easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

secessionists

labantisque

reweighing

rebroadening

dextreque

trenchlike

typhlectomy

inweaves

ilana

dioritic

titillating

matheis

netepichnaja

buggering

rebeccaism

purdham

confusaeque

appellatisque


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: praecipuaeque
cipher variations:
qsbfdjqvbfrvf rtcgekrwcgswg sudhflsxdhtxh tveigmtyeiuyi uwfjhnuzfjvzj
vxgkiovagkwak wyhljpwbhlxbl xzimkqxcimycm yajnlrydjnzdn zbkomszekoaeo
aclpntaflpbfp bdmqoubgmqcgq cenrpvchnrdhr dfosqwdioseis egptrxejptfjt
fhqusyfkqugku girvtzglrvhlv hjswuahmswimw iktxvbintxjnx jluywcjouykoy
kmvzxdkpvzlpz lnwayelqwamqa moxbzfmrxbnrb npycagnsycosc oqzdbhotzdptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: praecipuaeque
Cipher: kizvxrkfzvjfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: praecipuaeque
Cipher: ABBBA BAAAA AAAAA AABAA AAABA ABAAA ABBBA BAABB AAAAA AABAA ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: praecipuaeque
cipher variations:
qsbfdjqvbfrvfuabnhzujbnxjnyibvlpyxbvdxvcqbdpfclbdjldgybltvgzblpzlkgbtxlknbtvntswbjfrspbjhpjwebrjhwdbrndr
ambznxarbztrzeubhrnefbhzfhicbpvditbpftpmkbxztmhbxlhxrtcgekrwcgswgvbcoiavkcoykozjcwmqzycweywdrceqgdmcekme
hzcmuwhacmqamlhcuymlocuwoutxckgstqckiqkxfcskixecsoesbncaoybscausafvcisofgciagijdcqwejucqguqnlcyaunicymiy
sudhflsxdhtxhwcdpjbwldpzlpakdxnrazdxfzxesdfrhendflnfiadnvxibdnrbnmidvznmpdvxpvuydlhturdljrlygdtljyfdtpft
codbpzctdbvtbgwdjtpghdjbhjkedrxfkvdrhvromdzbvojdznjztveigmtyeiuyixdeqkcxmeqamqbleyosbaeygayftegsifoegmog
jbeowyjceosconjewaonqewyqwvzemiuvsemksmzheumkzgeuqgudpecqaduecwuchxekuqhiekciklfesyglwesiwspneacwpkeaoka
uwfjhnuzfjvzjyefrldynfrbnrcmfzptcbfzhbzgufhtjgpfhnphkcfpxzkdfptdpokfxbporfxzrxwafnjvwtfnltnaifvnlahfvrhv
eqfdrbevfdxvdiyflvrijfldjlmgftzhmxftjxtqofbdxqlfbplbvxgkiovagkwakzfgsmezogscosdngaqudcgaicahvgiukhqgioqi
ldgqyalegqueqplgycqpsgyasyxbgokwxugomuobjgwombigwsiwfrgescfwgeywejzgmwsjkgmekmnhguainygukyurpgceyrmgcqmc
wyhljpwbhlxblaghtnfaphtdpteohbrvedhbjdbiwhjvlirhjprjmehrzbmfhrvfrqmhzdrqthzbtzychplxyvhpnvpckhxpncjhxtjx
gshftdgxhfzxfkahnxtklhnflnoihvbjozhvlzvsqhdfzsnhdrndxzimkqxcimycmbhiuogbqiuequfpicswfeickecjxikwmjsikqsk
nfisacngiswgsrniaesruiacuazdiqmyzwiqowqdliyqodkiyukyhtiguehyigayglbioyulmiogmopjiwckpaiwmawtriegatoiesoe
yajnlrydjnzdncijvphcrjvfrvgqjdtxgfjdlfdkyjlxnktjlrtlogjtbdohjtxhtsojbftsvjbdvbaejrnzaxjrpxremjzrpeljzvlz
iujhvfizjhbzhmcjpzvmnjphnpqkjxdlqbjxnbxusjfhbupjftpfzbkomszekoaeodjkwqidskwgswhrkeuyhgkemgelzkmyolukmsum
phkucepikuyiutpkcgutwkcewcbfksoabyksqysfnkasqfmkawmajvkiwgjakicaindkqawnokqioqrlkyemrckyocyvtkgicvqkguqg
aclpntaflpbfpeklxrjetlxhtxislfvzihlfnhfmalnzpmvlntvnqilvdfqjlvzjvuqldhvuxldfxdcgltpbczltrztgolbtrgnlbxnb
