeepd
prendeedp prendedep prendedpe prendeepd prendeedp prendeped prendepde prendedpe prendedep prenddeep prenddepe
prenddeep prenddepe prenddpee prenddpee prenepded prenepdde prenepedd prenepedd prenepded prenepdde prenedped
prenedpde prenedepd prenededp preneddep preneddpe preneedpd preneeddp preneepdd preneepdd preneedpd preneeddp
preneddep preneddpe prenededp prenedepd prenedped prenedpde prendpdee prendpdee prendpede prendpeed prendpeed
prendpede prenddpee prenddpee prenddepe prenddeep prenddeep prenddepe prendedpe prendedep prendepde prendeped
prendeepd prendeedp prendedep prendedpe prendeedp prendeepd prendeped prendepde predenped predenpde predenepd
predenedp predendep predendpe predepned predepnde predepend predepedn predepden predepdne predeepnd predeepdn
predeenpd predeendp predeednp predeedpn prededpen prededpne prededepn prededenp predednep predednpe predneped
prednepde predneepd predneedp prednedep prednedpe prednpeed prednpede prednpeed prednpede prednpdee prednpdee
predneped prednepde predneepd predneedp prednedep prednedpe predndpee predndpee predndepe predndeep predndeep
predndepe predpneed predpnede predpneed predpnede predpndee predpndee predpened predpende predpeend predpeedn
predpeden predpedne predpeend predpeedn predpened predpende predpedne predpeden predpdeen predpdene predpdeen
predpdene predpdnee predpdnee predenped predenpde predenepd predenedp predendep predendpe predepned predepnde
predepend predepedn predepden predepdne predeepnd predeepdn predeenpd predeendp predeednp predeedpn prededpen
prededpne prededepn prededenp predednep predednpe preddnpee preddnpee preddnepe preddneep preddneep preddnepe
preddpnee preddpnee preddpene preddpeen preddpeen preddpene preddepne preddepen preddenpe preddenep preddeenp
preddeepn preddepen preddepne preddeepn preddeenp preddenep preddenpe preeendpd preeenddp preeenpdd preeenpdd
preeendpd preeenddp preeednpd preeedndp preeedpnd preeedpdn preeeddpn preeeddnp preeepdnd preeepddn preeepndd
preeepndd preeepdnd preeepddn preeeddpn preeeddnp preeedpdn preeedpnd preeednpd preeedndp preenedpd preeneddp
preenepdd preenepdd preenedpd preeneddp preendepd preendedp preendped preendpde preenddpe preenddep preenpded
preenpdde preenpedd preenpedd preenpded preenpdde preenddpe preenddep preendpde preendped preendepd preendedp
preednepd preednedp preednped preednpde preedndpe preedndep preedenpd preedendp preedepnd preedepdn preededpn
preedednp preedpend preedpedn preedpned preedpnde preedpdne preedpden preeddepn preeddenp preeddpen preeddpne
preeddnpe preeddnep preepnded preepndde preepnedd preepnedd preepnded preepndde preepdned preepdnde preepdend
preepdedn preepdden preepddne preepednd preepeddn preependd preependd preepednd preepeddn preepdden preepddne
preepdedn preepdend preepdned preepdnde preedndpe preedndep preednpde preednped preednepd preednedp preeddnpe
preeddnep preeddpne preeddpen preeddepn preeddenp preedpdne preedpden preedpnde preedpned preedpend preedpedn
preededpn preedednp preedepdn preedepnd preedenpd preedendp predendep predendpe predenedp predenepd predenped
predenpde predednep predednpe prededenp prededepn prededpen prededpne predeednp predeedpn predeendp predeenpd
predeepnd predeepdn predepden predepdne predepedn predepend predepned predepnde prednedep prednedpe predneedp
predneepd predneped prednepde predndeep predndepe predndeep predndepe predndpee predndpee prednedep prednedpe
predneedp predneepd predneped prednepde prednpdee prednpdee prednpede prednpeed prednpeed prednpede preddneep
preddnepe preddneep preddnepe preddnpee preddnpee preddenep preddenpe preddeenp preddeepn preddepen preddepne
preddeenp preddeepn preddenep preddenpe preddepne preddepen preddpeen preddpene preddpeen preddpene preddpnee
preddpnee predendep predendpe predenedp predenepd predenped predenpde predednep predednpe prededenp prededepn
prededpen prededpne predeednp predeedpn predeendp predeenpd predeepnd predeepdn predepden predepdne predepedn
predepend predepned predepnde predpndee predpndee predpnede predpneed predpneed predpnede predpdnee predpdnee
predpdene predpdeen predpdeen predpdene predpedne predpeden predpende predpened predpeend predpeedn predpeden
predpedne predpeedn predpeend predpened predpende prpeended prpeendde prpeenedd prpeenedd prpeended prpeendde
prpeedned prpeednde prpeedend prpeededn prpeedden prpeeddne prpeeednd prpeeeddn prpeeendd prpeeendd prpeeednd
prpeeeddn prpeedden prpeeddne prpeededn prpeedend prpeedned prpeednde prpeneded prpenedde prpeneedd prpeneedd
prpeneded prpenedde prpendeed prpendede prpendeed prpendede prpenddee prpenddee prpeneded prpenedde prpeneedd
prpeneedd prpeneded prpenedde prpenddee prpenddee prpendede prpendeed prpendeed prpendede prpedneed prpednede
prpedneed prpednede prpedndee prpedndee prpedened prpedende prpedeend prpedeedn prpededen prpededne prpedeend
prpedeedn prpedened prpedende prpededne prpededen prpeddeen prpeddene prpeddeen prpeddene prpeddnee prpeddnee
prpeended prpeendde prpeenedd prpeenedd prpeended prpeendde prpeedned prpeednde prpeedend prpeededn prpeedden
prpeeddne prpeeednd prpeeeddn prpeeendd prpeeendd prpeeednd prpeeeddn prpeedden prpeeddne prpeededn prpeedend
prpeedned prpeednde prpedndee prpedndee prpednede prpedneed prpedneed prpednede prpeddnee prpeddnee prpeddene
prpeddeen prpeddeen prpeddene prpededne prpededen prpedende prpedened prpedeend prpedeedn prpededen prpededne
prpedeedn prpedeend prpedened prpedende prpeended prpeendde prpeenedd prpeenedd prpeended prpeendde prpeedned
prpeednde prpeedend prpeededn prpeedden prpeeddne prpeeednd prpeeeddn prpeeendd prpeeendd prpeeednd prpeeeddn
prpeedden prpeeddne prpeededn prpeedend prpeedned prpeednde prpeneded prpenedde prpeneedd prpeneedd prpeneded
prpenedde prpendeed prpendede prpendeed prpendede prpenddee prpenddee prpeneded prpenedde prpeneedd prpeneedd
prpeneded prpenedde prpenddee prpenddee prpendede prpendeed prpendeed prpendede prpedneed prpednede prpedneed
