easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

kerry

ricochet

decomponible

rotalia

minnifield

pcroger

pelissier

umbriferus

moderantist

phalangid

implevissemusque

augustyn

phineus

jenice

avouches

condescendingness

plebificate

hurlbarrow


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: premunturque
cipher variations:
qsfnvouvsrvf rtgowpvwtswg suhpxqwxutxh tviqyrxyvuyi uwjrzsyzwvzj
vxksatzaxwak wyltbuabyxbl xzmucvbczycm yanvdwcdazdn zbowexdebaeo
acpxfyefcbfp bdqygzfgdcgq cerzhaghedhr dfsaibhifeis egtbjcijgfjt
fhuckdjkhgku givdleklihlv hjwemflmjimw ikxfngmnkjnx jlygohnolkoy
kmzhpiopmlpz lnaiqjpqnmqa mobjrkqronrb npckslrsposc oqdltmstqptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: premunturque
Cipher: kivnfmgfijfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: premunturque
Cipher: ABBBA BAAAA AABAA ABABB BAABB ABBAA BAABA BAABB BAAAA ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: premunturque
cipher variations:
qsfnvouvsrvfuanljogjaxjnyivjxosxidxvcqdhloelqjldgylfzoqzypzlkgtdnocngvntswjzpoapwhpjwerxdomdendr
amzvroyrmtrzeuhtfokfuzfhicprtowtcftpmkxphoihklhxrtgowpvwtswgvbomkphkbykozjwkyptyjeywdreimpfmrkme
hzmgaprazqamlhueopdohwoutxkaqpbqxiqkxfsyepnefoesbnawspzsnusafviugplgvagijdqsupxudguqnlyqipjilmiy
suhpxqwxutxhwcpnlqilczlpakxlzquzkfzxesfjnqgnslnfianhbqsbarbnmivfpqepixpvuylbrqcryjrlygtzfqofgpft
cobxtqatovtbgwjvhqmhwbhjkertvqyvehvromzrjqkjmnjztviqyrxyvuyixdqomrjmdamqblymarvalgayftgkorhotmog
jboicrtcbsconjwgqrfqjyqwvzmcsrdszksmzhuagrpghqgudpcyurbupwuchxkwirnixciklfsuwrzwfiwspnaskrlknoka
uwjrzsyzwvzjyerpnsknebnrcmznbswbmhbzguhlpsipunphkcpjdsudctdpokxhrsgrkzrxwandtsetaltnaivbhsqhirhv
eqdzvscvqxvdiylxjsojydjlmgtvxsaxgjxtqobtlsmloplbvxksatzaxwakzfsqotlofcosdnaoctxcnicahvimqtjqvoqi
ldqketvedueqplyisthslasyxboeutfubmuobjwcitrijsiwfreawtdwrywejzmyktpkzekmnhuwytbyhkyurpcumtnmpqmc
wyltbuabyxblagtrpumpgdpteobpduydojdbiwjnrukrwprjmerlfuwfevfrqmzjtuitmbtzycpfvugvcnvpckxdjusjktjx
gsfbxuexszxfkanzluqlaflnoivxzuczilzvsqdvnuonqrndxzmucvbczycmbhusqvnqhequfpcqevzepkecjxkosvlsxqsk
nfsmgvxgfwgsrnakuvjuncuazdqgwvhwdowqdlyekvtklukyhtgcyvfytayglboamvrmbgmopjwyavdajmawtrewovporsoe
yanvdwcdazdncivtrworifrvgqdrfwafqlfdkylptwmtyrtlogtnhwyhgxhtsoblvwkvodvbaerhxwixepxremzflwulmvlz
iuhdzwgzubzhmcpbnwsnchnpqkxzbwebknbxusfxpwqpstpfzbowexdebaeodjwusxpsjgswhresgxbgrmgelzmquxnuzsum
phuoixzihyiutpcmwxlwpewcbfsiyxjyfqysfnagmxvmnwmajvieaxhavcaindqcoxtodioqrlyacxfclocyvtgyqxrqtuqg
acpxfyefcbfpekxvtyqtkhtxisfthychsnhfmanrvyovatvnqivpjyajizjvuqdnxymxqfxdcgtjzykzgrztgobhnywnoxnb
kwjfbyibwdbjoerdpyupejprsmzbdygdmpdzwuhzrysruvrhbdqygzfgdcgqflywuzruliuyjtguizditoignboswzpwbuwo
rjwqkzbkjakwvreoyznyrgyedhukazlahsauhpciozxopyoclxkgczjcxeckpfseqzvqfkqstnacezhenqeaxviasztsvwsi
cerzhaghedhrgmzxvasvmjvzkuhvjaejupjhocptxaqxcvxpskxrlaclkblxwsfpzaozshzfeivlbambitbviqdjpaypqzpd
mylhdakdyfdlqgtfrawrglrtuobdfaiforfbywjbtautwxtjdfsaibhifeishnaywbtwnkwalviwkbfkvqkipdquybrydwyq
tlysmbdmlcmyxtgqabpatiagfjwmcbncjucwjrekqbzqraqenzmieblezgemrhugsbxshmsuvpcegbjgpsgczxkcubvuxyuk
egtbjcijgfjtiobzxcuxolxbmwjxlcglwrljqervzcszexzrumztncenmdnzyuhrbcqbujbhgkxndcodkvdxksflrcarsbrf
oanjfcmfahfnsivhtcytintvwqdfhckhqthdayldvcwvyzvlfhuckdjkhgkujpcaydvypmycnxkymdhmxsmkrfswadtafyas
vnauodfoneoazviscdrcvkcihlyoedpelweyltgmsdbstcsgpbokgdngbigotjwiudzujouwxregidliruiebzmewdxwzawm
givdleklihlvkqdbzewzqnzdoylzneinytnlsgtxbeubgzbtwobvpegpofpbawjtdesdwldjimzpfeqfmxfzmuhntectudth
qcplheohcjhpukxjveavkpvxysfhjemjsvjfcanfxeyxabxnhjwemflmjimwlrecafxaroaepzmaofjozuomthuycfvchacu
xpcwqfhqpgqcbxkueftexmekjnaqgfrgnyganvioufduveuirdqmifpidkiqvlykwfbwlqwyztgikfnktwkgdbogyfzybcyo
ikxfngmnkjnxmsfdbgybspbfqanbpgkpavpnuivzdgwdibdvyqdxrgirqhrdcylvfgufynflkobrhgshozhbowjpvgevwfvj
sernjgqjeljrwmzlxgcxmrxzauhjlgoluxlhecphzgazcdzpjlygohnolkoyntgechzctqcgrbocqhlqbwqovjwaehxejcew
zreyshjsrisedzmwghvgzogmlpcsihtipaicpxkqwhfwxgwktfsokhrkfmksxnamyhdynsyabvikmhpmvymifdqiahbadeaq
kmzhpiopmlpzouhfdiadurdhscpdrimrcxrpwkxbfiyfkdfxasfztiktsjtfeanxhiwhaphnmqdtjiujqbjdqylrxigxyhxl
ugtplislgnltyobnziezotzbcwjlniqnwznjgerjbicbefbrlnaiqjpqnmqapvigejbevseitdqesjnsdysqxlycgjzglegy
btgaujlutkugfboyijxibqionreukjvkrckerzmsyjhyziymvhuqmjtmhomuzpcoajfapuacdxkmojroxaokhfskcjdcfgcs
mobjrkqronrbqwjhfkcfwtfjuerftkoteztrymzdhkahmfhzcuhbvkmvulvhgcpzjkyjcrjposfvlkwlsdlfsantzkizajzn
wivrnkunipnvaqdpbkgbqvbdeylnpkspybpligtldkedghdtnpckslrsposcrxkigldgxugkvfsgulpufausznaeilbingia
dvicwlnwvmwihdqaklzkdskqptgwmlxmtemgtboualjabkaoxjwsolvojqowbreqclhcrwcefzmoqltqzcqmjhumelfehieu
oqdltmstqptdsyljhmehyvhlwgthvmqvgbvtaobfjmcjohjbewjdxmoxwnxjierblmaletlrquhxnmynufnhucpvbmkbclbp
ykxtpmwpkrpxcsfrdmidsxdfganprmuradrnkivnfmgfijfvpremunturquetzmkinfizwimxhuiwnrwhcwubpcgkndkpikc
fxkeynpyxoykjfscmnbmfumsrviyonzovgoivdqwcnlcdmcqzlyuqnxqlsqydtgsenjetyeghboqsnvsbesoljwognhgjkgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: premunturque
Cipher: cerzhaghedhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: premunturque
Cipher: 532451235433445424145451

Extended Methods:
Method #1

Plaintext: premunturque
method variations:
uwkrzsyzwvzkzbpwexdebaepegubkcikgfkukmzgphopmlpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
p r e m u n t u r q u e 
5 2 5 2 5 3 4 5 2 1 5 5 
3 4 1 3 4 3 4 4 4 4 4 1 
They are then read out in rows:
525253452155341343444441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: premunturque
Cipher: kkpybzslottd

Read more ...
Method #3

Plaintext: premunturque
method variations:
hyfxosyidyyv yfxosyidyyvh fxosyidyyvhy
xosyidyyvhyf osyidyyvhyfx syidyyvhyfxo
yidyyvhyfxos idyyvhyfxosy dyyvhyfxosyi
yyvhyfxosyid yvhyfxosyidy vhyfxosyidyy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: premunturque