kwljxhkbljdbjoelrbxoplrjprsmlzfnsdlzpdzwulhjdwrlhvrhbdmqoubgmqcgqflmyskfumyiuyjtmgwajimgoignbmoaqnwmouwo
rjmwegrkmwakwvrmeiwvymegyedhmuqcdamusauhpmcushomcyoclxmkyilcmkeckpfmscypqmskqstnmagotemaqeaxvmikexsmiwsi
cenrpvchnrdhrgmnztlgvnzjvzkunhxbkjnhpjhocnpbroxnpvxpsknxfhslnxblxwsnfjxwznfhzfeinvrdebnvtbviqndvtipndzpd
mynlzjmdnlfdlqgntdzqrntlrtuonbhpufnbrfbywnjlfytnjxtjdfosqwdioseishnoaumhwoakwalvoiyclkoiqkipdoqcspyoqwyq
tloygitmoycmyxtogkyxaogiagfjowsefcowucwjroewujqoeaqenzomakneomgemrhouearsoumsuvpociqvgocsgczxokmgzuokyuk
egptrxejptfjtiopbvnixpblxbmwpjzdmlpjrljqeprdtqzprxzrumpzhjunpzdnzyuphlzybphjbhgkpxtfgdpxvdxkspfxvkrpfbrf
oapnblofpnhfnsipvfbstpvntvwqpdjrwhpdthdayplnhavplzvlfhqusyfkqugkujpqcwojyqcmycnxqkaenmqksmkrfqseuraqsyas
vnqaikvoqaeoazvqimazcqikcihlqyugheqyweyltqgywlsqgcsgpbqocmpgqoigotjqwgctuqwouwxrqeksxiqeuiebzqmoibwqmawm
girvtzglrvhlvkqrdxpkzrdnzdoyrlbfonrltnlsgrtfvsbrtzbtworbjlwprbfpbawrjnbadrjldjimrzvhifrzxfzmurhzxmtrhdth
qcrpdnqhrpjhpukrxhduvrxpvxysrfltyjrfvjfcarnpjcxrnbxnhjswuahmswimwlrseyqlaseoaepzsmcgposmuomthsugwtcsuacu
xpsckmxqscgqcbxskocbeskmekjnsawijgsayganvsiaynusieuirdsqeorisqkiqvlsyievwsyqwyztsgmuzksgwkgdbsoqkdysocyo
iktxvbintxjnxmstfzrmbtfpbfqatndhqptnvpnuitvhxudtvbdvyqtdlnyrtdhrdcytlpdcftlnflkotbxjkhtbzhbowtjbzovtjfvj
setrfpsjtrljrwmtzjfwxtzrxzauthnvalthxlhectprleztpdzpjluywcjouykoyntugasncugqcgrbuoeirquowqovjuwiyveuwcew
zruemozsueisedzumqedgumogmlpucykliucaicpxukcapwukgwktfusgqtkusmksxnuakgxyuasyabvuiowbmuiymifduqsmfauqeaq
kmvzxdkpvzlpzouvhbtodvhrdhscvpfjsrvpxrpwkvxjzwfvxdfxasvfnpatvfjtfeavnrfehvnphnmqvdzlmjvdbjdqyvldbqxvlhxl
ugvthrulvtnltyovblhyzvbtzbcwvjpxcnvjznjgevrtngbvrfbrlnwayelqwamqapvwicupewiseitdwqgktswqysqxlwykaxgwyegy
btwgoqbuwgkugfbwosgfiwoqionrweamnkweckerzwmecrywmiymvhwuisvmwuomuzpwcmizawcuacdxwkqydowkaokhfwsuohcwsgcs
moxbzfmrxbnrbqwxjdvqfxjtfjuexrhlutxrztrymxzlbyhxzfhzcuxhprcvxhlvhgcxpthgjxprjposxfbnolxfdlfsaxnfdszxnjzn
wixvjtwnxvpnvaqxdnjabxdvbdeyxlrzepxlbpligxtvpidxthdtnpycagnsycoscrxykewrgykugkvfysimvuysausznyamcziyagia
dvyiqsdwyimwihdyquihkyqskqptygcopmygemgtbyogetayokaoxjywkuxoywqowbryeokbcyewcefzymsafqymcqmjhyuwqjeyuieu
oqzdbhotzdptdsyzlfxshzlvhlwgztjnwvztbvtaozbndajzbhjbewzjrtexzjnxjiezrvjilzrtlrquzhdpqnzhfnhuczphfubzplbp
ykzxlvypzxrpxcszfplcdzfxdfgazntbgrzndrnkizvxrkfzvjfvpraecipuaequetzamgytiamwimxhaukoxwaucwubpacoebkacikc
fxaksufyakoykjfaswkjmasumsrvaieqroaigoivdaqigvcaqmcqzlaymwzqaysqydtagqmdeagyeghbaouchsaoesoljawyslgawkgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: praecipuaeque
Cipher: cenrpvchnrdhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: praecipuaeque
Cipher: 53241151314253541151145451