prpednede prpedndee prpedndee prpedened prpedende prpedeend prpedeedn prpededen prpededne prpedeend prpedeedn
prpedened prpedende prpededne prpededen prpeddeen prpeddene prpeddeen prpeddene prpeddnee prpeddnee prpeended
prpeendde prpeenedd prpeenedd prpeended prpeendde prpeedned prpeednde prpeedend prpeededn prpeedden prpeeddne
prpeeednd prpeeeddn prpeeendd prpeeendd prpeeednd prpeeeddn prpeedden prpeeddne prpeededn prpeedend prpeedned
prpeednde prpedndee prpedndee prpednede prpedneed prpedneed prpednede prpeddnee prpeddnee prpeddene prpeddeen
prpeddeen prpeddene prpededne prpededen prpedende prpedened prpedeend prpedeedn prpededen prpededne prpedeedn
prpedeend prpedened prpedende prpneeded prpneedde prpneeedd prpneeedd prpneeded prpneedde prpnedeed prpnedede
prpnedeed prpnedede prpneddee prpneddee prpneeded prpneedde prpneeedd prpneeedd prpneeded prpneedde prpneddee
prpneddee prpnedede prpnedeed prpnedeed prpnedede prpneeded prpneedde prpneeedd prpneeedd prpneeded prpneedde
prpnedeed prpnedede prpnedeed prpnedede prpneddee prpneddee prpneeded prpneedde prpneeedd prpneeedd prpneeded
prpneedde prpneddee prpneddee prpnedede prpnedeed prpnedeed prpnedede prpndeeed prpndeede prpndeeed prpndeede
prpndedee prpndedee prpndeeed prpndeede prpndeeed prpndeede prpndedee prpndedee prpndeeed prpndeede prpndeeed
prpndeede prpndedee prpndedee prpnddeee prpnddeee prpnddeee prpnddeee prpnddeee prpnddeee prpneeded prpneedde
prpneeedd prpneeedd prpneeded prpneedde prpnedeed prpnedede prpnedeed prpnedede prpneddee prpneddee prpneeded
prpneedde prpneeedd prpneeedd prpneeded prpneedde prpneddee prpneddee prpnedede prpnedeed prpnedeed prpnedede
prpndedee prpndedee prpndeede prpndeeed prpndeeed prpndeede prpnddeee prpnddeee prpnddeee prpnddeee prpnddeee
prpnddeee prpndedee prpndedee prpndeede prpndeeed prpndeeed prpndeede prpndedee prpndedee prpndeede prpndeeed
prpndeeed prpndeede prpdeneed prpdenede prpdeneed prpdenede prpdendee prpdendee prpdeened prpdeende prpdeeend
prpdeeedn prpdeeden prpdeedne prpdeeend prpdeeedn prpdeened prpdeende prpdeedne prpdeeden prpdedeen prpdedene
prpdedeen prpdedene prpdednee prpdednee prpdneeed prpdneede prpdneeed prpdneede prpdnedee prpdnedee prpdneeed
prpdneede prpdneeed prpdneede prpdnedee prpdnedee prpdneeed prpdneede prpdneeed prpdneede prpdnedee prpdnedee
prpdndeee prpdndeee prpdndeee prpdndeee prpdndeee prpdndeee prpdeneed prpdenede prpdeneed prpdenede prpdendee
prpdendee prpdeened prpdeende prpdeeend prpdeeedn prpdeeden prpdeedne prpdeeend prpdeeedn prpdeened prpdeende
prpdeedne prpdeeden prpdedeen prpdedene prpdedeen prpdedene prpdednee prpdednee prpdeneed prpdenede prpdeneed
prpdenede prpdendee prpdendee prpdeened prpdeende prpdeeend prpdeeedn prpdeeden prpdeedne prpdeeend prpdeeedn
prpdeened prpdeende prpdeedne prpdeeden prpdedeen prpdedene prpdedeen prpdedene prpdednee prpdednee prpddneee
prpddneee prpddneee prpddneee prpddneee prpddneee prpddenee prpddenee prpddeene prpddeeen prpddeeen prpddeene
prpddeene prpddeeen prpddenee prpddenee prpddeene prpddeeen prpddeeen prpddeene prpddeeen prpddeene prpddenee
prpddenee prpeended prpeendde prpeenedd prpeenedd prpeended prpeendde prpeedned prpeednde prpeedend prpeededn
prpeedden prpeeddne prpeeednd prpeeeddn prpeeendd prpeeendd prpeeednd prpeeeddn prpeedden prpeeddne prpeededn
prpeedend prpeedned prpeednde prpeneded prpenedde prpeneedd prpeneedd prpeneded prpenedde prpendeed prpendede
prpendeed prpendede prpenddee prpenddee prpeneded prpenedde prpeneedd prpeneedd prpeneded prpenedde prpenddee
prpenddee prpendede prpendeed prpendeed prpendede prpedneed prpednede prpedneed prpednede prpedndee prpedndee
prpedened prpedende prpedeend prpedeedn prpededen prpededne prpedeend prpedeedn prpedened prpedende prpededne
prpededen prpeddeen prpeddene prpeddeen prpeddene prpeddnee prpeddnee prpeended prpeendde prpeenedd prpeenedd
prpeended prpeendde prpeedned prpeednde prpeedend prpeededn prpeedden prpeeddne prpeeednd prpeeeddn prpeeendd
prpeeendd prpeeednd prpeeeddn prpeedden prpeeddne prpeededn prpeedend prpeedned prpeednde prpedndee prpedndee
prpednede prpedneed prpedneed prpednede prpeddnee prpeddnee prpeddene prpeddeen prpeddeen prpeddene prpededne
prpededen prpedende prpedened prpedeend prpedeedn prpededen prpededne prpedeedn prpedeend prpedened prpedende
prpdendee prpdendee prpdenede prpdeneed prpdeneed prpdenede prpdednee prpdednee prpdedene prpdedeen prpdedeen
prpdedene prpdeedne prpdeeden prpdeende prpdeened prpdeeend prpdeeedn prpdeeden prpdeedne prpdeeedn prpdeeend
prpdeened prpdeende prpdnedee prpdnedee prpdneede prpdneeed prpdneeed prpdneede prpdndeee prpdndeee prpdndeee
prpdndeee prpdndeee prpdndeee prpdnedee prpdnedee prpdneede prpdneeed prpdneeed prpdneede prpdnedee prpdnedee
prpdneede prpdneeed prpdneeed prpdneede prpddneee prpddneee prpddneee prpddneee prpddneee prpddneee prpddenee
prpddenee prpddeene prpddeeen prpddeeen prpddeene prpddeene prpddeeen prpddenee prpddenee prpddeene prpddeeen
prpddeeen prpddeene prpddeeen prpddeene prpddenee prpddenee prpdendee prpdendee prpdenede prpdeneed prpdeneed
prpdenede prpdednee prpdednee prpdedene prpdedeen prpdedeen prpdedene prpdeedne prpdeeden prpdeende prpdeened
prpdeeend prpdeeedn prpdeeden prpdeedne prpdeeedn prpdeeend prpdeened prpdeende prpdendee prpdendee prpdenede
prpdeneed prpdeneed prpdenede prpdednee prpdednee prpdedene prpdedeen prpdedeen prpdedene prpdeedne prpdeeden
prpdeende prpdeened prpdeeend prpdeeedn prpdeeden prpdeedne prpdeeedn prpdeeend prpdeened prpdeende prepended
prependde prepenedd prepenedd prepended prependde prepedned prepednde prepedend prepededn prepedden prepeddne
prepeednd prepeeddn prepeendd prepeendd prepeednd prepeeddn prepedden prepeddne prepededn prepedend prepedned
prepednde prepneded prepnedde prepneedd prepneedd prepneded prepnedde prepndeed prepndede prepndeed prepndede
prepnddee prepnddee prepneded prepnedde prepneedd prepneedd prepneded prepnedde prepnddee prepnddee prepndede