first 5040 cipher variations(475687488 total)
premunturque premunturqeu premunturuqe premunturueq premuntureuq premunturequ premuntuqrue premuntuqreu premuntuqure
premuntuquer premuntuqeur premuntuqeru premuntuuqre premuntuuqer premuntuurqe premuntuureq premuntuuerq premuntuueqr
premuntuequr premuntueqru premuntueuqr premuntueurq premuntueruq premuntuerqu premuntruque premuntruqeu premuntruuqe
premuntruueq premuntrueuq premuntruequ premuntrquue premuntrqueu premuntrquue premuntrqueu premuntrqeuu premuntrqeuu
premuntruque premuntruqeu premuntruuqe premuntruueq premuntrueuq premuntruequ premuntrequu premuntrequu premuntreuqu
premuntreuuq premuntreuuq premuntreuqu premuntqruue premuntqrueu premuntqruue premuntqrueu premuntqreuu premuntqreuu
premuntqurue premuntqureu premuntquure premuntquuer premuntqueur premuntqueru premuntquure premuntquuer premuntqurue
premuntqureu premuntqueru premuntqueur premuntqeuur premuntqeuru premuntqeuur premuntqeuru premuntqeruu premuntqeruu
premunturque premunturqeu premunturuqe premunturueq premuntureuq premunturequ premuntuqrue premuntuqreu premuntuqure
premuntuquer premuntuqeur premuntuqeru premuntuuqre premuntuuqer premuntuurqe premuntuureq premuntuuerq premuntuueqr
premuntuequr premuntueqru premuntueuqr premuntueurq premuntueruq premuntuerqu premunterquu premunterquu premunteruqu
premunteruuq premunteruuq premunteruqu premunteqruu premunteqruu premuntequru premuntequur premuntequur premuntequru
premunteuqru premunteuqur premunteurqu premunteuruq premunteuurq premunteuuqr premunteuqur premunteuqru premunteuuqr
premunteuurq premunteuruq premunteurqu premunutrque premunutrqeu premunutruqe premunutrueq premunutreuq premunutrequ
premunutqrue premunutqreu premunutqure premunutquer premunutqeur premunutqeru premunutuqre premunutuqer premunuturqe
premunutureq premunutuerq premunutueqr premunutequr premunuteqru premunuteuqr premunuteurq premunuteruq premunuterqu
premunurtque premunurtqeu premunurtuqe premunurtueq premunurteuq premunurtequ premunurqtue premunurqteu premunurqute
premunurquet premunurqeut premunurqetu premunuruqte premunuruqet premunurutqe premunuruteq premunuruetq premunurueqt
premunurequt premunureqtu premunureuqt premunureutq premunuretuq premunuretqu premunuqrtue premunuqrteu premunuqrute
premunuqruet premunuqreut premunuqretu premunuqtrue premunuqtreu premunuqture premunuqtuer premunuqteur premunuqteru
premunuqutre premunuquter premunuqurte premunuquret premunuquert premunuquetr premunuqetur premunuqetru premunuqeutr
premunuqeurt premunuqerut premunuqertu premunuurqte premunuurqet premunuurtqe premunuurteq premunuuretq premunuureqt
premunuuqrte premunuuqret premunuuqtre premunuuqter premunuuqetr premunuuqert premunuutqre premunuutqer premunuutrqe
premunuutreq premunuuterq premunuuteqr premunuueqtr premunuueqrt premunuuetqr premunuuetrq premunuuertq premunuuerqt
premunuerqut premunuerqtu premunueruqt premunuerutq premunuertuq premunuertqu premunueqrut premunueqrtu premunuequrt
premunuequtr premunueqtur premunueqtru premunueuqrt premunueuqtr premunueurqt premunueurtq premunueutrq premunueutqr
premunuetqur premunuetqru premunuetuqr premunueturq premunuetruq premunuetrqu premunrutque premunrutqeu premunrutuqe
premunrutueq premunruteuq premunrutequ premunruqtue premunruqteu premunruqute premunruquet premunruqeut premunruqetu
premunruuqte premunruuqet premunruutqe premunruuteq premunruuetq premunruueqt premunruequt premunrueqtu premunrueuqt
premunrueutq premunruetuq premunruetqu premunrtuque premunrtuqeu premunrtuuqe premunrtuueq premunrtueuq premunrtuequ
premunrtquue premunrtqueu premunrtquue premunrtqueu premunrtqeuu premunrtqeuu premunrtuque premunrtuqeu premunrtuuqe
premunrtuueq premunrtueuq premunrtuequ premunrtequu premunrtequu premunrteuqu premunrteuuq premunrteuuq premunrteuqu
premunrqtuue premunrqtueu premunrqtuue premunrqtueu premunrqteuu premunrqteuu premunrqutue premunrquteu premunrquute
premunrquuet premunrqueut premunrquetu premunrquute premunrquuet premunrqutue premunrquteu premunrquetu premunrqueut
premunrqeuut premunrqeutu premunrqeuut premunrqeutu premunrqetuu premunrqetuu premunrutque premunrutqeu premunrutuqe
premunrutueq premunruteuq premunrutequ premunruqtue premunruqteu premunruqute premunruquet premunruqeut premunruqetu
premunruuqte premunruuqet premunruutqe premunruuteq premunruuetq premunruueqt premunruequt premunrueqtu premunrueuqt
premunrueutq premunruetuq premunruetqu premunretquu premunretquu premunretuqu premunretuuq premunretuuq premunretuqu
premunreqtuu premunreqtuu premunrequtu premunrequut premunrequut premunrequtu premunreuqtu premunreuqut premunreutqu
premunreutuq premunreuutq premunreuuqt premunreuqut premunreuqtu premunreuuqt premunreuutq premunreutuq premunreutqu
premunqurtue premunqurteu premunqurute premunquruet premunqureut premunquretu premunqutrue premunqutreu premunquture
premunqutuer premunquteur premunquteru premunquutre premunquuter premunquurte premunquuret premunquuert premunquuetr
premunquetur premunquetru premunqueutr premunqueurt premunquerut premunquertu premunqrutue premunqruteu premunqruute
premunqruuet premunqrueut premunqruetu premunqrtuue premunqrtueu premunqrtuue premunqrtueu premunqrteuu premunqrteuu
premunqrutue premunqruteu premunqruute premunqruuet premunqrueut premunqruetu premunqretuu premunqretuu premunqreutu
premunqreuut premunqreuut premunqreutu premunqtruue premunqtrueu premunqtruue premunqtrueu premunqtreuu premunqtreuu
premunqturue premunqtureu premunqtuure premunqtuuer premunqtueur premunqtueru premunqtuure premunqtuuer premunqturue
premunqtureu premunqtueru premunqtueur premunqteuur premunqteuru premunqteuur premunqteuru premunqteruu premunqteruu
premunqurtue premunqurteu premunqurute premunquruet premunqureut premunquretu premunqutrue premunqutreu premunquture
premunqutuer premunquteur premunquteru premunquutre premunquuter premunquurte premunquuret premunquuert premunquuetr
premunquetur premunquetru premunqueutr premunqueurt premunquerut premunquertu premunqertuu premunqertuu premunqerutu
premunqeruut premunqeruut premunqerutu premunqetruu premunqetruu premunqeturu premunqetuur premunqetuur premunqeturu
premunqeutru premunqeutur premunqeurtu premunqeurut premunqeuurt premunqeuutr premunqeutur premunqeutru premunqeuutr
premunqeuurt premunqeurut premunqeurtu premunuurqte premunuurqet premunuurtqe premunuurteq premunuuretq premunuureqt
premunuuqrte premunuuqret premunuuqtre premunuuqter premunuuqetr premunuuqert premunuutqre premunuutqer premunuutrqe
premunuutreq premunuuterq premunuuteqr premunuueqtr premunuueqrt premunuuetqr premunuuetrq premunuuertq premunuuerqt
premunuruqte premunuruqet premunurutqe premunuruteq premunuruetq premunurueqt premunurqute premunurquet premunurqtue
premunurqteu premunurqetu premunurqeut premunurtque premunurtqeu premunurtuqe premunurtueq premunurteuq premunurtequ
premunureqtu premunurequt premunuretqu premunuretuq premunureutq premunureuqt premunuqrute premunuqruet premunuqrtue
premunuqrteu premunuqretu premunuqreut premunuqurte premunuquret premunuqutre premunuquter premunuquetr premunuquert
premunuqture premunuqtuer premunuqtrue premunuqtreu premunuqteru premunuqteur premunuqeutr premunuqeurt premunuqetur
premunuqetru premunuqertu premunuqerut premunutrque premunutrqeu premunutruqe premunutrueq premunutreuq premunutrequ
premunutqrue premunutqreu premunutqure premunutquer premunutqeur premunutqeru premunutuqre premunutuqer premunuturqe
premunutureq premunutuerq premunutueqr premunutequr premunuteqru premunuteuqr premunuteurq premunuteruq premunuterqu
premunuerqtu premunuerqut premunuertqu premunuertuq premunuerutq premunueruqt premunueqrtu premunueqrut premunueqtru
premunueqtur premunuequtr premunuequrt premunuetqru premunuetqur premunuetrqu premunuetruq premunueturq premunuetuqr
premunueuqtr premunueuqrt premunueutqr premunueutrq premunueurtq premunueurqt premuneurqut premuneurqtu premuneuruqt
premuneurutq premuneurtuq premuneurtqu premuneuqrut premuneuqrtu premuneuqurt premuneuqutr premuneuqtur premuneuqtru
premuneuuqrt premuneuuqtr premuneuurqt premuneuurtq premuneuutrq premuneuutqr premuneutqur premuneutqru premuneutuqr
premuneuturq premuneutruq premuneutrqu premuneruqut premuneruqtu premuneruuqt premuneruutq premunerutuq premunerutqu
premunerquut premunerqutu premunerquut premunerqutu premunerqtuu premunerqtuu premuneruqut premuneruqtu premuneruuqt
premuneruutq premunerutuq premunerutqu premunertquu premunertquu premunertuqu premunertuuq premunertuuq premunertuqu
premuneqruut premuneqrutu premuneqruut premuneqrutu premuneqrtuu premuneqrtuu premunequrut premunequrtu premunequurt
premunequutr premunequtur premunequtru premunequurt premunequutr premunequrut premunequrtu premunequtru premunequtur
premuneqtuur premuneqturu premuneqtuur premuneqturu premuneqtruu premuneqtruu premuneurqut premuneurqtu premuneuruqt
premuneurutq premuneurtuq premuneurtqu premuneuqrut premuneuqrtu premuneuqurt premuneuqutr premuneuqtur premuneuqtru
premuneuuqrt premuneuuqtr premuneuurqt premuneuurtq premuneuutrq premuneuutqr premuneutqur premuneutqru premuneutuqr
premuneuturq premuneutruq premuneutrqu premunetrquu premunetrquu premunetruqu premunetruuq premunetruuq premunetruqu
premunetqruu premunetqruu premunetquru premunetquur premunetquur premunetquru premunetuqru premunetuqur premuneturqu
premuneturuq premunetuurq premunetuuqr premunetuqur premunetuqru premunetuuqr premunetuurq premuneturuq premuneturqu