Extended Methods:
Method #1

Plaintext: praecipuaeque
method variations:
uwfkhouzfkvzkzblpntzelpaepegqusyekqufkukmvzxdkpvzlpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
p r a e c i p u a e q u e 
5 2 1 5 3 4 5 5 1 5 1 5 5 
3 4 1 1 1 2 3 4 1 1 4 4 1 
They are then read out in rows:
52153455151553411123411441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: praecipuaeque
Cipher: kvszvvpdamdqd

Read more ...
Method #3

Plaintext: praecipuaeque
method variations:
hdvlqwxdvayyv dvlqwxdvayyvh vlqwxdvayyvhd
lqwxdvayyvhdv qwxdvayyvhdvl wxdvayyvhdvlq
xdvayyvhdvlqw dvayyvhdvlqwx vayyvhdvlqwxd
ayyvhdvlqwxdv yyvhdvlqwxdva yvhdvlqwxdvay
vhdvlqwxdvayy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: praecipuaeque

first 5040 cipher variations(6187239489 total)
praecipuaeque praecipuaeqeu praecipuaeuqe praecipuaeueq praecipuaeeuq praecipuaeequ praecipuaqeue praecipuaqeeu praecipuaquee
praecipuaquee praecipuaqeue praecipuaqeeu praecipuauqee praecipuauqee praecipuaueqe praecipuaueeq praecipuaueeq praecipuaueqe
praecipuaeque praecipuaeqeu praecipuaeuqe praecipuaeueq praecipuaeeuq praecipuaeequ praecipueaque praecipueaqeu praecipueauqe
praecipueaueq praecipueaeuq praecipueaequ praecipueqaue praecipueqaeu praecipuequae praecipuequea praecipueqeua praecipueqeau
praecipueuqae praecipueuqea praecipueuaqe praecipueuaeq praecipueueaq praecipueueqa praecipueequa praecipueeqau praecipueeuqa
praecipueeuaq praecipueeauq praecipueeaqu praecipuqeaue praecipuqeaeu praecipuqeuae praecipuqeuea praecipuqeeua praecipuqeeau
praecipuqaeue praecipuqaeeu praecipuqauee praecipuqauee praecipuqaeue praecipuqaeeu praecipuquaee praecipuquaee praecipuqueae
praecipuqueea praecipuqueea praecipuqueae praecipuqeaue praecipuqeaeu praecipuqeuae praecipuqeuea praecipuqeeua praecipuqeeau
praecipuueqae praecipuueqea praecipuueaqe praecipuueaeq praecipuueeaq praecipuueeqa praecipuuqeae praecipuuqeea praecipuuqaee
praecipuuqaee praecipuuqeae praecipuuqeea praecipuuaqee praecipuuaqee praecipuuaeqe praecipuuaeeq praecipuuaeeq praecipuuaeqe
praecipuueqae praecipuueqea praecipuueaqe praecipuueaeq praecipuueeaq praecipuueeqa praecipueequa praecipueeqau praecipueeuqa
praecipueeuaq praecipueeauq praecipueeaqu praecipueqeua praecipueqeau praecipuequea praecipuequae praecipueqaue praecipueqaeu
praecipueuqea praecipueuqae praecipueueqa praecipueueaq praecipueuaeq praecipueuaqe praecipueaque praecipueaqeu praecipueauqe
praecipueaueq praecipueaeuq praecipueaequ praecipaueque praecipaueqeu praecipaueuqe praecipaueueq praecipaueeuq praecipaueequ
praecipauqeue praecipauqeeu praecipauquee praecipauquee praecipauqeue praecipauqeeu praecipauuqee praecipauuqee praecipauueqe