prepndeed prepndeed prepndede prepdneed prepdnede prepdneed prepdnede prepdndee prepdndee prepdened prepdende
prepdeend prepdeedn prepdeden prepdedne prepdeend prepdeedn prepdened prepdende prepdedne prepdeden prepddeen
prepddene prepddeen prepddene prepddnee prepddnee prepended prependde prepenedd prepenedd prepended prependde
prepedned prepednde prepedend prepededn prepedden prepeddne prepeednd prepeeddn prepeendd prepeendd prepeednd
prepeeddn prepedden prepeddne prepededn prepedend prepedned prepednde prepdndee prepdndee prepdnede prepdneed
prepdneed prepdnede prepddnee prepddnee prepddene prepddeen prepddeen prepddene prepdedne prepdeden prepdende
prepdened prepdeend prepdeedn prepdeden prepdedne prepdeedn prepdeend prepdened prepdende preepnded preepndde
preepnedd preepnedd preepnded preepndde preepdned preepdnde preepdend preepdedn preepdden preepddne preepednd
preepeddn preependd preependd preepednd preepeddn preepdden preepddne preepdedn preepdend preepdned preepdnde
preenpded preenpdde preenpedd preenpedd preenpded preenpdde preendped preendpde preendepd preendedp preenddep
preenddpe preenedpd preeneddp preenepdd preenepdd preenedpd preeneddp preenddep preenddpe preendedp preendepd
preendped preendpde preednped preednpde preednepd preednedp preedndep preedndpe preedpned preedpnde preedpend
preedpedn preedpden preedpdne preedepnd preedepdn preedenpd preedendp preedednp preededpn preeddpen preeddpne
preeddepn preeddenp preeddnep preeddnpe preeendpd preeenddp preeenpdd preeenpdd preeendpd preeenddp preeednpd
preeedndp preeedpnd preeedpdn preeeddpn preeeddnp preeepdnd preeepddn preeepndd preeepndd preeepdnd preeepddn
preeeddpn preeeddnp preeedpdn preeedpnd preeednpd preeedndp preedndep preedndpe preednedp preednepd preednped
preednpde preeddnep preeddnpe preeddenp preeddepn preeddpen preeddpne preedednp preededpn preedendp preedenpd
preedepnd preedepdn preedpden preedpdne preedpedn preedpend preedpned preedpnde prenepded prenepdde prenepedd
prenepedd prenepded prenepdde prenedped prenedpde prenedepd prenededp preneddep preneddpe preneedpd preneeddp
preneepdd preneepdd preneedpd preneeddp preneddep preneddpe prenededp prenedepd prenedped prenedpde prenpeded
prenpedde prenpeedd prenpeedd prenpeded prenpedde prenpdeed prenpdede prenpdeed prenpdede prenpddee prenpddee
prenpeded prenpedde prenpeedd prenpeedd prenpeded prenpedde prenpddee prenpddee prenpdede prenpdeed prenpdeed
prenpdede prendpeed prendpede prendpeed prendpede prendpdee prendpdee prendeped prendepde prendeepd prendeedp
prendedep prendedpe prendeepd prendeedp prendeped prendepde prendedpe prendedep prenddeep prenddepe prenddeep
prenddepe prenddpee prenddpee prenepded prenepdde prenepedd prenepedd prenepded prenepdde prenedped prenedpde
prenedepd prenededp preneddep preneddpe preneedpd preneeddp preneepdd preneepdd preneedpd preneeddp preneddep
preneddpe prenededp prenedepd prenedped prenedpde prendpdee prendpdee prendpede prendpeed prendpeed prendpede
prenddpee prenddpee prenddepe prenddeep prenddeep prenddepe prendedpe prendedep prendepde prendeped prendeepd
prendeedp prendedep prendedpe prendeedp prendeepd prendeped prendepde predenped predenpde predenepd predenedp
predendep predendpe predepned predepnde predepend predepedn predepden predepdne predeepnd predeepdn predeenpd
predeendp predeednp predeedpn prededpen prededpne prededepn prededenp predednep predednpe predneped prednepde
predneepd predneedp prednedep prednedpe prednpeed prednpede prednpeed prednpede prednpdee prednpdee predneped
prednepde predneepd predneedp prednedep prednedpe predndpee predndpee predndepe predndeep predndeep predndepe
predpneed predpnede predpneed predpnede predpndee predpndee predpened predpende predpeend predpeedn predpeden
predpedne predpeend predpeedn predpened predpende predpedne predpeden predpdeen predpdene predpdeen predpdene
predpdnee predpdnee predenped predenpde predenepd predenedp predendep predendpe predepned predepnde predepend
predepedn predepden predepdne predeepnd predeepdn predeenpd predeendp predeednp predeedpn prededpen prededpne
prededepn prededenp predednep predednpe preddnpee preddnpee preddnepe preddneep preddneep preddnepe preddpnee
preddpnee preddpene preddpeen preddpeen preddpene preddepne preddepen preddenpe preddenep preddeenp preddeepn
preddepen preddepne preddeepn preddeenp preddenep preddenpe preeendpd preeenddp preeenpdd preeenpdd preeendpd
preeenddp preeednpd preeedndp preeedpnd preeedpdn preeeddpn preeeddnp preeepdnd preeepddn preeepndd preeepndd
preeepdnd preeepddn preeeddpn preeeddnp preeedpdn preeedpnd preeednpd preeedndp preenedpd preeneddp preenepdd
preenepdd preenedpd preeneddp preendepd preendedp preendped preendpde preenddpe preenddep preenpded preenpdde
preenpedd preenpedd preenpded preenpdde preenddpe preenddep preendpde preendped preendepd preendedp preednepd
preednedp preednped preednpde preedndpe preedndep preedenpd preedendp preedepnd preedepdn preededpn preedednp
preedpend preedpedn preedpned preedpnde preedpdne preedpden preeddepn preeddenp preeddpen preeddpne preeddnpe
preeddnep preepnded preepndde preepnedd preepnedd preepnded preepndde preepdned preepdnde preepdend preepdedn
preepdden preepddne preepednd preepeddn preependd preependd preepednd preepeddn preepdden preepddne preepdedn
preepdend preepdned preepdnde preedndpe preedndep preednpde preednped preednepd preednedp preeddnpe preeddnep
preeddpne preeddpen preeddepn preeddenp preedpdne preedpden preedpnde preedpned preedpend preedpedn preededpn
preedednp preedepdn preedepnd preedenpd preedendp predendep predendpe predenedp predenepd predenped predenpde
predednep predednpe prededenp prededepn prededpen prededpne predeednp predeedpn predeendp predeenpd predeepnd
predeepdn predepden predepdne predepedn predepend predepned predepnde prednedep prednedpe predneedp predneepd
predneped prednepde predndeep predndepe predndeep predndepe predndpee predndpee prednedep prednedpe predneedp