premutnurque premutnurqeu premutnuruqe premutnurueq premutnureuq premutnurequ premutnuqrue premutnuqreu premutnuqure
premutnuquer premutnuqeur premutnuqeru premutnuuqre premutnuuqer premutnuurqe premutnuureq premutnuuerq premutnuueqr
premutnuequr premutnueqru premutnueuqr premutnueurq premutnueruq premutnuerqu premutnruque premutnruqeu premutnruuqe
premutnruueq premutnrueuq premutnruequ premutnrquue premutnrqueu premutnrquue premutnrqueu premutnrqeuu premutnrqeuu
premutnruque premutnruqeu premutnruuqe premutnruueq premutnrueuq premutnruequ premutnrequu premutnrequu premutnreuqu
premutnreuuq premutnreuuq premutnreuqu premutnqruue premutnqrueu premutnqruue premutnqrueu premutnqreuu premutnqreuu
premutnqurue premutnqureu premutnquure premutnquuer premutnqueur premutnqueru premutnquure premutnquuer premutnqurue
premutnqureu premutnqueru premutnqueur premutnqeuur premutnqeuru premutnqeuur premutnqeuru premutnqeruu premutnqeruu
premutnurque premutnurqeu premutnuruqe premutnurueq premutnureuq premutnurequ premutnuqrue premutnuqreu premutnuqure
premutnuquer premutnuqeur premutnuqeru premutnuuqre premutnuuqer premutnuurqe premutnuureq premutnuuerq premutnuueqr
premutnuequr premutnueqru premutnueuqr premutnueurq premutnueruq premutnuerqu premutnerquu premutnerquu premutneruqu
premutneruuq premutneruuq premutneruqu premutneqruu premutneqruu premutnequru premutnequur premutnequur premutnequru
premutneuqru premutneuqur premutneurqu premutneuruq premutneuurq premutneuuqr premutneuqur premutneuqru premutneuuqr
premutneuurq premutneuruq premutneurqu premutunrque premutunrqeu premutunruqe premutunrueq premutunreuq premutunrequ
premutunqrue premutunqreu premutunqure premutunquer premutunqeur premutunqeru premutunuqre premutunuqer premutunurqe
premutunureq premutunuerq premutunueqr premutunequr premutuneqru premutuneuqr premutuneurq premutuneruq premutunerqu
premuturnque premuturnqeu premuturnuqe premuturnueq premuturneuq premuturnequ premuturqnue premuturqneu premuturqune
premuturquen premuturqeun premuturqenu premuturuqne premuturuqen premuturunqe premuturuneq premuturuenq premuturueqn
premuturequn premutureqnu premutureuqn premutureunq premuturenuq premuturenqu premutuqrnue premutuqrneu premutuqrune
premutuqruen premutuqreun premutuqrenu premutuqnrue premutuqnreu premutuqnure premutuqnuer premutuqneur premutuqneru
premutuqunre premutuquner premutuqurne premutuquren premutuquern premutuquenr premutuqenur premutuqenru premutuqeunr
premutuqeurn premutuqerun premutuqernu premutuurqne premutuurqen premutuurnqe premutuurneq premutuurenq premutuureqn
premutuuqrne premutuuqren premutuuqnre premutuuqner premutuuqenr premutuuqern premutuunqre premutuunqer premutuunrqe
premutuunreq premutuunerq premutuuneqr premutuueqnr premutuueqrn premutuuenqr premutuuenrq premutuuernq premutuuerqn
premutuerqun premutuerqnu premutueruqn premutuerunq premutuernuq premutuernqu premutueqrun premutueqrnu premutuequrn
premutuequnr premutueqnur premutueqnru premutueuqrn premutueuqnr premutueurqn premutueurnq premutueunrq premutueunqr
premutuenqur premutuenqru premutuenuqr premutuenurq premutuenruq premutuenrqu premutrunque premutrunqeu premutrunuqe
premutrunueq premutruneuq premutrunequ premutruqnue premutruqneu premutruqune premutruquen premutruqeun premutruqenu
premutruuqne premutruuqen premutruunqe premutruuneq premutruuenq premutruueqn premutruequn premutrueqnu premutrueuqn
premutrueunq premutruenuq premutruenqu premutrnuque premutrnuqeu premutrnuuqe premutrnuueq premutrnueuq premutrnuequ
premutrnquue premutrnqueu premutrnquue premutrnqueu premutrnqeuu premutrnqeuu premutrnuque premutrnuqeu premutrnuuqe
premutrnuueq premutrnueuq premutrnuequ premutrnequu premutrnequu premutrneuqu premutrneuuq premutrneuuq premutrneuqu
premutrqnuue premutrqnueu premutrqnuue premutrqnueu premutrqneuu premutrqneuu premutrqunue premutrquneu premutrquune
premutrquuen premutrqueun premutrquenu premutrquune premutrquuen premutrqunue premutrquneu premutrquenu premutrqueun
premutrqeuun premutrqeunu premutrqeuun premutrqeunu premutrqenuu premutrqenuu premutrunque premutrunqeu premutrunuqe
premutrunueq premutruneuq premutrunequ premutruqnue premutruqneu premutruqune premutruquen premutruqeun premutruqenu
premutruuqne premutruuqen premutruunqe premutruuneq premutruuenq premutruueqn premutruequn premutrueqnu premutrueuqn
premutrueunq premutruenuq premutruenqu premutrenquu premutrenquu premutrenuqu premutrenuuq premutrenuuq premutrenuqu
premutreqnuu premutreqnuu premutrequnu premutrequun premutrequun premutrequnu premutreuqnu premutreuqun premutreunqu
premutreunuq premutreuunq premutreuuqn premutreuqun premutreuqnu premutreuuqn premutreuunq premutreunuq premutreunqu
premutqurnue premutqurneu premutqurune premutquruen premutqureun premutqurenu premutqunrue premutqunreu premutqunure
premutqunuer premutquneur premutquneru premutquunre premutquuner premutquurne premutquuren premutquuern premutquuenr
premutquenur premutquenru premutqueunr premutqueurn premutquerun premutquernu premutqrunue premutqruneu premutqruune
premutqruuen premutqrueun premutqruenu premutqrnuue premutqrnueu premutqrnuue premutqrnueu premutqrneuu premutqrneuu
premutqrunue premutqruneu premutqruune premutqruuen premutqrueun premutqruenu premutqrenuu premutqrenuu premutqreunu
premutqreuun premutqreuun premutqreunu premutqnruue premutqnrueu premutqnruue premutqnrueu premutqnreuu premutqnreuu
premutqnurue premutqnureu premutqnuure premutqnuuer premutqnueur premutqnueru premutqnuure premutqnuuer premutqnurue
premutqnureu premutqnueru premutqnueur premutqneuur premutqneuru premutqneuur premutqneuru premutqneruu premutqneruu
premutqurnue premutqurneu premutqurune premutquruen premutqureun premutqurenu premutqunrue premutqunreu premutqunure
premutqunuer premutquneur premutquneru premutquunre premutquuner premutquurne premutquuren premutquuern premutquuenr
premutquenur premutquenru premutqueunr premutqueurn premutquerun premutquernu premutqernuu premutqernuu premutqerunu
premutqeruun premutqeruun premutqerunu premutqenruu premutqenruu premutqenuru premutqenuur premutqenuur premutqenuru
premutqeunru premutqeunur premutqeurnu premutqeurun premutqeuurn premutqeuunr premutqeunur premutqeunru premutqeuunr
premutqeuurn premutqeurun premutqeurnu premutuurqne premutuurqen premutuurnqe premutuurneq premutuurenq premutuureqn
premutuuqrne premutuuqren premutuuqnre premutuuqner premutuuqenr premutuuqern premutuunqre premutuunqer premutuunrqe
premutuunreq premutuunerq premutuuneqr premutuueqnr premutuueqrn premutuuenqr premutuuenrq premutuuernq premutuuerqn
premuturuqne premuturuqen premuturunqe premuturuneq premuturuenq premuturueqn premuturqune premuturquen premuturqnue
premuturqneu premuturqenu premuturqeun premuturnque premuturnqeu premuturnuqe premuturnueq premuturneuq premuturnequ
premutureqnu premuturequn premuturenqu premuturenuq premutureunq premutureuqn premutuqrune premutuqruen premutuqrnue
premutuqrneu premutuqrenu premutuqreun premutuqurne premutuquren premutuqunre premutuquner premutuquenr premutuquern
premutuqnure premutuqnuer premutuqnrue premutuqnreu premutuqneru premutuqneur premutuqeunr premutuqeurn premutuqenur
premutuqenru premutuqernu premutuqerun premutunrque premutunrqeu premutunruqe premutunrueq premutunreuq premutunrequ
premutunqrue premutunqreu premutunqure premutunquer premutunqeur premutunqeru premutunuqre premutunuqer premutunurqe
premutunureq premutunuerq premutunueqr premutunequr premutuneqru premutuneuqr premutuneurq premutuneruq premutunerqu
premutuerqnu premutuerqun premutuernqu premutuernuq premutuerunq premutueruqn premutueqrnu premutueqrun premutueqnru
premutueqnur premutuequnr premutuequrn premutuenqru premutuenqur premutuenrqu premutuenruq premutuenurq premutuenuqr
premutueuqnr premutueuqrn premutueunqr premutueunrq premutueurnq premutueurqn premuteurqun premuteurqnu premuteuruqn
premuteurunq premuteurnuq premuteurnqu premuteuqrun premuteuqrnu premuteuqurn premuteuqunr premuteuqnur premuteuqnru
premuteuuqrn premuteuuqnr premuteuurqn premuteuurnq premuteuunrq premuteuunqr premuteunqur premuteunqru premuteunuqr
premuteunurq premuteunruq premuteunrqu premuteruqun premuteruqnu premuteruuqn premuteruunq premuterunuq premuterunqu
premuterquun premuterqunu premuterquun premuterqunu premuterqnuu premuterqnuu premuteruqun premuteruqnu premuteruuqn
premuteruunq premuterunuq premuterunqu premuternquu premuternquu premuternuqu premuternuuq premuternuuq premuternuqu
premuteqruun premuteqrunu premuteqruun premuteqrunu premuteqrnuu premuteqrnuu premutequrun premutequrnu premutequurn
premutequunr premutequnur premutequnru premutequurn premutequunr premutequrun premutequrnu premutequnru premutequnur
premuteqnuur premuteqnuru premuteqnuur premuteqnuru premuteqnruu premuteqnruu premuteurqun premuteurqnu premuteuruqn
premuteurunq premuteurnuq premuteurnqu premuteuqrun premuteuqrnu premuteuqurn premuteuqunr premuteuqnur premuteuqnru
premuteuuqrn premuteuuqnr premuteuurqn premuteuurnq premuteuunrq premuteuunqr premuteunqur premuteunqru premuteunuqr
premuteunurq premuteunruq premuteunrqu premutenrquu premutenrquu premutenruqu premutenruuq premutenruuq premutenruqu
premutenqruu premutenqruu premutenquru premutenquur premutenquur premutenquru premutenuqru premutenuqur premutenurqu
premutenuruq premutenuurq premutenuuqr premutenuqur premutenuqru premutenuuqr premutenuurq premutenuruq premutenurqu