praecipauueeq praecipauueeq praecipauueqe praecipaueque praecipaueqeu praecipaueuqe praecipaueueq praecipaueeuq praecipaueequ
praecipaeuque praecipaeuqeu praecipaeuuqe praecipaeuueq praecipaeueuq praecipaeuequ praecipaequue praecipaequeu praecipaequue
praecipaequeu praecipaeqeuu praecipaeqeuu praecipaeuque praecipaeuqeu praecipaeuuqe praecipaeuueq praecipaeueuq praecipaeuequ
praecipaeequu praecipaeequu praecipaeeuqu praecipaeeuuq praecipaeeuuq praecipaeeuqu praecipaqeuue praecipaqeueu praecipaqeuue
praecipaqeueu praecipaqeeuu praecipaqeeuu praecipaqueue praecipaqueeu praecipaquuee praecipaquuee praecipaqueue praecipaqueeu
praecipaquuee praecipaquuee praecipaqueue praecipaqueeu praecipaqueeu praecipaqueue praecipaqeuue praecipaqeueu praecipaqeuue
praecipaqeueu praecipaqeeuu praecipaqeeuu praecipaueque praecipaueqeu praecipaueuqe praecipaueueq praecipaueeuq praecipaueequ
praecipauqeue praecipauqeeu praecipauquee praecipauquee praecipauqeue praecipauqeeu praecipauuqee praecipauuqee praecipauueqe
praecipauueeq praecipauueeq praecipauueqe praecipaueque praecipaueqeu praecipaueuqe praecipaueueq praecipaueeuq praecipaueequ
praecipaeequu praecipaeequu praecipaeeuqu praecipaeeuuq praecipaeeuuq praecipaeeuqu praecipaeqeuu praecipaeqeuu praecipaequeu
praecipaequue praecipaequue praecipaequeu praecipaeuqeu praecipaeuque praecipaeuequ praecipaeueuq praecipaeuueq praecipaeuuqe
praecipaeuque praecipaeuqeu praecipaeuuqe praecipaeuueq praecipaeueuq praecipaeuequ praecipeauque praecipeauqeu praecipeauuqe
praecipeauueq praecipeaueuq praecipeauequ praecipeaquue praecipeaqueu praecipeaquue praecipeaqueu praecipeaqeuu praecipeaqeuu
praecipeauque praecipeauqeu praecipeauuqe praecipeauueq praecipeaueuq praecipeauequ praecipeaequu praecipeaequu praecipeaeuqu
praecipeaeuuq praecipeaeuuq praecipeaeuqu praecipeuaque praecipeuaqeu praecipeuauqe praecipeuaueq praecipeuaeuq praecipeuaequ
praecipeuqaue praecipeuqaeu praecipeuquae praecipeuquea praecipeuqeua praecipeuqeau praecipeuuqae praecipeuuqea praecipeuuaqe
praecipeuuaeq praecipeuueaq praecipeuueqa praecipeuequa praecipeueqau praecipeueuqa praecipeueuaq praecipeueauq praecipeueaqu
praecipequaue praecipequaeu praecipequuae praecipequuea praecipequeua praecipequeau praecipeqauue praecipeqaueu praecipeqauue
praecipeqaueu praecipeqaeuu praecipeqaeuu praecipequaue praecipequaeu praecipequuae praecipequuea praecipequeua praecipequeau
praecipeqeauu praecipeqeauu praecipeqeuau praecipeqeuua praecipeqeuua praecipeqeuau praecipeuuqae praecipeuuqea praecipeuuaqe
praecipeuuaeq praecipeuueaq praecipeuueqa praecipeuquae praecipeuquea praecipeuqaue praecipeuqaeu praecipeuqeau praecipeuqeua