predneepd predneped prednepde prednpdee prednpdee prednpede prednpeed prednpeed prednpede preddneep preddnepe
preddneep preddnepe preddnpee preddnpee preddenep preddenpe preddeenp preddeepn preddepen preddepne preddeenp
preddeepn preddenep preddenpe preddepne preddepen preddpeen preddpene preddpeen preddpene preddpnee preddpnee
predendep predendpe predenedp predenepd predenped predenpde predednep predednpe prededenp prededepn prededpen
prededpne predeednp predeedpn predeendp predeenpd predeepnd predeepdn predepden predepdne predepedn predepend
predepned predepnde predpndee predpndee predpnede predpneed predpneed predpnede predpdnee predpdnee predpdene
predpdeen predpdeen predpdene predpedne predpeden predpende predpened predpeend predpeedn predpeden predpedne
predpeedn predpeend predpened predpende prnpeeded prnpeedde prnpeeedd prnpeeedd prnpeeded prnpeedde prnpedeed
prnpedede prnpedeed prnpedede prnpeddee prnpeddee prnpeeded prnpeedde prnpeeedd prnpeeedd prnpeeded prnpeedde
prnpeddee prnpeddee prnpedede prnpedeed prnpedeed prnpedede prnpeeded prnpeedde prnpeeedd prnpeeedd prnpeeded
prnpeedde prnpedeed prnpedede prnpedeed prnpedede prnpeddee prnpeddee prnpeeded prnpeedde prnpeeedd prnpeeedd
prnpeeded prnpeedde prnpeddee prnpeddee prnpedede prnpedeed prnpedeed prnpedede prnpdeeed prnpdeede prnpdeeed
prnpdeede prnpdedee prnpdedee prnpdeeed prnpdeede prnpdeeed prnpdeede prnpdedee prnpdedee prnpdeeed prnpdeede
prnpdeeed prnpdeede prnpdedee prnpdedee prnpddeee prnpddeee prnpddeee prnpddeee prnpddeee prnpddeee prnpeeded
prnpeedde prnpeeedd prnpeeedd prnpeeded prnpeedde prnpedeed prnpedede prnpedeed prnpedede prnpeddee prnpeddee
prnpeeded prnpeedde prnpeeedd prnpeeedd prnpeeded prnpeedde prnpeddee prnpeddee prnpedede prnpedeed prnpedeed
prnpedede prnpdedee prnpdedee prnpdeede prnpdeeed prnpdeeed prnpdeede prnpddeee prnpddeee prnpddeee prnpddeee
prnpddeee prnpddeee prnpdedee prnpdedee prnpdeede prnpdeeed prnpdeeed prnpdeede prnpdedee prnpdedee prnpdeede
prnpdeeed prnpdeeed prnpdeede prnepeded prnepedde prnepeedd prnepeedd prnepeded prnepedde prnepdeed prnepdede
prnepdeed prnepdede prnepddee prnepddee prnepeded prnepedde prnepeedd prnepeedd prnepeded prnepedde prnepddee
prnepddee prnepdede prnepdeed prnepdeed prnepdede prneepded prneepdde prneepedd prneepedd prneepded prneepdde
prneedped prneedpde prneedepd prneededp prneeddep prneeddpe prneeedpd prneeeddp prneeepdd prneeepdd prneeedpd
prneeeddp prneeddep prneeddpe prneededp prneedepd prneedped prneedpde prnedeped prnedepde prnedeepd prnedeedp
prnededep prnededpe prnedpeed prnedpede prnedpeed prnedpede prnedpdee prnedpdee prnedeped prnedepde prnedeepd
prnedeedp prnededep prnededpe prneddpee prneddpee prneddepe prneddeep prneddeep prneddepe prneeedpd prneeeddp
prneeepdd prneeepdd prneeedpd prneeeddp prneedepd prneededp prneedped prneedpde prneeddpe prneeddep prneepded
prneepdde prneepedd prneepedd prneepded prneepdde prneeddpe prneeddep prneedpde prneedped prneedepd prneededp
prnededep prnededpe prnedeedp prnedeepd prnedeped prnedepde prneddeep prneddepe prneddeep prneddepe prneddpee
prneddpee prnededep prnededpe prnedeedp prnedeepd prnedeped prnedepde prnedpdee prnedpdee prnedpede prnedpeed
prnedpeed prnedpede prneepded prneepdde prneepedd prneepedd prneepded prneepdde prneedped prneedpde prneedepd
prneededp prneeddep prneeddpe prneeedpd prneeeddp prneeepdd prneeepdd prneeedpd prneeeddp prneeddep prneeddpe
prneededp prneedepd prneedped prneedpde prnepeded prnepedde prnepeedd prnepeedd prnepeded prnepedde prnepdeed
prnepdede prnepdeed prnepdede prnepddee prnepddee prnepeded prnepedde prnepeedd prnepeedd prnepeded prnepedde
prnepddee prnepddee prnepdede prnepdeed prnepdeed prnepdede prnedpeed prnedpede prnedpeed prnedpede prnedpdee
prnedpdee prnedeped prnedepde prnedeepd prnedeedp prnededep prnededpe prnedeepd prnedeedp prnedeped prnedepde
prnededpe prnededep prneddeep prneddepe prneddeep prneddepe prneddpee prneddpee prneepded prneepdde prneepedd
prneepedd prneepded prneepdde prneedped prneedpde prneedepd prneededp prneeddep prneeddpe prneeedpd prneeeddp
prneeepdd prneeepdd prneeedpd prneeeddp prneeddep prneeddpe prneededp prneedepd prneedped prneedpde prnedpdee
prnedpdee prnedpede prnedpeed prnedpeed prnedpede prneddpee prneddpee prneddepe prneddeep prneddeep prneddepe
prnededpe prnededep prnedepde prnedeped prnedeepd prnedeedp prnededep prnededpe prnedeedp prnedeepd prnedeped
prnedepde prndeeped prndeepde prndeeepd prndeeedp prndeedep prndeedpe prndepeed prndepede prndepeed prndepede
prndepdee prndepdee prndeeped prndeepde prndeeepd prndeeedp prndeedep prndeedpe prndedpee prndedpee prndedepe
prndedeep prndedeep prndedepe prndeeped prndeepde prndeeepd prndeeedp prndeedep prndeedpe prndepeed prndepede
prndepeed prndepede prndepdee prndepdee prndeeped prndeepde prndeeepd prndeeedp prndeedep prndeedpe prndedpee
prndedpee prndedepe prndedeep prndedeep prndedepe prndpeeed prndpeede prndpeeed prndpeede prndpedee prndpedee
prndpeeed prndpeede prndpeeed prndpeede prndpedee prndpedee prndpeeed prndpeede prndpeeed prndpeede prndpedee
prndpedee prndpdeee prndpdeee prndpdeee prndpdeee prndpdeee prndpdeee prndeeped prndeepde prndeeepd prndeeedp
prndeedep prndeedpe prndepeed prndepede prndepeed prndepede prndepdee prndepdee prndeeped prndeepde prndeeepd
prndeeedp prndeedep prndeedpe prndedpee prndedpee prndedepe prndedeep prndedeep prndedepe prnddepee prnddepee
prnddeepe prnddeeep prnddeeep prnddeepe prnddpeee prnddpeee prnddpeee prnddpeee prnddpeee prnddpeee prnddepee
prnddepee prnddeepe prnddeeep prnddeeep prnddeepe prnddepee prnddepee prnddeepe prnddeeep prnddeeep prnddeepe
prneeedpd prneeeddp prneeepdd prneeepdd prneeedpd prneeeddp prneedepd prneededp prneedped prneedpde prneeddpe
prneeddep prneepded prneepdde prneepedd prneepedd prneepded prneepdde prneeddpe prneeddep prneedpde prneedped
prneedepd prneededp prneeedpd prneeeddp prneeepdd prneeepdd prneeedpd prneeeddp prneedepd prneededp prneedped