premuutnrque premuutnrqeu premuutnruqe premuutnrueq premuutnreuq premuutnrequ premuutnqrue premuutnqreu premuutnqure
premuutnquer premuutnqeur premuutnqeru premuutnuqre premuutnuqer premuutnurqe premuutnureq premuutnuerq premuutnueqr
premuutnequr premuutneqru premuutneuqr premuutneurq premuutneruq premuutnerqu premuutrnque premuutrnqeu premuutrnuqe
premuutrnueq premuutrneuq premuutrnequ premuutrqnue premuutrqneu premuutrqune premuutrquen premuutrqeun premuutrqenu
premuutruqne premuutruqen premuutrunqe premuutruneq premuutruenq premuutrueqn premuutrequn premuutreqnu premuutreuqn
premuutreunq premuutrenuq premuutrenqu premuutqrnue premuutqrneu premuutqrune premuutqruen premuutqreun premuutqrenu
premuutqnrue premuutqnreu premuutqnure premuutqnuer premuutqneur premuutqneru premuutqunre premuutquner premuutqurne
premuutquren premuutquern premuutquenr premuutqenur premuutqenru premuutqeunr premuutqeurn premuutqerun premuutqernu
premuuturqne premuuturqen premuuturnqe premuuturneq premuuturenq premuutureqn premuutuqrne premuutuqren premuutuqnre
premuutuqner premuutuqenr premuutuqern premuutunqre premuutunqer premuutunrqe premuutunreq premuutunerq premuutuneqr
premuutueqnr premuutueqrn premuutuenqr premuutuenrq premuutuernq premuutuerqn premuuterqun premuuterqnu premuuteruqn
premuuterunq premuuternuq premuuternqu premuuteqrun premuuteqrnu premuutequrn premuutequnr premuuteqnur premuuteqnru
premuuteuqrn premuuteuqnr premuuteurqn premuuteurnq premuuteunrq premuuteunqr premuutenqur premuutenqru premuutenuqr
premuutenurq premuutenruq premuutenrqu premuuntrque premuuntrqeu premuuntruqe premuuntrueq premuuntreuq premuuntrequ
premuuntqrue premuuntqreu premuuntqure premuuntquer premuuntqeur premuuntqeru premuuntuqre premuuntuqer premuunturqe
premuuntureq premuuntuerq premuuntueqr premuuntequr premuunteqru premuunteuqr premuunteurq premuunteruq premuunterqu
premuunrtque premuunrtqeu premuunrtuqe premuunrtueq premuunrteuq premuunrtequ premuunrqtue premuunrqteu premuunrqute
premuunrquet premuunrqeut premuunrqetu premuunruqte premuunruqet premuunrutqe premuunruteq premuunruetq premuunrueqt
premuunrequt premuunreqtu premuunreuqt premuunreutq premuunretuq premuunretqu premuunqrtue premuunqrteu premuunqrute
premuunqruet premuunqreut premuunqretu premuunqtrue premuunqtreu premuunqture premuunqtuer premuunqteur premuunqteru
premuunqutre premuunquter premuunqurte premuunquret premuunquert premuunquetr premuunqetur premuunqetru premuunqeutr
premuunqeurt premuunqerut premuunqertu premuunurqte premuunurqet premuunurtqe premuunurteq premuunuretq premuunureqt
premuunuqrte premuunuqret premuunuqtre premuunuqter premuunuqetr premuunuqert premuunutqre premuunutqer premuunutrqe
premuunutreq premuunuterq premuunuteqr premuunueqtr premuunueqrt premuunuetqr premuunuetrq premuunuertq premuunuerqt
premuunerqut premuunerqtu premuuneruqt premuunerutq premuunertuq premuunertqu premuuneqrut premuuneqrtu premuunequrt
premuunequtr premuuneqtur premuuneqtru premuuneuqrt premuuneuqtr premuuneurqt premuuneurtq premuuneutrq premuuneutqr
premuunetqur premuunetqru premuunetuqr premuuneturq premuunetruq premuunetrqu premuurntque premuurntqeu premuurntuqe
premuurntueq premuurnteuq premuurntequ premuurnqtue premuurnqteu premuurnqute premuurnquet premuurnqeut premuurnqetu
premuurnuqte premuurnuqet premuurnutqe premuurnuteq premuurnuetq premuurnueqt premuurnequt premuurneqtu premuurneuqt
premuurneutq premuurnetuq premuurnetqu premuurtnque premuurtnqeu premuurtnuqe premuurtnueq premuurtneuq premuurtnequ
premuurtqnue premuurtqneu premuurtqune premuurtquen premuurtqeun premuurtqenu premuurtuqne premuurtuqen premuurtunqe
premuurtuneq premuurtuenq premuurtueqn premuurtequn premuurteqnu premuurteuqn premuurteunq premuurtenuq premuurtenqu
premuurqtnue premuurqtneu premuurqtune premuurqtuen premuurqteun premuurqtenu premuurqntue premuurqnteu premuurqnute
premuurqnuet premuurqneut premuurqnetu premuurqunte premuurqunet premuurqutne premuurquten premuurquetn premuurquent
premuurqenut premuurqentu premuurqeunt premuurqeutn premuurqetun premuurqetnu premuurutqne premuurutqen premuurutnqe
premuurutneq premuurutenq premuuruteqn premuuruqtne premuuruqten premuuruqnte premuuruqnet premuuruqent premuuruqetn
premuurunqte premuurunqet premuuruntqe premuurunteq premuurunetq premuuruneqt premuurueqnt premuurueqtn premuuruenqt
premuuruentq premuuruetnq premuuruetqn premuuretqun premuuretqnu premuuretuqn premuuretunq premuuretnuq premuuretnqu
premuureqtun premuureqtnu premuurequtn premuurequnt premuureqnut premuureqntu premuureuqtn premuureuqnt premuureutqn
premuureutnq premuureuntq premuureunqt premuurenqut premuurenqtu premuurenuqt premuurenutq premuurentuq premuurentqu
premuuqnrtue premuuqnrteu premuuqnrute premuuqnruet premuuqnreut premuuqnretu premuuqntrue premuuqntreu premuuqnture
premuuqntuer premuuqnteur premuuqnteru premuuqnutre premuuqnuter premuuqnurte premuuqnuret premuuqnuert premuuqnuetr
premuuqnetur premuuqnetru premuuqneutr premuuqneurt premuuqnerut premuuqnertu premuuqrntue premuuqrnteu premuuqrnute
premuuqrnuet premuuqrneut premuuqrnetu premuuqrtnue premuuqrtneu premuuqrtune premuuqrtuen premuuqrteun premuuqrtenu
premuuqrutne premuuqruten premuuqrunte premuuqrunet premuuqruent premuuqruetn premuuqretun premuuqretnu premuuqreutn
premuuqreunt premuuqrenut premuuqrentu premuuqtrnue premuuqtrneu premuuqtrune premuuqtruen premuuqtreun premuuqtrenu
premuuqtnrue premuuqtnreu premuuqtnure premuuqtnuer premuuqtneur premuuqtneru premuuqtunre premuuqtuner premuuqturne
premuuqturen premuuqtuern premuuqtuenr premuuqtenur premuuqtenru premuuqteunr premuuqteurn premuuqterun premuuqternu
premuuqurtne premuuqurten premuuqurnte premuuqurnet premuuqurent premuuquretn premuuqutrne premuuqutren premuuqutnre
premuuqutner premuuqutenr premuuqutern premuuquntre premuuqunter premuuqunrte premuuqunret premuuqunert premuuqunetr
premuuquetnr premuuquetrn premuuquentr premuuquenrt premuuquernt premuuquertn premuuqertun premuuqertnu premuuqerutn
premuuqerunt premuuqernut premuuqerntu premuuqetrun premuuqetrnu premuuqeturn premuuqetunr premuuqetnur premuuqetnru
premuuqeutrn premuuqeutnr premuuqeurtn premuuqeurnt premuuqeunrt premuuqeuntr premuuqentur premuuqentru premuuqenutr
premuuqenurt premuuqenrut premuuqenrtu premuuunrqte premuuunrqet premuuunrtqe premuuunrteq premuuunretq premuuunreqt
premuuunqrte premuuunqret premuuunqtre premuuunqter premuuunqetr premuuunqert premuuuntqre premuuuntqer premuuuntrqe
premuuuntreq premuuunterq premuuunteqr premuuuneqtr premuuuneqrt premuuunetqr premuuunetrq premuuunertq premuuunerqt
premuuurnqte premuuurnqet premuuurntqe premuuurnteq premuuurnetq premuuurneqt premuuurqnte premuuurqnet premuuurqtne
premuuurqten premuuurqetn premuuurqent premuuurtqne premuuurtqen premuuurtnqe premuuurtneq premuuurtenq premuuurteqn
premuuureqtn premuuureqnt premuuuretqn premuuuretnq premuuurentq premuuurenqt premuuuqrnte premuuuqrnet premuuuqrtne
premuuuqrten premuuuqretn premuuuqrent premuuuqnrte premuuuqnret premuuuqntre premuuuqnter premuuuqnetr premuuuqnert
premuuuqtnre premuuuqtner premuuuqtrne premuuuqtren premuuuqtern premuuuqtenr premuuuqentr premuuuqenrt premuuuqetnr
premuuuqetrn premuuuqertn premuuuqernt premuuutrqne premuuutrqen premuuutrnqe premuuutrneq premuuutrenq premuuutreqn
premuuutqrne premuuutqren premuuutqnre premuuutqner premuuutqenr premuuutqern premuuutnqre premuuutnqer premuuutnrqe
premuuutnreq premuuutnerq premuuutneqr premuuuteqnr premuuuteqrn premuuutenqr premuuutenrq premuuuternq premuuuterqn
premuuuerqtn premuuuerqnt premuuuertqn premuuuertnq premuuuerntq premuuuernqt premuuueqrtn premuuueqrnt premuuueqtrn
premuuueqtnr premuuueqntr premuuueqnrt premuuuetqrn premuuuetqnr premuuuetrqn premuuuetrnq premuuuetnrq premuuuetnqr
premuuuenqtr premuuuenqrt premuuuentqr premuuuentrq premuuuenrtq premuuuenrqt premuuenrqut premuuenrqtu premuuenruqt
premuuenrutq premuuenrtuq premuuenrtqu premuuenqrut premuuenqrtu premuuenqurt premuuenqutr premuuenqtur premuuenqtru
premuuenuqrt premuuenuqtr premuuenurqt premuuenurtq premuuenutrq premuuenutqr premuuentqur premuuentqru premuuentuqr
premuuenturq premuuentruq premuuentrqu premuuernqut premuuernqtu premuuernuqt premuuernutq premuuerntuq premuuerntqu
premuuerqnut premuuerqntu premuuerqunt premuuerqutn premuuerqtun premuuerqtnu premuueruqnt premuueruqtn premuuerunqt
premuueruntq premuuerutnq premuuerutqn premuuertqun premuuertqnu premuuertuqn premuuertunq premuuertnuq premuuertnqu
premuueqrnut premuueqrntu premuueqrunt premuueqrutn premuueqrtun premuueqrtnu premuueqnrut premuueqnrtu premuueqnurt
premuueqnutr premuueqntur premuueqntru premuuequnrt premuuequntr premuuequrnt premuuequrtn premuuequtrn premuuequtnr
premuueqtnur premuueqtnru premuueqtunr premuueqturn premuueqtrun premuueqtrnu premuueurqnt premuueurqtn premuueurnqt
premuueurntq premuueurtnq premuueurtqn premuueuqrnt premuueuqrtn premuueuqnrt premuueuqntr premuueuqtnr premuueuqtrn
premuueunqrt premuueunqtr premuueunrqt premuueunrtq premuueuntrq premuueuntqr premuueutqnr premuueutqrn premuueutnqr
premuueutnrq premuueutrnq premuueutrqn premuuetrqun premuuetrqnu premuuetruqn premuuetrunq premuuetrnuq premuuetrnqu
premuuetqrun premuuetqrnu premuuetqurn premuuetqunr premuuetqnur premuuetqnru premuuetuqrn premuuetuqnr premuueturqn
premuueturnq premuuetunrq premuuetunqr premuuetnqur premuuetnqru premuuetnuqr premuuetnurq premuuetnruq premuuetnrqu