praecipeuaque praecipeuaqeu praecipeuauqe praecipeuaueq praecipeuaeuq praecipeuaequ praecipeueqau praecipeuequa praecipeueaqu
praecipeueauq praecipeueuaq praecipeueuqa praecipeeuqua praecipeeuqau praecipeeuuqa praecipeeuuaq praecipeeuauq praecipeeuaqu
praecipeequua praecipeequau praecipeequua praecipeequau praecipeeqauu praecipeeqauu praecipeeuqua praecipeeuqau praecipeeuuqa
praecipeeuuaq praecipeeuauq praecipeeuaqu praecipeeaquu praecipeeaquu praecipeeauqu praecipeeauuq praecipeeauuq praecipeeauqu
praecipqaeuue praecipqaeueu praecipqaeuue praecipqaeueu praecipqaeeuu praecipqaeeuu praecipqaueue praecipqaueeu praecipqauuee
praecipqauuee praecipqaueue praecipqaueeu praecipqauuee praecipqauuee praecipqaueue praecipqaueeu praecipqaueeu praecipqaueue
praecipqaeuue praecipqaeueu praecipqaeuue praecipqaeueu praecipqaeeuu praecipqaeeuu praecipqeauue praecipqeaueu praecipqeauue
praecipqeaueu praecipqeaeuu praecipqeaeuu praecipqeuaue praecipqeuaeu praecipqeuuae praecipqeuuea praecipqeueua praecipqeueau
praecipqeuuae praecipqeuuea praecipqeuaue praecipqeuaeu praecipqeueau praecipqeueua praecipqeeuua praecipqeeuau praecipqeeuua
praecipqeeuau praecipqeeauu praecipqeeauu praecipqueaue praecipqueaeu praecipqueuae praecipqueuea praecipqueeua praecipqueeau
praecipquaeue praecipquaeeu praecipquauee praecipquauee praecipquaeue praecipquaeeu praecipquuaee praecipquuaee praecipquueae
praecipquueea praecipquueea praecipquueae praecipqueaue praecipqueaeu praecipqueuae praecipqueuea praecipqueeua praecipqueeau
praecipqueuae praecipqueuea praecipqueaue praecipqueaeu praecipqueeau praecipqueeua praecipquueae praecipquueea praecipquuaee
praecipquuaee praecipquueae praecipquueea praecipquauee praecipquauee praecipquaeue praecipquaeeu praecipquaeeu praecipquaeue
praecipqueuae praecipqueuea praecipqueaue praecipqueaeu praecipqueeau praecipqueeua praecipqeeuua praecipqeeuau praecipqeeuua
praecipqeeuau praecipqeeauu praecipqeeauu praecipqeueua praecipqeueau praecipqeuuea praecipqeuuae praecipqeuaue praecipqeuaeu
praecipqeuuea praecipqeuuae praecipqeueua praecipqeueau praecipqeuaeu praecipqeuaue praecipqeauue praecipqeaueu praecipqeauue
praecipqeaueu praecipqeaeuu praecipqeaeuu praecipuaeque praecipuaeqeu praecipuaeuqe praecipuaeueq praecipuaeeuq praecipuaeequ
praecipuaqeue praecipuaqeeu praecipuaquee praecipuaquee praecipuaqeue praecipuaqeeu praecipuauqee praecipuauqee praecipuaueqe
praecipuaueeq praecipuaueeq praecipuaueqe praecipuaeque praecipuaeqeu praecipuaeuqe praecipuaeueq praecipuaeeuq praecipuaeequ