prneedpde prneeddpe prneeddep prneepded prneepdde prneepedd prneepedd prneepded prneepdde prneeddpe prneeddep
prneedpde prneedped prneedepd prneededp prnedeepd prnedeedp prnedeped prnedepde prnededpe prnededep prnedeepd
prnedeedp prnedeped prnedepde prnededpe prnededep prnedpeed prnedpede prnedpeed prnedpede prnedpdee prnedpdee
prneddepe prneddeep prneddpee prneddpee prneddepe prneddeep prnepeded prnepedde prnepeedd prnepeedd prnepeded
prnepedde prnepdeed prnepdede prnepdeed prnepdede prnepddee prnepddee prnepeded prnepedde prnepeedd prnepeedd
prnepeded prnepedde prnepddee prnepddee prnepdede prnepdeed prnepdeed prnepdede prnededpe prnededep prnedepde
prnedeped prnedeepd prnedeedp prneddepe prneddeep prneddpee prneddpee prneddepe prneddeep prnedpdee prnedpdee
prnedpede prnedpeed prnedpeed prnedpede prnededpe prnededep prnedepde prnedeped prnedeepd prnedeedp prndeedep
prndeedpe prndeeedp prndeeepd prndeeped prndeepde prndedeep prndedepe prndedeep prndedepe prndedpee prndedpee
prndeedep prndeedpe prndeeedp prndeeepd prndeeped prndeepde prndepdee prndepdee prndepede prndepeed prndepeed
prndepede prndeedep prndeedpe prndeeedp prndeeepd prndeeped prndeepde prndedeep prndedepe prndedeep prndedepe
prndedpee prndedpee prndeedep prndeedpe prndeeedp prndeeepd prndeeped prndeepde prndepdee prndepdee prndepede
prndepeed prndepeed prndepede prnddeeep prnddeepe prnddeeep prnddeepe prnddepee prnddepee prnddeeep prnddeepe
prnddeeep prnddeepe prnddepee prnddepee prnddeeep prnddeepe prnddeeep prnddeepe prnddepee prnddepee prnddpeee
prnddpeee prnddpeee prnddpeee prnddpeee prnddpeee prndeedep prndeedpe prndeeedp prndeeepd prndeeped prndeepde
prndedeep prndedepe prndedeep prndedepe prndedpee prndedpee prndeedep prndeedpe prndeeedp prndeeepd prndeeped
prndeepde prndepdee prndepdee prndepede prndepeed prndepeed prndepede prndpedee prndpedee prndpeede prndpeeed
prndpeeed prndpeede prndpdeee prndpdeee prndpdeee prndpdeee prndpdeee prndpdeee prndpedee prndpedee prndpeede
prndpeeed prndpeeed prndpeede prndpedee prndpedee prndpeede prndpeeed prndpeeed prndpeede prdpeneed prdpenede
prdpeneed prdpenede prdpendee prdpendee prdpeened prdpeende prdpeeend prdpeeedn prdpeeden prdpeedne prdpeeend
prdpeeedn prdpeened prdpeende prdpeedne prdpeeden prdpedeen prdpedene prdpedeen prdpedene prdpednee prdpednee
prdpneeed prdpneede prdpneeed prdpneede prdpnedee prdpnedee prdpneeed prdpneede prdpneeed prdpneede prdpnedee
prdpnedee prdpneeed prdpneede prdpneeed prdpneede prdpnedee prdpnedee prdpndeee prdpndeee prdpndeee prdpndeee
prdpndeee prdpndeee prdpeneed prdpenede prdpeneed prdpenede prdpendee prdpendee prdpeened prdpeende prdpeeend
prdpeeedn prdpeeden prdpeedne prdpeeend prdpeeedn prdpeened prdpeende prdpeedne prdpeeden prdpedeen prdpedene
prdpedeen prdpedene prdpednee prdpednee prdpeneed prdpenede prdpeneed prdpenede prdpendee prdpendee prdpeened
prdpeende prdpeeend prdpeeedn prdpeeden prdpeedne prdpeeend prdpeeedn prdpeened prdpeende prdpeedne prdpeeden
prdpedeen prdpedene prdpedeen prdpedene prdpednee prdpednee prdpdneee prdpdneee prdpdneee prdpdneee prdpdneee
prdpdneee prdpdenee prdpdenee prdpdeene prdpdeeen prdpdeeen prdpdeene prdpdeene prdpdeeen prdpdenee prdpdenee
prdpdeene prdpdeeen prdpdeeen prdpdeene prdpdeeen prdpdeene prdpdenee prdpdenee prdepneed prdepnede prdepneed
prdepnede prdepndee prdepndee prdepened prdepende prdepeend prdepeedn prdepeden prdepedne prdepeend prdepeedn
prdepened prdepende prdepedne prdepeden prdepdeen prdepdene prdepdeen prdepdene prdepdnee prdepdnee prdenpeed
prdenpede prdenpeed prdenpede prdenpdee prdenpdee prdeneped prdenepde prdeneepd prdeneedp prdenedep prdenedpe
prdeneepd prdeneedp prdeneped prdenepde prdenedpe prdenedep prdendeep prdendepe prdendeep prdendepe prdendpee
prdendpee prdeenped prdeenpde prdeenepd prdeenedp prdeendep prdeendpe prdeepned prdeepnde prdeepend prdeepedn
prdeepden prdeepdne prdeeepnd prdeeepdn prdeeenpd prdeeendp prdeeednp prdeeedpn prdeedpen prdeedpne prdeedepn
prdeedenp prdeednep prdeednpe prdeenepd prdeenedp prdeenped prdeenpde prdeendpe prdeendep prdeeenpd prdeeendp
prdeeepnd prdeeepdn prdeeedpn prdeeednp prdeepend prdeepedn prdeepned prdeepnde prdeepdne prdeepden prdeedepn
prdeedenp prdeedpen prdeedpne prdeednpe prdeednep prdedneep prdednepe prdedneep prdednepe prdednpee prdednpee
prdedenep prdedenpe prdedeenp prdedeepn prdedepen prdedepne prdedeenp prdedeepn prdedenep prdedenpe prdedepne
prdedepen prdedpeen prdedpene prdedpeen prdedpene prdedpnee prdedpnee prdnepeed prdnepede prdnepeed prdnepede
prdnepdee prdnepdee prdneeped prdneepde prdneeepd prdneeedp prdneedep prdneedpe prdneeepd prdneeedp prdneeped
prdneepde prdneedpe prdneedep prdnedeep prdnedepe prdnedeep prdnedepe prdnedpee prdnedpee prdnpeeed prdnpeede
prdnpeeed prdnpeede prdnpedee prdnpedee prdnpeeed prdnpeede prdnpeeed prdnpeede prdnpedee prdnpedee prdnpeeed
prdnpeede prdnpeeed prdnpeede prdnpedee prdnpedee prdnpdeee prdnpdeee prdnpdeee prdnpdeee prdnpdeee prdnpdeee
prdnepeed prdnepede prdnepeed prdnepede prdnepdee prdnepdee prdneeped prdneepde prdneeepd prdneeedp prdneedep
prdneedpe prdneeepd prdneeedp prdneeped prdneepde prdneedpe prdneedep prdnedeep prdnedepe prdnedeep prdnedepe
prdnedpee prdnedpee prdnepeed prdnepede prdnepeed prdnepede prdnepdee prdnepdee prdneeped prdneepde prdneeepd
prdneeedp prdneedep prdneedpe prdneeepd prdneeedp prdneeped prdneepde prdneedpe prdneedep prdnedeep prdnedepe
prdnedeep prdnedepe prdnedpee prdnedpee prdndpeee prdndpeee prdndpeee prdndpeee prdndpeee prdndpeee prdndepee
prdndepee prdndeepe prdndeeep prdndeeep prdndeepe prdndeepe prdndeeep prdndepee prdndepee prdndeepe prdndeeep
prdndeeep prdndeepe prdndeeep prdndeepe prdndepee prdndepee prdeenped prdeenpde prdeenepd prdeenedp prdeendep
prdeendpe prdeepned prdeepnde prdeepend prdeepedn prdeepden prdeepdne prdeeepnd prdeeepdn prdeeenpd prdeeendp
prdeeednp prdeeedpn prdeedpen prdeedpne prdeedepn prdeedenp prdeednep prdeednpe prdeneped prdenepde prdeneepd