premurtunque premurtunqeu premurtunuqe premurtunueq premurtuneuq premurtunequ premurtuqnue premurtuqneu premurtuqune
premurtuquen premurtuqeun premurtuqenu premurtuuqne premurtuuqen premurtuunqe premurtuuneq premurtuuenq premurtuueqn
premurtuequn premurtueqnu premurtueuqn premurtueunq premurtuenuq premurtuenqu premurtnuque premurtnuqeu premurtnuuqe
premurtnuueq premurtnueuq premurtnuequ premurtnquue premurtnqueu premurtnquue premurtnqueu premurtnqeuu premurtnqeuu
premurtnuque premurtnuqeu premurtnuuqe premurtnuueq premurtnueuq premurtnuequ premurtnequu premurtnequu premurtneuqu
premurtneuuq premurtneuuq premurtneuqu premurtqnuue premurtqnueu premurtqnuue premurtqnueu premurtqneuu premurtqneuu
premurtqunue premurtquneu premurtquune premurtquuen premurtqueun premurtquenu premurtquune premurtquuen premurtqunue
premurtquneu premurtquenu premurtqueun premurtqeuun premurtqeunu premurtqeuun premurtqeunu premurtqenuu premurtqenuu
premurtunque premurtunqeu premurtunuqe premurtunueq premurtuneuq premurtunequ premurtuqnue premurtuqneu premurtuqune
premurtuquen premurtuqeun premurtuqenu premurtuuqne premurtuuqen premurtuunqe premurtuuneq premurtuuenq premurtuueqn
premurtuequn premurtueqnu premurtueuqn premurtueunq premurtuenuq premurtuenqu premurtenquu premurtenquu premurtenuqu
premurtenuuq premurtenuuq premurtenuqu premurteqnuu premurteqnuu premurtequnu premurtequun premurtequun premurtequnu
premurteuqnu premurteuqun premurteunqu premurteunuq premurteuunq premurteuuqn premurteuqun premurteuqnu premurteuuqn
premurteuunq premurteunuq premurteunqu premurutnque premurutnqeu premurutnuqe premurutnueq premurutneuq premurutnequ
premurutqnue premurutqneu premurutqune premurutquen premurutqeun premurutqenu premurutuqne premurutuqen premurutunqe
premurutuneq premurutuenq premurutueqn premurutequn premuruteqnu premuruteuqn premuruteunq premurutenuq premurutenqu
premuruntque premuruntqeu premuruntuqe premuruntueq premurunteuq premuruntequ premurunqtue premurunqteu premurunqute
premurunquet premurunqeut premurunqetu premurunuqte premurunuqet premurunutqe premurunuteq premurunuetq premurunueqt
premurunequt premuruneqtu premuruneuqt premuruneutq premurunetuq premurunetqu premuruqntue premuruqnteu premuruqnute
premuruqnuet premuruqneut premuruqnetu premuruqtnue premuruqtneu premuruqtune premuruqtuen premuruqteun premuruqtenu
premuruqutne premuruquten premuruqunte premuruqunet premuruquent premuruquetn premuruqetun premuruqetnu premuruqeutn
premuruqeunt premuruqenut premuruqentu premuruunqte premuruunqet premuruuntqe premuruunteq premuruunetq premuruuneqt
premuruuqnte premuruuqnet premuruuqtne premuruuqten premuruuqetn premuruuqent premuruutqne premuruutqen premuruutnqe
premuruutneq premuruutenq premuruuteqn premuruueqtn premuruueqnt premuruuetqn premuruuetnq premuruuentq premuruuenqt
premuruenqut premuruenqtu premuruenuqt premuruenutq premuruentuq premuruentqu premurueqnut premurueqntu premuruequnt
premuruequtn premurueqtun premurueqtnu premurueuqnt premurueuqtn premurueunqt premurueuntq premurueutnq premurueutqn
premuruetqun premuruetqnu premuruetuqn premuruetunq premuruetnuq premuruetnqu premurnutque premurnutqeu premurnutuqe
premurnutueq premurnuteuq premurnutequ premurnuqtue premurnuqteu premurnuqute premurnuquet premurnuqeut premurnuqetu
premurnuuqte premurnuuqet premurnuutqe premurnuuteq premurnuuetq premurnuueqt premurnuequt premurnueqtu premurnueuqt
premurnueutq premurnuetuq premurnuetqu premurntuque premurntuqeu premurntuuqe premurntuueq premurntueuq premurntuequ
premurntquue premurntqueu premurntquue premurntqueu premurntqeuu premurntqeuu premurntuque premurntuqeu premurntuuqe
premurntuueq premurntueuq premurntuequ premurntequu premurntequu premurnteuqu premurnteuuq premurnteuuq premurnteuqu
premurnqtuue premurnqtueu premurnqtuue premurnqtueu premurnqteuu premurnqteuu premurnqutue premurnquteu premurnquute
premurnquuet premurnqueut premurnquetu premurnquute premurnquuet premurnqutue premurnquteu premurnquetu premurnqueut
premurnqeuut premurnqeutu premurnqeuut premurnqeutu premurnqetuu premurnqetuu premurnutque premurnutqeu premurnutuqe
premurnutueq premurnuteuq premurnutequ premurnuqtue premurnuqteu premurnuqute premurnuquet premurnuqeut premurnuqetu
premurnuuqte premurnuuqet premurnuutqe premurnuuteq premurnuuetq premurnuueqt premurnuequt premurnueqtu premurnueuqt
premurnueutq premurnuetuq premurnuetqu premurnetquu premurnetquu premurnetuqu premurnetuuq premurnetuuq premurnetuqu
premurneqtuu premurneqtuu premurnequtu premurnequut premurnequut premurnequtu premurneuqtu premurneuqut premurneutqu
premurneutuq premurneuutq premurneuuqt premurneuqut premurneuqtu premurneuuqt premurneuutq premurneutuq premurneutqu
premurquntue premurqunteu premurqunute premurqunuet premurquneut premurqunetu premurqutnue premurqutneu premurqutune
premurqutuen premurquteun premurqutenu premurquutne premurquuten premurquunte premurquunet premurquuent premurquuetn
premurquetun premurquetnu premurqueutn premurqueunt premurquenut premurquentu premurqnutue premurqnuteu premurqnuute
premurqnuuet premurqnueut premurqnuetu premurqntuue premurqntueu premurqntuue premurqntueu premurqnteuu premurqnteuu
premurqnutue premurqnuteu premurqnuute premurqnuuet premurqnueut premurqnuetu premurqnetuu premurqnetuu premurqneutu
premurqneuut premurqneuut premurqneutu premurqtnuue premurqtnueu premurqtnuue premurqtnueu premurqtneuu premurqtneuu
premurqtunue premurqtuneu premurqtuune premurqtuuen premurqtueun premurqtuenu premurqtuune premurqtuuen premurqtunue
premurqtuneu premurqtuenu premurqtueun premurqteuun premurqteunu premurqteuun premurqteunu premurqtenuu premurqtenuu
premurquntue premurqunteu premurqunute premurqunuet premurquneut premurqunetu premurqutnue premurqutneu premurqutune
premurqutuen premurquteun premurqutenu premurquutne premurquuten premurquunte premurquunet premurquuent premurquuetn
premurquetun premurquetnu premurqueutn premurqueunt premurquenut premurquentu premurqentuu premurqentuu premurqenutu
premurqenuut premurqenuut premurqenutu premurqetnuu premurqetnuu premurqetunu premurqetuun premurqetuun premurqetunu
premurqeutnu premurqeutun premurqeuntu premurqeunut premurqeuunt premurqeuutn premurqeutun premurqeutnu premurqeuutn
premurqeuunt premurqeunut premurqeuntu premuruunqte premuruunqet premuruuntqe premuruunteq premuruunetq premuruuneqt
premuruuqnte premuruuqnet premuruuqtne premuruuqten premuruuqetn premuruuqent premuruutqne premuruutqen premuruutnqe
premuruutneq premuruutenq premuruuteqn premuruueqtn premuruueqnt premuruuetqn premuruuetnq premuruuentq premuruuenqt
premurunuqte premurunuqet premurunutqe premurunuteq premurunuetq premurunueqt premurunqute premurunquet premurunqtue
premurunqteu premurunqetu premurunqeut premuruntque premuruntqeu premuruntuqe premuruntueq premurunteuq premuruntequ
premuruneqtu premurunequt premurunetqu premurunetuq premuruneutq premuruneuqt premuruqnute premuruqnuet premuruqntue
premuruqnteu premuruqnetu premuruqneut premuruqunte premuruqunet premuruqutne premuruquten premuruquetn premuruquent
premuruqtune premuruqtuen premuruqtnue premuruqtneu premuruqtenu premuruqteun premuruqeutn premuruqeunt premuruqetun
premuruqetnu premuruqentu premuruqenut premurutnque premurutnqeu premurutnuqe premurutnueq premurutneuq premurutnequ
premurutqnue premurutqneu premurutqune premurutquen premurutqeun premurutqenu premurutuqne premurutuqen premurutunqe
premurutuneq premurutuenq premurutueqn premurutequn premuruteqnu premuruteuqn premuruteunq premurutenuq premurutenqu
premuruenqtu premuruenqut premuruentqu premuruentuq premuruenutq premuruenuqt premurueqntu premurueqnut premurueqtnu
premurueqtun premuruequtn premuruequnt premuruetqnu premuruetqun premuruetnqu premuruetnuq premuruetunq premuruetuqn
premurueuqtn premurueuqnt premurueutqn premurueutnq premurueuntq premurueunqt premureunqut premureunqtu premureunuqt
premureunutq premureuntuq premureuntqu premureuqnut premureuqntu premureuqunt premureuqutn premureuqtun premureuqtnu
premureuuqnt premureuuqtn premureuunqt premureuuntq premureuutnq premureuutqn premureutqun premureutqnu premureutuqn
premureutunq premureutnuq premureutnqu premurenuqut premurenuqtu premurenuuqt premurenuutq premurenutuq premurenutqu
premurenquut premurenqutu premurenquut premurenqutu premurenqtuu premurenqtuu premurenuqut premurenuqtu premurenuuqt
premurenuutq premurenutuq premurenutqu premurentquu premurentquu premurentuqu premurentuuq premurentuuq premurentuqu
premureqnuut premureqnutu premureqnuut premureqnutu premureqntuu premureqntuu premurequnut premurequntu premurequunt
premurequutn premurequtun premurequtnu premurequunt premurequutn premurequnut premurequntu premurequtnu premurequtun
premureqtuun premureqtunu premureqtuun premureqtunu premureqtnuu premureqtnuu premureunqut premureunqtu premureunuqt
premureunutq premureuntuq premureuntqu premureuqnut premureuqntu premureuqunt premureuqutn premureuqtun premureuqtnu
premureuuqnt premureuuqtn premureuunqt premureuuntq premureuutnq premureuutqn premureutqun premureutqnu premureutuqn
premureutunq premureutnuq premureutnqu premuretnquu premuretnquu premuretnuqu premuretnuuq premuretnuuq premuretnuqu
premuretqnuu premuretqnuu premuretqunu premuretquun premuretquun premuretqunu premuretuqnu premuretuqun premuretunqu
premuretunuq premuretuunq premuretuuqn premuretuqun premuretuqnu premuretuuqn premuretuunq premuretunuq premuretunqu