praecipueaque praecipueaqeu praecipueauqe praecipueaueq praecipueaeuq praecipueaequ praecipueqaue praecipueqaeu praecipuequae
praecipuequea praecipueqeua praecipueqeau praecipueuqae praecipueuqea praecipueuaqe praecipueuaeq praecipueueaq praecipueueqa
praecipueequa praecipueeqau praecipueeuqa praecipueeuaq praecipueeauq praecipueeaqu praecipuqeaue praecipuqeaeu praecipuqeuae
praecipuqeuea praecipuqeeua praecipuqeeau praecipuqaeue praecipuqaeeu praecipuqauee praecipuqauee praecipuqaeue praecipuqaeeu
praecipuquaee praecipuquaee praecipuqueae praecipuqueea praecipuqueea praecipuqueae praecipuqeaue praecipuqeaeu praecipuqeuae
praecipuqeuea praecipuqeeua praecipuqeeau praecipuueqae praecipuueqea praecipuueaqe praecipuueaeq praecipuueeaq praecipuueeqa
praecipuuqeae praecipuuqeea praecipuuqaee praecipuuqaee praecipuuqeae praecipuuqeea praecipuuaqee praecipuuaqee praecipuuaeqe
praecipuuaeeq praecipuuaeeq praecipuuaeqe praecipuueqae praecipuueqea praecipuueaqe praecipuueaeq praecipuueeaq praecipuueeqa
praecipueequa praecipueeqau praecipueeuqa praecipueeuaq praecipueeauq praecipueeaqu praecipueqeua praecipueqeau praecipuequea
praecipuequae praecipueqaue praecipueqaeu praecipueuqea praecipueuqae praecipueueqa praecipueueaq praecipueuaeq praecipueuaqe
praecipueaque praecipueaqeu praecipueauqe praecipueaueq praecipueaeuq praecipueaequ praecipeaequu praecipeaequu praecipeaeuqu
praecipeaeuuq praecipeaeuuq praecipeaeuqu praecipeaqeuu praecipeaqeuu praecipeaqueu praecipeaquue praecipeaquue praecipeaqueu
praecipeauqeu praecipeauque praecipeauequ praecipeaueuq praecipeauueq praecipeauuqe praecipeauque praecipeauqeu praecipeauuqe
praecipeauueq praecipeaueuq praecipeauequ praecipeeaquu praecipeeaquu praecipeeauqu praecipeeauuq praecipeeauuq praecipeeauqu
praecipeeqauu praecipeeqauu praecipeequau praecipeequua praecipeequua praecipeequau praecipeeuqau praecipeeuqua praecipeeuaqu
praecipeeuauq praecipeeuuaq praecipeeuuqa praecipeeuqua praecipeeuqau praecipeeuuqa praecipeeuuaq praecipeeuauq praecipeeuaqu
praecipeqeauu praecipeqeauu praecipeqeuau praecipeqeuua praecipeqeuua praecipeqeuau praecipeqaeuu praecipeqaeuu praecipeqaueu
praecipeqauue praecipeqauue praecipeqaueu praecipequaeu praecipequaue praecipequeau praecipequeua praecipequuea praecipequuae
praecipequaue praecipequaeu praecipequuae praecipequuea praecipequeua praecipequeau praecipeueqau praecipeuequa praecipeueaqu
praecipeueauq praecipeueuaq praecipeueuqa praecipeuqeau praecipeuqeua praecipeuqaeu praecipeuqaue praecipeuquae praecipeuquea
praecipeuaqeu praecipeuaque praecipeuaequ praecipeuaeuq praecipeuaueq praecipeuauqe praecipeuuqae praecipeuuqea praecipeuuaqe