prdeneedp prdenedep prdenedpe prdenpeed prdenpede prdenpeed prdenpede prdenpdee prdenpdee prdeneped prdenepde
prdeneepd prdeneedp prdenedep prdenedpe prdendpee prdendpee prdendepe prdendeep prdendeep prdendepe prdepneed
prdepnede prdepneed prdepnede prdepndee prdepndee prdepened prdepende prdepeend prdepeedn prdepeden prdepedne
prdepeend prdepeedn prdepened prdepende prdepedne prdepeden prdepdeen prdepdene prdepdeen prdepdene prdepdnee
prdepdnee prdeenped prdeenpde prdeenepd prdeenedp prdeendep prdeendpe prdeepned prdeepnde prdeepend prdeepedn
prdeepden prdeepdne prdeeepnd prdeeepdn prdeeenpd prdeeendp prdeeednp prdeeedpn prdeedpen prdeedpne prdeedepn
prdeedenp prdeednep prdeednpe prdednpee prdednpee prdednepe prdedneep prdedneep prdednepe prdedpnee prdedpnee
prdedpene prdedpeen prdedpeen prdedpene prdedepne prdedepen prdedenpe prdedenep prdedeenp prdedeepn prdedepen
prdedepne prdedeepn prdedeenp prdedenep prdedenpe prdeenepd prdeenedp prdeenped prdeenpde prdeendpe prdeendep
prdeeenpd prdeeendp prdeeepnd prdeeepdn prdeeedpn prdeeednp prdeepend prdeepedn prdeepned prdeepnde prdeepdne
prdeepden prdeedepn prdeedenp prdeedpen prdeedpne prdeednpe prdeednep prdeneepd prdeneedp prdeneped prdenepde
prdenedpe prdenedep prdeneepd prdeneedp prdeneped prdenepde prdenedpe prdenedep prdenpeed prdenpede prdenpeed
prdenpede prdenpdee prdenpdee prdendepe prdendeep prdendpee prdendpee prdendepe prdendeep prdeenepd prdeenedp
prdeenped prdeenpde prdeendpe prdeendep prdeeenpd prdeeendp prdeeepnd prdeeepdn prdeeedpn prdeeednp prdeepend
prdeepedn prdeepned prdeepnde prdeepdne prdeepden prdeedepn prdeedenp prdeedpen prdeedpne prdeednpe prdeednep
prdepneed prdepnede prdepneed prdepnede prdepndee prdepndee prdepened prdepende prdepeend prdepeedn prdepeden
prdepedne prdepeend prdepeedn prdepened prdepende prdepedne prdepeden prdepdeen prdepdene prdepdeen prdepdene
prdepdnee prdepdnee prdednepe prdedneep prdednpee prdednpee prdednepe prdedneep prdedenpe prdedenep prdedepne
prdedepen prdedeepn prdedeenp prdedpene prdedpeen prdedpnee prdedpnee prdedpene prdedpeen prdedeepn prdedeenp
prdedepen prdedepne prdedenpe prdedenep prddeneep prddenepe prddeneep prddenepe prddenpee prddenpee prddeenep
prddeenpe prddeeenp prddeeepn prddeepen prddeepne prddeeenp prddeeepn prddeenep prddeenpe prddeepne prddeepen
prddepeen prddepene prddepeen prddepene prddepnee prddepnee prddneeep prddneepe prddneeep prddneepe prddnepee
prddnepee prddneeep prddneepe prddneeep prddneepe prddnepee prddnepee prddneeep prddneepe prddneeep prddneepe
prddnepee prddnepee prddnpeee prddnpeee prddnpeee prddnpeee prddnpeee prddnpeee prddeneep prddenepe prddeneep
prddenepe prddenpee prddenpee prddeenep prddeenpe prddeeenp prddeeepn prddeepen prddeepne prddeeenp prddeeepn
prddeenep prddeenpe prddeepne prddeepen prddepeen prddepene prddepeen prddepene prddepnee prddepnee prddeneep
prddenepe prddeneep prddenepe prddenpee prddenpee prddeenep prddeenpe prddeeenp prddeeepn prddeepen prddeepne
prddeeenp prddeeepn prddeenep prddeenpe prddeepne prddeepen prddepeen prddepene prddepeen prddepene prddepnee
prddepnee prddpneee prddpneee prddpneee prddpneee prddpneee prddpneee prddpenee prddpenee prddpeene prddpeeen
prddpeeen prddpeene prddpeene prddpeeen prddpenee prddpenee prddpeene prddpeeen prddpeeen prddpeene prddpeeen
prddpeene prddpenee prddpenee prepended prependde prepenedd prepenedd prepended prependde prepedned prepednde
prepedend prepededn prepedden prepeddne prepeednd prepeeddn prepeendd prepeendd prepeednd prepeeddn prepedden
prepeddne prepededn prepedend prepedned prepednde prepneded prepnedde prepneedd prepneedd prepneded prepnedde
prepndeed prepndede prepndeed prepndede prepnddee prepnddee prepneded prepnedde prepneedd prepneedd prepneded
prepnedde prepnddee prepnddee prepndede prepndeed prepndeed prepndede prepdneed prepdnede prepdneed prepdnede
prepdndee prepdndee prepdened prepdende prepdeend prepdeedn prepdeden prepdedne prepdeend prepdeedn prepdened
prepdende prepdedne prepdeden prepddeen prepddene prepddeen prepddene prepddnee prepddnee prepended prependde
prepenedd prepenedd prepended prependde prepedned prepednde prepedend prepededn prepedden prepeddne prepeednd
prepeeddn prepeendd prepeendd prepeednd prepeeddn prepedden prepeddne prepededn prepedend prepedned prepednde
prepdndee prepdndee prepdnede prepdneed prepdneed prepdnede prepddnee prepddnee prepddene prepddeen prepddeen
prepddene prepdedne prepdeden prepdende prepdened prepdeend prepdeedn prepdeden prepdedne prepdeedn prepdeend
prepdened prepdende preepnded preepndde preepnedd preepnedd preepnded preepndde preepdned preepdnde preepdend
preepdedn preepdden preepddne preepednd preepeddn preependd preependd preepednd preepeddn preepdden preepddne
preepdedn preepdend preepdned preepdnde preenpded preenpdde preenpedd preenpedd preenpded preenpdde preendped
preendpde preendepd preendedp preenddep preenddpe preenedpd preeneddp preenepdd preenepdd preenedpd preeneddp
preenddep preenddpe preendedp preendepd preendped preendpde preednped preednpde preednepd preednedp preedndep
preedndpe preedpned preedpnde preedpend preedpedn preedpden preedpdne preedepnd preedepdn preedenpd preedendp
preedednp preededpn preeddpen preeddpne preeddepn preeddenp preeddnep preeddnpe preeendpd preeenddp preeenpdd
preeenpdd preeendpd preeenddp preeednpd preeedndp preeedpnd preeedpdn preeeddpn preeeddnp preeepdnd preeepddn
preeepndd preeepndd preeepdnd preeepddn preeeddpn preeeddnp preeedpdn preeedpnd preeednpd preeedndp preedndep
preedndpe preednedp preednepd preednped preednpde preeddnep preeddnpe preeddenp preeddepn preeddpen preeddpne
preedednp preededpn preedendp preedenpd preedepnd preedepdn preedpden preedpdne preedpedn preedpend preedpned
preedpnde prenepded prenepdde prenepedd prenepedd prenepded prenepdde prenedped prenedpde prenedepd prenededp
preneddep preneddpe preneedpd preneeddp preneepdd preneepdd preneedpd preneeddp preneddep preneddpe prenededp