premuqturnue premuqturneu premuqturune premuqturuen premuqtureun premuqturenu premuqtunrue premuqtunreu premuqtunure
premuqtunuer premuqtuneur premuqtuneru premuqtuunre premuqtuuner premuqtuurne premuqtuuren premuqtuuern premuqtuuenr
premuqtuenur premuqtuenru premuqtueunr premuqtueurn premuqtuerun premuqtuernu premuqtrunue premuqtruneu premuqtruune
premuqtruuen premuqtrueun premuqtruenu premuqtrnuue premuqtrnueu premuqtrnuue premuqtrnueu premuqtrneuu premuqtrneuu
premuqtrunue premuqtruneu premuqtruune premuqtruuen premuqtrueun premuqtruenu premuqtrenuu premuqtrenuu premuqtreunu
premuqtreuun premuqtreuun premuqtreunu premuqtnruue premuqtnrueu premuqtnruue premuqtnrueu premuqtnreuu premuqtnreuu
premuqtnurue premuqtnureu premuqtnuure premuqtnuuer premuqtnueur premuqtnueru premuqtnuure premuqtnuuer premuqtnurue
premuqtnureu premuqtnueru premuqtnueur premuqtneuur premuqtneuru premuqtneuur premuqtneuru premuqtneruu premuqtneruu
premuqturnue premuqturneu premuqturune premuqturuen premuqtureun premuqturenu premuqtunrue premuqtunreu premuqtunure
premuqtunuer premuqtuneur premuqtuneru premuqtuunre premuqtuuner premuqtuurne premuqtuuren premuqtuuern premuqtuuenr
premuqtuenur premuqtuenru premuqtueunr premuqtueurn premuqtuerun premuqtuernu premuqternuu premuqternuu premuqterunu
premuqteruun premuqteruun premuqterunu premuqtenruu premuqtenruu premuqtenuru premuqtenuur premuqtenuur premuqtenuru
premuqteunru premuqteunur premuqteurnu premuqteurun premuqteuurn premuqteuunr premuqteunur premuqteunru premuqteuunr
premuqteuurn premuqteurun premuqteurnu premuqutrnue premuqutrneu premuqutrune premuqutruen premuqutreun premuqutrenu
premuqutnrue premuqutnreu premuqutnure premuqutnuer premuqutneur premuqutneru premuqutunre premuqutuner premuquturne
premuquturen premuqutuern premuqutuenr premuqutenur premuqutenru premuquteunr premuquteurn premuquterun premuquternu
premuqurtnue premuqurtneu premuqurtune premuqurtuen premuqurteun premuqurtenu premuqurntue premuqurnteu premuqurnute
premuqurnuet premuqurneut premuqurnetu premuqurunte premuqurunet premuqurutne premuquruten premuquruetn premuquruent
premuqurenut premuqurentu premuqureunt premuqureutn premuquretun premuquretnu premuqunrtue premuqunrteu premuqunrute
premuqunruet premuqunreut premuqunretu premuquntrue premuquntreu premuqunture premuquntuer premuqunteur premuqunteru
premuqunutre premuqunuter premuqunurte premuqunuret premuqunuert premuqunuetr premuqunetur premuqunetru premuquneutr
premuquneurt premuqunerut premuqunertu premuquurnte premuquurnet premuquurtne premuquurten premuquuretn premuquurent
premuquunrte premuquunret premuquuntre premuquunter premuquunetr premuquunert premuquutnre premuquutner premuquutrne
premuquutren premuquutern premuquutenr premuquuentr premuquuenrt premuquuetnr premuquuetrn premuquuertn premuquuernt
premuquernut premuquerntu premuquerunt premuquerutn premuquertun premuquertnu premuquenrut premuquenrtu premuquenurt
premuquenutr premuquentur premuquentru premuqueunrt premuqueuntr premuqueurnt premuqueurtn premuqueutrn premuqueutnr
premuquetnur premuquetnru premuquetunr premuqueturn premuquetrun premuquetrnu premuqrutnue premuqrutneu premuqrutune
premuqrutuen premuqruteun premuqrutenu premuqruntue premuqrunteu premuqrunute premuqrunuet premuqruneut premuqrunetu
premuqruunte premuqruunet premuqruutne premuqruuten premuqruuetn premuqruuent premuqruenut premuqruentu premuqrueunt
premuqrueutn premuqruetun premuqruetnu premuqrtunue premuqrtuneu premuqrtuune premuqrtuuen premuqrtueun premuqrtuenu
premuqrtnuue premuqrtnueu premuqrtnuue premuqrtnueu premuqrtneuu premuqrtneuu premuqrtunue premuqrtuneu premuqrtuune
premuqrtuuen premuqrtueun premuqrtuenu premuqrtenuu premuqrtenuu premuqrteunu premuqrteuun premuqrteuun premuqrteunu
premuqrntuue premuqrntueu premuqrntuue premuqrntueu premuqrnteuu premuqrnteuu premuqrnutue premuqrnuteu premuqrnuute
premuqrnuuet premuqrnueut premuqrnuetu premuqrnuute premuqrnuuet premuqrnutue premuqrnuteu premuqrnuetu premuqrnueut
premuqrneuut premuqrneutu premuqrneuut premuqrneutu premuqrnetuu premuqrnetuu premuqrutnue premuqrutneu premuqrutune
premuqrutuen premuqruteun premuqrutenu premuqruntue premuqrunteu premuqrunute premuqrunuet premuqruneut premuqrunetu
premuqruunte premuqruunet premuqruutne premuqruuten premuqruuetn premuqruuent premuqruenut premuqruentu premuqrueunt
premuqrueutn premuqruetun premuqruetnu premuqretnuu premuqretnuu premuqretunu premuqretuun premuqretuun premuqretunu
premuqrentuu premuqrentuu premuqrenutu premuqrenuut premuqrenuut premuqrenutu premuqreuntu premuqreunut premuqreutnu
premuqreutun premuqreuutn premuqreuunt premuqreunut premuqreuntu premuqreuunt premuqreuutn premuqreutun premuqreutnu
premuqnurtue premuqnurteu premuqnurute premuqnuruet premuqnureut premuqnuretu premuqnutrue premuqnutreu premuqnuture
premuqnutuer premuqnuteur premuqnuteru premuqnuutre premuqnuuter premuqnuurte premuqnuuret premuqnuuert premuqnuuetr
premuqnuetur premuqnuetru premuqnueutr premuqnueurt premuqnuerut premuqnuertu premuqnrutue premuqnruteu premuqnruute
premuqnruuet premuqnrueut premuqnruetu premuqnrtuue premuqnrtueu premuqnrtuue premuqnrtueu premuqnrteuu premuqnrteuu
premuqnrutue premuqnruteu premuqnruute premuqnruuet premuqnrueut premuqnruetu premuqnretuu premuqnretuu premuqnreutu
premuqnreuut premuqnreuut premuqnreutu premuqntruue premuqntrueu premuqntruue premuqntrueu premuqntreuu premuqntreuu
premuqnturue premuqntureu premuqntuure premuqntuuer premuqntueur premuqntueru premuqntuure premuqntuuer premuqnturue
premuqntureu premuqntueru premuqntueur premuqnteuur premuqnteuru premuqnteuur premuqnteuru premuqnteruu premuqnteruu
premuqnurtue premuqnurteu premuqnurute premuqnuruet premuqnureut premuqnuretu premuqnutrue premuqnutreu premuqnuture
premuqnutuer premuqnuteur premuqnuteru premuqnuutre premuqnuuter premuqnuurte premuqnuuret premuqnuuert premuqnuuetr
premuqnuetur premuqnuetru premuqnueutr premuqnueurt premuqnuerut premuqnuertu premuqnertuu premuqnertuu premuqnerutu
premuqneruut premuqneruut premuqnerutu premuqnetruu premuqnetruu premuqneturu premuqnetuur premuqnetuur premuqneturu
premuqneutru premuqneutur premuqneurtu premuqneurut premuqneuurt premuqneuutr premuqneutur premuqneutru premuqneuutr
premuqneuurt premuqneurut premuqneurtu premuquurnte premuquurnet premuquurtne premuquurten premuquuretn premuquurent
premuquunrte premuquunret premuquuntre premuquunter premuquunetr premuquunert premuquutnre premuquutner premuquutrne
premuquutren premuquutern premuquutenr premuquuentr premuquuenrt premuquuetnr premuquuetrn premuquuertn premuquuernt
premuqurunte premuqurunet premuqurutne premuquruten premuquruetn premuquruent premuqurnute premuqurnuet premuqurntue
premuqurnteu premuqurnetu premuqurneut premuqurtnue premuqurtneu premuqurtune premuqurtuen premuqurteun premuqurtenu
premuqurentu premuqurenut premuquretnu premuquretun premuqureutn premuqureunt premuqunrute premuqunruet premuqunrtue
premuqunrteu premuqunretu premuqunreut premuqunurte premuqunuret premuqunutre premuqunuter premuqunuetr premuqunuert
premuqunture premuquntuer premuquntrue premuquntreu premuqunteru premuqunteur premuquneutr premuquneurt premuqunetur
premuqunetru premuqunertu premuqunerut premuqutrnue premuqutrneu premuqutrune premuqutruen premuqutreun premuqutrenu
premuqutnrue premuqutnreu premuqutnure premuqutnuer premuqutneur premuqutneru premuqutunre premuqutuner premuquturne
premuquturen premuqutuern premuqutuenr premuqutenur premuqutenru premuquteunr premuquteurn premuquterun premuquternu
premuquerntu premuquernut premuquertnu premuquertun premuquerutn premuquerunt premuquenrtu premuquenrut premuquentru
premuquentur premuquenutr premuquenurt premuquetnru premuquetnur premuquetrnu premuquetrun premuqueturn premuquetunr
premuqueuntr premuqueunrt premuqueutnr premuqueutrn premuqueurtn premuqueurnt premuqeurnut premuqeurntu premuqeurunt
premuqeurutn premuqeurtun premuqeurtnu premuqeunrut premuqeunrtu premuqeunurt premuqeunutr premuqeuntur premuqeuntru
premuqeuunrt premuqeuuntr premuqeuurnt premuqeuurtn premuqeuutrn premuqeuutnr premuqeutnur premuqeutnru premuqeutunr
premuqeuturn premuqeutrun premuqeutrnu premuqerunut premuqeruntu premuqeruunt premuqeruutn premuqerutun premuqerutnu
premuqernuut premuqernutu premuqernuut premuqernutu premuqerntuu premuqerntuu premuqerunut premuqeruntu premuqeruunt
premuqeruutn premuqerutun premuqerutnu premuqertnuu premuqertnuu premuqertunu premuqertuun premuqertuun premuqertunu
premuqenruut premuqenrutu premuqenruut premuqenrutu premuqenrtuu premuqenrtuu premuqenurut premuqenurtu premuqenuurt
premuqenuutr premuqenutur premuqenutru premuqenuurt premuqenuutr premuqenurut premuqenurtu premuqenutru premuqenutur
premuqentuur premuqenturu premuqentuur premuqenturu premuqentruu premuqentruu premuqeurnut premuqeurntu premuqeurunt
premuqeurutn premuqeurtun premuqeurtnu premuqeunrut premuqeunrtu premuqeunurt premuqeunutr premuqeuntur premuqeuntru
premuqeuunrt premuqeuuntr premuqeuurnt premuqeuurtn premuqeuutrn premuqeuutnr premuqeutnur premuqeutnru premuqeutunr
premuqeuturn premuqeutrun premuqeutrnu premuqetrnuu premuqetrnuu premuqetrunu premuqetruun premuqetruun premuqetrunu
premuqetnruu premuqetnruu premuqetnuru premuqetnuur premuqetnuur premuqetnuru premuqetunru premuqetunur premuqeturnu
premuqeturun premuqetuurn premuqetuunr premuqetunur premuqetunru premuqetuunr premuqetuurn premuqeturun premuqeturnu
premuuturqne premuuturqen premuuturnqe premuuturneq premuuturenq premuutureqn premuutuqrne premuutuqren premuutuqnre
premuutuqner premuutuqenr premuutuqern premuutunqre premuutunqer premuutunrqe premuutunreq premuutunerq premuutuneqr
premuutueqnr premuutueqrn premuutuenqr premuutuenrq premuutuernq premuutuerqn premuutruqne premuutruqen premuutrunqe
premuutruneq premuutruenq premuutrueqn premuutrqune premuutrquen premuutrqnue premuutrqneu premuutrqenu premuutrqeun
premuutrnque premuutrnqeu premuutrnuqe premuutrnueq premuutrneuq premuutrnequ premuutreqnu premuutrequn premuutrenqu
premuutrenuq premuutreunq premuutreuqn premuutqrune premuutqruen premuutqrnue premuutqrneu premuutqrenu premuutqreun
premuutqurne premuutquren premuutqunre premuutquner premuutquenr premuutquern premuutqnure premuutqnuer premuutqnrue
premuutqnreu premuutqneru premuutqneur premuutqeunr premuutqeurn premuutqenur premuutqenru premuutqernu premuutqerun
premuutnrque premuutnrqeu premuutnruqe premuutnrueq premuutnreuq premuutnrequ premuutnqrue premuutnqreu premuutnqure
premuutnquer premuutnqeur premuutnqeru premuutnuqre premuutnuqer premuutnurqe premuutnureq premuutnuerq premuutnueqr
premuutnequr premuutneqru premuutneuqr premuutneurq premuutneruq premuutnerqu premuuterqnu premuuterqun premuuternqu
premuuternuq premuuterunq premuuteruqn premuuteqrnu premuuteqrun premuuteqnru premuuteqnur premuutequnr premuutequrn
premuutenqru premuutenqur premuutenrqu premuutenruq premuutenurq premuutenuqr premuuteuqnr premuuteuqrn premuuteunqr
premuuteunrq premuuteurnq premuuteurqn premuuutrqne premuuutrqen premuuutrnqe premuuutrneq premuuutrenq premuuutreqn
premuuutqrne premuuutqren premuuutqnre premuuutqner premuuutqenr premuuutqern premuuutnqre premuuutnqer premuuutnrqe
premuuutnreq premuuutnerq premuuutneqr premuuuteqnr premuuuteqrn premuuutenqr premuuutenrq premuuuternq premuuuterqn
premuuurtqne premuuurtqen premuuurtnqe premuuurtneq premuuurtenq premuuurteqn premuuurqtne premuuurqten premuuurqnte
premuuurqnet premuuurqent premuuurqetn premuuurnqte premuuurnqet premuuurntqe premuuurnteq premuuurnetq premuuurneqt
premuuureqnt premuuureqtn premuuurenqt premuuurentq premuuuretnq premuuuretqn premuuuqrtne premuuuqrten premuuuqrnte
premuuuqrnet premuuuqrent premuuuqretn premuuuqtrne premuuuqtren premuuuqtnre premuuuqtner premuuuqtenr premuuuqtern
premuuuqntre premuuuqnter premuuuqnrte premuuuqnret premuuuqnert premuuuqnetr premuuuqetnr premuuuqetrn premuuuqentr
premuuuqenrt premuuuqernt premuuuqertn premuuunrqte premuuunrqet premuuunrtqe premuuunrteq premuuunretq premuuunreqt
premuuunqrte premuuunqret premuuunqtre premuuunqter premuuunqetr premuuunqert premuuuntqre premuuuntqer premuuuntrqe
premuuuntreq premuuunterq premuuunteqr premuuuneqtr premuuuneqrt premuuunetqr premuuunetrq premuuunertq premuuunerqt
premuuuerqnt premuuuerqtn premuuuernqt premuuuerntq premuuuertnq premuuuertqn premuuueqrnt premuuueqrtn premuuueqnrt
premuuueqntr premuuueqtnr premuuueqtrn premuuuenqrt premuuuenqtr premuuuenrqt premuuuenrtq premuuuentrq premuuuentqr
premuuuetqnr premuuuetqrn premuuuetnqr premuuuetnrq premuuuetrnq premuuuetrqn premuurutqne premuurutqen premuurutnqe
premuurutneq premuurutenq premuuruteqn premuuruqtne premuuruqten premuuruqnte premuuruqnet premuuruqent premuuruqetn
premuurunqte premuurunqet premuuruntqe premuurunteq premuurunetq premuuruneqt premuurueqnt premuurueqtn premuuruenqt
premuuruentq premuuruetnq premuuruetqn premuurtuqne premuurtuqen premuurtunqe premuurtuneq premuurtuenq premuurtueqn
premuurtqune premuurtquen premuurtqnue premuurtqneu premuurtqenu premuurtqeun premuurtnque premuurtnqeu premuurtnuqe
premuurtnueq premuurtneuq premuurtnequ premuurteqnu premuurtequn premuurtenqu premuurtenuq premuurteunq premuurteuqn
premuurqtune premuurqtuen premuurqtnue premuurqtneu premuurqtenu premuurqteun premuurqutne premuurquten premuurqunte
premuurqunet premuurquent premuurquetn premuurqnute premuurqnuet premuurqntue premuurqnteu premuurqnetu premuurqneut
premuurqeunt premuurqeutn premuurqenut premuurqentu premuurqetnu premuurqetun premuurntque premuurntqeu premuurntuqe
premuurntueq premuurnteuq premuurntequ premuurnqtue premuurnqteu premuurnqute premuurnquet premuurnqeut premuurnqetu
premuurnuqte premuurnuqet premuurnutqe premuurnuteq premuurnuetq premuurnueqt premuurnequt premuurneqtu premuurneuqt
premuurneutq premuurnetuq premuurnetqu premuuretqnu premuuretqun premuuretnqu premuuretnuq premuuretunq premuuretuqn
premuureqtnu premuureqtun premuureqntu premuureqnut premuurequnt premuurequtn premuurenqtu premuurenqut premuurentqu
premuurentuq premuurenutq premuurenuqt premuureuqnt premuureuqtn premuureunqt premuureuntq premuureutnq premuureutqn
premuuqurtne premuuqurten premuuqurnte premuuqurnet premuuqurent premuuquretn premuuqutrne premuuqutren premuuqutnre
premuuqutner premuuqutenr premuuqutern premuuquntre premuuqunter premuuqunrte premuuqunret premuuqunert premuuqunetr
premuuquetnr premuuquetrn premuuquentr premuuquenrt premuuquernt premuuquertn premuuqrutne premuuqruten premuuqrunte
premuuqrunet premuuqruent premuuqruetn premuuqrtune premuuqrtuen premuuqrtnue premuuqrtneu premuuqrtenu premuuqrteun
premuuqrntue premuuqrnteu premuuqrnute premuuqrnuet premuuqrneut premuuqrnetu premuuqretnu premuuqretun premuuqrentu
premuuqrenut premuuqreunt premuuqreutn premuuqtrune premuuqtruen premuuqtrnue premuuqtrneu premuuqtrenu premuuqtreun
premuuqturne premuuqturen premuuqtunre premuuqtuner premuuqtuenr premuuqtuern premuuqtnure premuuqtnuer premuuqtnrue
premuuqtnreu premuuqtneru premuuqtneur premuuqteunr premuuqteurn premuuqtenur premuuqtenru premuuqternu premuuqterun
premuuqnrtue premuuqnrteu premuuqnrute premuuqnruet premuuqnreut premuuqnretu premuuqntrue premuuqntreu premuuqnture
premuuqntuer premuuqnteur premuuqnteru premuuqnutre premuuqnuter premuuqnurte premuuqnuret premuuqnuert premuuqnuetr
premuuqnetur premuuqnetru premuuqneutr premuuqneurt premuuqnerut premuuqnertu premuuqertnu premuuqertun premuuqerntu
premuuqernut premuuqerunt premuuqerutn premuuqetrnu premuuqetrun premuuqetnru premuuqetnur premuuqetunr premuuqeturn
premuuqentru premuuqentur premuuqenrtu premuuqenrut premuuqenurt premuuqenutr premuuqeutnr premuuqeutrn premuuqeuntr
premuuqeunrt premuuqeurnt premuuqeurtn premuunurqte premuunurqet premuunurtqe premuunurteq premuunuretq premuunureqt
premuunuqrte premuunuqret premuunuqtre premuunuqter premuunuqetr premuunuqert premuunutqre premuunutqer premuunutrqe
premuunutreq premuunuterq premuunuteqr premuunueqtr premuunueqrt premuunuetqr premuunuetrq premuunuertq premuunuerqt
premuunruqte premuunruqet premuunrutqe premuunruteq premuunruetq premuunrueqt premuunrqute premuunrquet premuunrqtue
premuunrqteu premuunrqetu premuunrqeut premuunrtque premuunrtqeu premuunrtuqe premuunrtueq premuunrteuq premuunrtequ
premuunreqtu premuunrequt premuunretqu premuunretuq premuunreutq premuunreuqt premuunqrute premuunqruet premuunqrtue
premuunqrteu premuunqretu premuunqreut premuunqurte premuunquret premuunqutre premuunquter premuunquetr premuunquert
premuunqture premuunqtuer premuunqtrue premuunqtreu premuunqteru premuunqteur premuunqeutr premuunqeurt premuunqetur
premuunqetru premuunqertu premuunqerut premuuntrque premuuntrqeu premuuntruqe premuuntrueq premuuntreuq premuuntrequ
premuuntqrue premuuntqreu premuuntqure premuuntquer premuuntqeur premuuntqeru premuuntuqre premuuntuqer premuunturqe
premuuntureq premuuntuerq premuuntueqr premuuntequr premuunteqru premuunteuqr premuunteurq premuunteruq premuunterqu
premuunerqtu premuunerqut premuunertqu premuunertuq premuunerutq premuuneruqt premuuneqrtu premuuneqrut premuuneqtru
premuuneqtur premuunequtr premuunequrt premuunetqru premuunetqur premuunetrqu premuunetruq premuuneturq premuunetuqr
premuuneuqtr premuuneuqrt premuuneutqr premuuneutrq premuuneurtq premuuneurqt premuueurqnt premuueurqtn premuueurnqt
premuueurntq premuueurtnq premuueurtqn premuueuqrnt premuueuqrtn premuueuqnrt premuueuqntr premuueuqtnr premuueuqtrn
premuueunqrt premuueunqtr premuueunrqt premuueunrtq premuueuntrq premuueuntqr premuueutqnr premuueutqrn premuueutnqr
premuueutnrq premuueutrnq premuueutrqn premuueruqnt premuueruqtn premuuerunqt premuueruntq premuuerutnq premuuerutqn
premuuerqunt premuuerqutn premuuerqnut premuuerqntu premuuerqtnu premuuerqtun premuuernqut premuuernqtu premuuernuqt
premuuernutq premuuerntuq premuuerntqu premuuertqnu premuuertqun premuuertnqu premuuertnuq premuuertunq premuuertuqn
premuueqrunt premuueqrutn premuueqrnut premuueqrntu premuueqrtnu premuueqrtun premuuequrnt premuuequrtn premuuequnrt
premuuequntr premuuequtnr premuuequtrn premuueqnurt premuueqnutr premuueqnrut premuueqnrtu premuueqntru premuueqntur
premuueqtunr premuueqturn premuueqtnur premuueqtnru premuueqtrnu premuueqtrun premuuenrqut premuuenrqtu premuuenruqt
premuuenrutq premuuenrtuq premuuenrtqu premuuenqrut premuuenqrtu premuuenqurt premuuenqutr premuuenqtur premuuenqtru
premuuenuqrt premuuenuqtr premuuenurqt premuuenurtq premuuenutrq premuuenutqr premuuentqur premuuentqru premuuentuqr
premuuenturq premuuentruq premuuentrqu premuuetrqnu premuuetrqun premuuetrnqu premuuetrnuq premuuetrunq premuuetruqn
premuuetqrnu premuuetqrun premuuetqnru premuuetqnur premuuetqunr premuuetqurn premuuetnqru premuuetnqur premuuetnrqu
premuuetnruq premuuetnurq premuuetnuqr premuuetuqnr premuuetuqrn premuuetunqr premuuetunrq premuueturnq premuueturqn