prenedepd prenedped prenedpde prenpeded prenpedde prenpeedd prenpeedd prenpeded prenpedde prenpdeed prenpdede
prenpdeed prenpdede prenpddee prenpddee prenpeded prenpedde prenpeedd prenpeedd prenpeded prenpedde prenpddee
prenpddee prenpdede prenpdeed prenpdeed prenpdede prendpeed prendpede prendpeed prendpede prendpdee prendpdee
prendeped prendepde prendeepd prendeedp prendedep prendedpe prendeepd prendeedp prendeped prendepde prendedpe
prendedep prenddeep prenddepe prenddeep prenddepe prenddpee prenddpee prenepded prenepdde prenepedd prenepedd
prenepded prenepdde prenedped prenedpde prenedepd prenededp preneddep preneddpe preneedpd preneeddp preneepdd
preneepdd preneedpd preneeddp preneddep preneddpe prenededp prenedepd prenedped prenedpde prendpdee prendpdee
prendpede prendpeed prendpeed prendpede prenddpee prenddpee prenddepe prenddeep prenddeep prenddepe prendedpe
prendedep prendepde prendeped prendeepd prendeedp prendedep prendedpe prendeedp prendeepd prendeped prendepde
predenped predenpde predenepd predenedp predendep predendpe predepned predepnde predepend predepedn predepden
predepdne predeepnd predeepdn predeenpd predeendp predeednp predeedpn prededpen prededpne prededepn prededenp
predednep predednpe predneped prednepde predneepd predneedp prednedep prednedpe prednpeed prednpede prednpeed
prednpede prednpdee prednpdee predneped prednepde predneepd predneedp prednedep prednedpe predndpee predndpee
predndepe predndeep predndeep predndepe predpneed predpnede predpneed predpnede predpndee predpndee predpened
predpende predpeend predpeedn predpeden predpedne predpeend predpeedn predpened predpende predpedne predpeden
predpdeen predpdene predpdeen predpdene predpdnee predpdnee predenped predenpde predenepd predenedp predendep
predendpe predepned predepnde predepend predepedn predepden predepdne predeepnd predeepdn predeenpd predeendp
predeednp predeedpn prededpen prededpne prededepn prededenp predednep predednpe preddnpee preddnpee preddnepe
preddneep preddneep preddnepe preddpnee preddpnee preddpene preddpeen preddpeen preddpene preddepne preddepen
preddenpe preddenep preddeenp preddeepn preddepen preddepne preddeepn preddeenp preddenep preddenpe preeendpd
preeenddp preeenpdd preeenpdd preeendpd preeenddp preeednpd preeedndp preeedpnd preeedpdn preeeddpn preeeddnp
preeepdnd preeepddn preeepndd preeepndd preeepdnd preeepddn preeeddpn preeeddnp preeedpdn preeedpnd preeednpd
preeedndp preenedpd preeneddp preenepdd preenepdd preenedpd preeneddp preendepd preendedp preendped preendpde
preenddpe preenddep preenpded preenpdde preenpedd preenpedd preenpded preenpdde preenddpe preenddep preendpde
preendped preendepd preendedp preednepd preednedp preednped preednpde preedndpe preedndep preedenpd preedendp
preedepnd preedepdn preededpn preedednp preedpend preedpedn preedpned preedpnde preedpdne preedpden preeddepn
preeddenp preeddpen preeddpne preeddnpe preeddnep preepnded preepndde preepnedd preepnedd preepnded preepndde
preepdned preepdnde preepdend preepdedn preepdden preepddne preepednd preepeddn preependd preependd preepednd
preepeddn preepdden preepddne preepdedn preepdend preepdned preepdnde preedndpe preedndep preednpde preednped
preednepd preednedp preeddnpe preeddnep preeddpne preeddpen preeddepn preeddenp preedpdne preedpden preedpnde
preedpned preedpend preedpedn preededpn preedednp preedepdn preedepnd preedenpd preedendp predendep predendpe
predenedp predenepd predenped predenpde predednep predednpe prededenp prededepn prededpen prededpne predeednp
predeedpn predeendp predeenpd predeepnd predeepdn predepden predepdne predepedn predepend predepned predepnde
prednedep prednedpe predneedp predneepd predneped prednepde predndeep predndepe predndeep predndepe predndpee
predndpee prednedep prednedpe predneedp predneepd predneped prednepde prednpdee prednpdee prednpede prednpeed
prednpeed prednpede preddneep preddnepe preddneep preddnepe preddnpee preddnpee preddenep preddenpe preddeenp
preddeepn preddepen preddepne preddeenp preddeepn preddenep preddenpe preddepne preddepen preddpeen preddpene
preddpeen preddpene preddpnee preddpnee predendep predendpe predenedp predenepd predenped predenpde predednep
predednpe prededenp prededepn prededpen prededpne predeednp predeedpn predeendp predeenpd predeepnd predeepdn
predepden predepdne predepedn predepend predepned predepnde predpndee predpndee predpnede predpneed predpneed
predpnede predpdnee predpdnee predpdene predpdeen predpdeen predpdene predpedne predpeden predpende predpened
predpeend predpeedn predpeden predpedne predpeedn predpeend predpened predpende prdpendee prdpendee prdpenede
prdpeneed prdpeneed prdpenede prdpednee prdpednee prdpedene prdpedeen prdpedeen prdpedene prdpeedne prdpeeden
prdpeende prdpeened prdpeeend prdpeeedn prdpeeden prdpeedne prdpeeedn prdpeeend prdpeened prdpeende prdpnedee
prdpnedee prdpneede prdpneeed prdpneeed prdpneede prdpndeee prdpndeee prdpndeee prdpndeee prdpndeee prdpndeee
prdpnedee prdpnedee prdpneede prdpneeed prdpneeed prdpneede prdpnedee prdpnedee prdpneede prdpneeed prdpneeed
prdpneede prdpdneee prdpdneee prdpdneee prdpdneee prdpdneee prdpdneee prdpdenee prdpdenee prdpdeene prdpdeeen
prdpdeeen prdpdeene prdpdeene prdpdeeen prdpdenee prdpdenee prdpdeene prdpdeeen prdpdeeen prdpdeene prdpdeeen
prdpdeene prdpdenee prdpdenee prdpendee prdpendee prdpenede prdpeneed prdpeneed prdpenede prdpednee prdpednee
prdpedene prdpedeen prdpedeen prdpedene prdpeedne prdpeeden prdpeende prdpeened prdpeeend prdpeeedn prdpeeden
prdpeedne prdpeeedn prdpeeend prdpeened prdpeende prdpendee prdpendee prdpenede prdpeneed prdpeneed prdpenede
prdpednee prdpednee prdpedene prdpedeen prdpedeen prdpedene prdpeedne prdpeeden prdpeende prdpeened prdpeeend
prdpeeedn prdpeeden prdpeedne prdpeeedn prdpeeend prdpeened prdpeende prdepndee prdepndee prdepnede prdepneed
prdepneed prdepnede prdepdnee prdepdnee prdepdene prdepdeen prdepdeen prdepdene prdepedne prdepeden prdepende
prdepened prdepeend prdepeedn prdepeden prdepedne prdepeedn prdepeend prdepened prdepende prdenpdee prdenpdee
prdenpede prdenpeed prdenpeed prdenpede prdendpee prdendpee prdendepe prdendeep prdendeep prdendepe prdenedpe
prdenedep prdenepde prdeneped prdeneepd prdeneedp prdenedep prdenedpe prdeneedp prdeneepd prdeneped prdenepde
prdednpee prdednpee prdednepe prdedneep prdedneep prdednepe prdedpnee prdedpnee prdedpene prdedpeen prdedpeen
prdedpene prdedepne prdedepen prdedenpe prdedenep prdedeenp prdedeepn prdedepen prdedepne prdedeepn prdedeenp
prdedenep prdedenpe prdeendpe prdeendep prdeenpde prdeenped prdeenepd prdeenedp prdeednpe prdeednep prdeedpne
prdeedpen prdeedepn prdeedenp prdeepdne prdeepden prdeepnde prdeepned prdeepend prdeepedn prdeeedpn prdeeednp
prdeeepdn prdeeepnd prdeeenpd prdeeendp prdeendep prdeendpe prdeenedp prdeenepd prdeenped prdeenpde prdeednep
prdeednpe prdeedenp prdeedepn prdeedpen prdeedpne prdeeednp prdeeedpn prdeeendp prdeeenpd prdeeepnd prdeeepdn
prdeepden prdeepdne prdeepedn prdeepend prdeepned prdeepnde prdnepdee prdnepdee prdnepede prdnepeed prdnepeed
prdnepede prdnedpee prdnedpee prdnedepe prdnedeep prdnedeep prdnedepe prdneedpe prdneedep prdneepde prdneeped
prdneeepd prdneeedp prdneedep prdneedpe prdneeedp prdneeepd prdneeped prdneepde prdnpedee prdnpedee prdnpeede
prdnpeeed prdnpeeed prdnpeede prdnpdeee prdnpdeee prdnpdeee prdnpdeee prdnpdeee prdnpdeee prdnpedee prdnpedee
prdnpeede prdnpeeed prdnpeeed prdnpeede prdnpedee prdnpedee prdnpeede prdnpeeed prdnpeeed prdnpeede prdndpeee
prdndpeee prdndpeee prdndpeee prdndpeee prdndpeee prdndepee prdndepee prdndeepe prdndeeep prdndeeep prdndeepe
prdndeepe prdndeeep prdndepee prdndepee prdndeepe prdndeeep prdndeeep prdndeepe prdndeeep prdndeepe prdndepee
prdndepee prdnepdee prdnepdee prdnepede prdnepeed prdnepeed prdnepede prdnedpee prdnedpee prdnedepe prdnedeep
prdnedeep prdnedepe prdneedpe prdneedep prdneepde prdneeped prdneeepd prdneeedp prdneedep prdneedpe prdneeedp
prdneeepd prdneeped prdneepde prdnepdee prdnepdee prdnepede prdnepeed prdnepeed prdnepede prdnedpee prdnedpee
prdnedepe prdnedeep prdnedeep prdnedepe prdneedpe prdneedep prdneepde prdneeped prdneeepd prdneeedp prdneedep
prdneedpe prdneeedp prdneeepd prdneeped prdneepde prddenpee prddenpee prddenepe prddeneep prddeneep prddenepe
prddepnee prddepnee prddepene prddepeen prddepeen prddepene prddeepne prddeepen prddeenpe prddeenep prddeeenp
prddeeepn prddeepen prddeepne prddeeepn prddeeenp prddeenep prddeenpe prddnepee prddnepee prddneepe prddneeep
prddneeep prddneepe prddnpeee prddnpeee prddnpeee prddnpeee prddnpeee prddnpeee prddnepee prddnepee prddneepe
prddneeep prddneeep prddneepe prddnepee prddnepee prddneepe prddneeep prddneeep prddneepe prddpneee prddpneee
prddpneee prddpneee prddpneee prddpneee prddpenee prddpenee prddpeene prddpeeen prddpeeen prddpeene prddpeene
prddpeeen prddpenee prddpenee prddpeene prddpeeen prddpeeen prddpeene prddpeeen prddpeene prddpenee prddpenee
prddenpee prddenpee prddenepe prddeneep prddeneep prddenepe prddepnee prddepnee prddepene prddepeen prddepeen
prddepene prddeepne prddeepen prddeenpe prddeenep prddeeenp prddeeepn prddeepen prddeepne prddeeepn prddeeenp
prddeenep prddeenpe prddenpee prddenpee prddenepe prddeneep prddeneep prddenepe prddepnee prddepnee prddepene
prddepeen prddepeen prddepene prddeepne prddeepen prddeenpe prddeenep prddeeenp prddeeepn prddeepen prddeepne
prddeeepn prddeeenp prddeenep prddeenpe prdeendpe prdeendep prdeenpde prdeenped prdeenepd prdeenedp prdeednpe
prdeednep prdeedpne prdeedpen prdeedepn prdeedenp prdeepdne prdeepden prdeepnde prdeepned prdeepend prdeepedn
prdeeedpn prdeeednp prdeeepdn prdeeepnd prdeeenpd prdeeendp prdenedpe prdenedep prdenepde prdeneped prdeneepd
prdeneedp prdendepe prdendeep prdendpee prdendpee prdendepe prdendeep prdenpdee prdenpdee prdenpede prdenpeed
prdenpeed prdenpede prdenedpe prdenedep prdenepde prdeneped prdeneepd prdeneedp prdednepe prdedneep prdednpee
prdednpee prdednepe prdedneep prdedenpe prdedenep prdedepne prdedepen prdedeepn prdedeenp prdedpene prdedpeen
prdedpnee prdedpnee prdedpene prdedpeen prdedeepn prdedeenp prdedepen prdedepne prdedenpe prdedenep prdepndee
prdepndee prdepnede prdepneed prdepneed prdepnede prdepdnee prdepdnee prdepdene prdepdeen prdepdeen prdepdene
prdepedne prdepeden prdepende prdepened prdepeend prdepeedn prdepeden prdepedne prdepeedn prdepeend prdepened
prdepende prdeendpe prdeendep prdeenpde prdeenped prdeenepd prdeenedp prdeednpe prdeednep prdeedpne prdeedpen
prdeedepn prdeedenp prdeepdne prdeepden prdeepnde prdeepned prdeepend prdeepedn prdeeedpn prdeeednp prdeeepdn
prdeeepnd prdeeenpd prdeeendp prdeendep prdeendpe prdeenedp prdeenepd prdeenped prdeenpde prdeednep prdeednpe
prdeedenp prdeedepn prdeedpen prdeedpne prdeeednp prdeeedpn prdeeendp prdeeenpd prdeeepnd prdeeepdn prdeepden
prdeepdne prdeepedn prdeepend prdeepned prdeepnde prdenedep prdenedpe prdeneedp prdeneepd prdeneped prdenepde
prdendeep prdendepe prdendeep prdendepe prdendpee prdendpee prdenedep prdenedpe prdeneedp prdeneepd prdeneped
prdenepde prdenpdee prdenpdee prdenpede prdenpeed prdenpeed prdenpede prdedneep prdednepe prdedneep prdednepe
prdednpee prdednpee prdedenep prdedenpe prdedeenp prdedeepn prdedepen prdedepne prdedeenp prdedeepn prdedenep
prdedenpe prdedepne prdedepen prdedpeen prdedpene prdedpeen prdedpene prdedpnee prdedpnee prdeendep prdeendpe
prdeenedp prdeenepd prdeenped prdeenpde prdeednep prdeednpe prdeedenp prdeedepn prdeedpen prdeedpne prdeeednp
prdeeedpn prdeeendp prdeeenpd prdeeepnd prdeeepdn prdeepden prdeepdne prdeepedn prdeepend prdeepned prdeepnde
prdepndee prdepndee prdepnede prdepneed prdepneed prdepnede prdepdnee prdepdnee prdepdene prdepdeen prdepdeen
prdepdene prdepedne prdepeden prdepende prdepened prdepeend prdepeedn prdepeden prdepedne prdepeedn prdepeend
prdepened prdepende

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us