premueturqun premueturqnu premueturuqn premueturunq premueturnuq premueturnqu premuetuqrun premuetuqrnu premuetuqurn
premuetuqunr premuetuqnur premuetuqnru premuetuuqrn premuetuuqnr premuetuurqn premuetuurnq premuetuunrq premuetuunqr
premuetunqur premuetunqru premuetunuqr premuetunurq premuetunruq premuetunrqu premuetruqun premuetruqnu premuetruuqn
premuetruunq premuetrunuq premuetrunqu premuetrquun premuetrqunu premuetrquun premuetrqunu premuetrqnuu premuetrqnuu
premuetruqun premuetruqnu premuetruuqn premuetruunq premuetrunuq premuetrunqu premuetrnquu premuetrnquu premuetrnuqu
premuetrnuuq premuetrnuuq premuetrnuqu premuetqruun premuetqrunu premuetqruun premuetqrunu premuetqrnuu premuetqrnuu
premuetqurun premuetqurnu premuetquurn premuetquunr premuetqunur premuetqunru premuetquurn premuetquunr premuetqurun
premuetqurnu premuetqunru premuetqunur premuetqnuur premuetqnuru premuetqnuur premuetqnuru premuetqnruu premuetqnruu
premueturqun premueturqnu premueturuqn premueturunq premueturnuq premueturnqu premuetuqrun premuetuqrnu premuetuqurn
premuetuqunr premuetuqnur premuetuqnru premuetuuqrn premuetuuqnr premuetuurqn premuetuurnq premuetuunrq premuetuunqr
premuetunqur premuetunqru premuetunuqr premuetunurq premuetunruq premuetunrqu premuetnrquu premuetnrquu premuetnruqu
premuetnruuq premuetnruuq premuetnruqu premuetnqruu premuetnqruu premuetnquru premuetnquur premuetnquur premuetnquru
premuetnuqru premuetnuqur premuetnurqu premuetnuruq premuetnuurq premuetnuuqr premuetnuqur premuetnuqru premuetnuuqr
premuetnuurq premuetnuruq premuetnurqu premueutrqun premueutrqnu premueutruqn premueutrunq premueutrnuq premueutrnqu
premueutqrun premueutqrnu premueutqurn premueutqunr premueutqnur premueutqnru premueutuqrn premueutuqnr premueuturqn
premueuturnq premueutunrq premueutunqr premueutnqur premueutnqru premueutnuqr premueutnurq premueutnruq premueutnrqu
premueurtqun premueurtqnu premueurtuqn premueurtunq premueurtnuq premueurtnqu premueurqtun premueurqtnu premueurqutn
premueurqunt premueurqnut premueurqntu premueuruqtn premueuruqnt premueurutqn premueurutnq premueuruntq premueurunqt
premueurnqut premueurnqtu premueurnuqt premueurnutq premueurntuq premueurntqu premueuqrtun premueuqrtnu premueuqrutn
premueuqrunt premueuqrnut premueuqrntu premueuqtrun premueuqtrnu premueuqturn premueuqtunr premueuqtnur premueuqtnru
premueuqutrn premueuqutnr premueuqurtn premueuqurnt premueuqunrt premueuquntr premueuqntur premueuqntru premueuqnutr
premueuqnurt premueuqnrut premueuqnrtu premueuurqtn premueuurqnt premueuurtqn premueuurtnq premueuurntq premueuurnqt
premueuuqrtn premueuuqrnt premueuuqtrn premueuuqtnr premueuuqntr premueuuqnrt premueuutqrn premueuutqnr premueuutrqn
premueuutrnq premueuutnrq premueuutnqr premueuunqtr premueuunqrt premueuuntqr premueuuntrq premueuunrtq premueuunrqt
premueunrqut premueunrqtu premueunruqt premueunrutq premueunrtuq premueunrtqu premueunqrut premueunqrtu premueunqurt
premueunqutr premueunqtur premueunqtru premueunuqrt premueunuqtr premueunurqt premueunurtq premueunutrq premueunutqr
premueuntqur premueuntqru premueuntuqr premueunturq premueuntruq premueuntrqu premuerutqun premuerutqnu premuerutuqn
premuerutunq premuerutnuq premuerutnqu premueruqtun premueruqtnu premueruqutn premueruqunt premueruqnut premueruqntu
premueruuqtn premueruuqnt premueruutqn premueruutnq premueruuntq premueruunqt premuerunqut premuerunqtu premuerunuqt
premuerunutq premueruntuq premueruntqu premuertuqun premuertuqnu premuertuuqn premuertuunq premuertunuq premuertunqu
premuertquun premuertqunu premuertquun premuertqunu premuertqnuu premuertqnuu premuertuqun premuertuqnu premuertuuqn
premuertuunq premuertunuq premuertunqu premuertnquu premuertnquu premuertnuqu premuertnuuq premuertnuuq premuertnuqu
premuerqtuun premuerqtunu premuerqtuun premuerqtunu premuerqtnuu premuerqtnuu premuerqutun premuerqutnu premuerquutn
premuerquunt premuerqunut premuerquntu premuerquutn premuerquunt premuerqutun premuerqutnu premuerquntu premuerqunut
premuerqnuut premuerqnutu premuerqnuut premuerqnutu premuerqntuu premuerqntuu premuerutqun premuerutqnu premuerutuqn
premuerutunq premuerutnuq premuerutnqu premueruqtun premueruqtnu premueruqutn premueruqunt premueruqnut premueruqntu
premueruuqtn premueruuqnt premueruutqn premueruutnq premueruuntq premueruunqt premuerunqut premuerunqtu premuerunuqt
premuerunutq premueruntuq premueruntqu premuerntquu premuerntquu premuerntuqu premuerntuuq premuerntuuq premuerntuqu
premuernqtuu premuernqtuu premuernqutu premuernquut premuernquut premuernqutu premuernuqtu premuernuqut premuernutqu
premuernutuq premuernuutq premuernuuqt premuernuqut premuernuqtu premuernuuqt premuernuutq premuernutuq premuernutqu
premuequrtun premuequrtnu premuequrutn premuequrunt premuequrnut premuequrntu premuequtrun premuequtrnu premuequturn
premuequtunr premuequtnur premuequtnru premuequutrn premuequutnr premuequurtn premuequurnt premuequunrt premuequuntr
premuequntur premuequntru premuequnutr premuequnurt premuequnrut premuequnrtu premueqrutun premueqrutnu premueqruutn
premueqruunt premueqrunut premueqruntu premueqrtuun premueqrtunu premueqrtuun premueqrtunu premueqrtnuu premueqrtnuu
premueqrutun premueqrutnu premueqruutn premueqruunt premueqrunut premueqruntu premueqrntuu premueqrntuu premueqrnutu
premueqrnuut premueqrnuut premueqrnutu premueqtruun premueqtrunu premueqtruun premueqtrunu premueqtrnuu premueqtrnuu
premueqturun premueqturnu premueqtuurn premueqtuunr premueqtunur premueqtunru premueqtuurn premueqtuunr premueqturun
premueqturnu premueqtunru premueqtunur premueqtnuur premueqtnuru premueqtnuur premueqtnuru premueqtnruu premueqtnruu
premuequrtun premuequrtnu premuequrutn premuequrunt premuequrnut premuequrntu premuequtrun premuequtrnu premuequturn
premuequtunr premuequtnur premuequtnru premuequutrn premuequutnr premuequurtn premuequurnt premuequunrt premuequuntr
premuequntur premuequntru premuequnutr premuequnurt premuequnrut premuequnrtu premueqnrtuu premueqnrtuu premueqnrutu
premueqnruut premueqnruut premueqnrutu premueqntruu premueqntruu premueqnturu premueqntuur premueqntuur premueqnturu
premueqnutru premueqnutur premueqnurtu premueqnurut premueqnuurt premueqnuutr premueqnutur premueqnutru premueqnuutr
premueqnuurt premueqnurut premueqnurtu premueuurqtn premueuurqnt premueuurtqn premueuurtnq premueuurntq premueuurnqt
premueuuqrtn premueuuqrnt premueuuqtrn premueuuqtnr premueuuqntr premueuuqnrt premueuutqrn premueuutqnr premueuutrqn
premueuutrnq premueuutnrq premueuutnqr premueuunqtr premueuunqrt premueuuntqr premueuuntrq premueuunrtq premueuunrqt
premueuruqtn premueuruqnt premueurutqn premueurutnq premueuruntq premueurunqt premueurqutn premueurqunt premueurqtun
premueurqtnu premueurqntu premueurqnut premueurtqun premueurtqnu premueurtuqn premueurtunq premueurtnuq premueurtnqu
premueurnqtu premueurnqut premueurntqu premueurntuq premueurnutq premueurnuqt premueuqrutn premueuqrunt premueuqrtun
premueuqrtnu premueuqrntu premueuqrnut premueuqurtn premueuqurnt premueuqutrn premueuqutnr premueuquntr premueuqunrt
premueuqturn premueuqtunr premueuqtrun premueuqtrnu premueuqtnru premueuqtnur premueuqnutr premueuqnurt premueuqntur
premueuqntru premueuqnrtu premueuqnrut premueutrqun premueutrqnu premueutruqn premueutrunq premueutrnuq premueutrnqu
premueutqrun premueutqrnu premueutqurn premueutqunr premueutqnur premueutqnru premueutuqrn premueutuqnr premueuturqn
premueuturnq premueutunrq premueutunqr premueutnqur premueutnqru premueutnuqr premueutnurq premueutnruq premueutnrqu
premueunrqtu premueunrqut premueunrtqu premueunrtuq premueunrutq premueunruqt premueunqrtu premueunqrut premueunqtru
premueunqtur premueunqutr premueunqurt premueuntqru premueuntqur premueuntrqu premueuntruq premueunturq premueuntuqr
premueunuqtr premueunuqrt premueunutqr premueunutrq premueunurtq premueunurqt premuenurqut premuenurqtu premuenuruqt
premuenurutq premuenurtuq premuenurtqu premuenuqrut premuenuqrtu premuenuqurt premuenuqutr premuenuqtur premuenuqtru
premuenuuqrt premuenuuqtr premuenuurqt premuenuurtq premuenuutrq premuenuutqr premuenutqur premuenutqru premuenutuqr
premuenuturq premuenutruq premuenutrqu premuenruqut premuenruqtu premuenruuqt premuenruutq premuenrutuq premuenrutqu
premuenrquut premuenrqutu premuenrquut premuenrqutu premuenrqtuu premuenrqtuu premuenruqut premuenruqtu premuenruuqt
premuenruutq premuenrutuq premuenrutqu premuenrtquu premuenrtquu premuenrtuqu premuenrtuuq premuenrtuuq premuenrtuqu
premuenqruut premuenqrutu premuenqruut premuenqrutu premuenqrtuu premuenqrtuu premuenqurut premuenqurtu premuenquurt
premuenquutr premuenqutur premuenqutru premuenquurt premuenquutr premuenqurut premuenqurtu premuenqutru premuenqutur
premuenqtuur premuenqturu premuenqtuur premuenqturu premuenqtruu premuenqtruu premuenurqut premuenurqtu premuenuruqt
premuenurutq premuenurtuq premuenurtqu premuenuqrut premuenuqrtu premuenuqurt premuenuqutr premuenuqtur premuenuqtru
premuenuuqrt premuenuuqtr premuenuurqt premuenuurtq premuenuutrq premuenuutqr premuenutqur premuenutqru premuenutuqr
premuenuturq premuenutruq premuenutrqu premuentrquu premuentrquu premuentruqu premuentruuq premuentruuq premuentruqu
premuentqruu premuentqruu premuentquru premuentquur premuentquur premuentquru premuentuqru premuentuqur premuenturqu
premuenturuq premuentuurq premuentuuqr premuentuqur premuentuqru premuentuuqr premuentuurq premuenturuq premuenturqu

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us