praecipeuuaeq praecipeuueaq praecipeuueqa praecipeuequa praecipeueqau praecipeueuqa praecipeueuaq praecipeueauq praecipeueaqu
praecipeuqeua praecipeuqeau praecipeuquea praecipeuquae praecipeuqaue praecipeuqaeu praecipeuuqea praecipeuuqae praecipeuueqa
praecipeuueaq praecipeuuaeq praecipeuuaqe praecipeuaque praecipeuaqeu praecipeuauqe praecipeuaueq praecipeuaeuq praecipeuaequ
praeciupaeque praeciupaeqeu praeciupaeuqe praeciupaeueq praeciupaeeuq praeciupaeequ praeciupaqeue praeciupaqeeu praeciupaquee
praeciupaquee praeciupaqeue praeciupaqeeu praeciupauqee praeciupauqee praeciupaueqe praeciupaueeq praeciupaueeq praeciupaueqe
praeciupaeque praeciupaeqeu praeciupaeuqe praeciupaeueq praeciupaeeuq praeciupaeequ praeciupeaque praeciupeaqeu praeciupeauqe
praeciupeaueq praeciupeaeuq praeciupeaequ praeciupeqaue praeciupeqaeu praeciupequae praeciupequea praeciupeqeua praeciupeqeau
praeciupeuqae praeciupeuqea praeciupeuaqe praeciupeuaeq praeciupeueaq praeciupeueqa praeciupeequa praeciupeeqau praeciupeeuqa
praeciupeeuaq praeciupeeauq praeciupeeaqu praeciupqeaue praeciupqeaeu praeciupqeuae praeciupqeuea praeciupqeeua praeciupqeeau
praeciupqaeue praeciupqaeeu praeciupqauee praeciupqauee praeciupqaeue praeciupqaeeu praeciupquaee praeciupquaee praeciupqueae
praeciupqueea praeciupqueea praeciupqueae praeciupqeaue praeciupqeaeu praeciupqeuae praeciupqeuea praeciupqeeua praeciupqeeau
praeciupueqae praeciupueqea praeciupueaqe praeciupueaeq praeciupueeaq praeciupueeqa praeciupuqeae praeciupuqeea praeciupuqaee
praeciupuqaee praeciupuqeae praeciupuqeea praeciupuaqee praeciupuaqee praeciupuaeqe praeciupuaeeq praeciupuaeeq praeciupuaeqe
praeciupueqae praeciupueqea praeciupueaqe praeciupueaeq praeciupueeaq praeciupueeqa praeciupeequa praeciupeeqau praeciupeeuqa
praeciupeeuaq praeciupeeauq praeciupeeaqu praeciupeqeua praeciupeqeau praeciupequea praeciupequae praeciupeqaue praeciupeqaeu
praeciupeuqea praeciupeuqae praeciupeueqa praeciupeueaq praeciupeuaeq praeciupeuaqe praeciupeaque praeciupeaqeu praeciupeauqe
praeciupeaueq praeciupeaeuq praeciupeaequ praeciuapeque praeciuapeqeu praeciuapeuqe praeciuapeueq praeciuapeeuq praeciuapeequ
praeciuapqeue praeciuapqeeu praeciuapquee praeciuapquee praeciuapqeue praeciuapqeeu praeciuapuqee praeciuapuqee praeciuapueqe
praeciuapueeq praeciuapueeq praeciuapueqe praeciuapeque praeciuapeqeu praeciuapeuqe praeciuapeueq praeciuapeeuq praeciuapeequ
praeciuaepque praeciuaepqeu praeciuaepuqe praeciuaepueq praeciuaepeuq praeciuaepequ praeciuaeqpue praeciuaeqpeu praeciuaequpe
praeciuaequep praeciuaeqeup praeciuaeqepu praeciuaeuqpe praeciuaeuqep praeciuaeupqe praeciuaeupeq praeciuaeuepq praeciuaeueqp
praeciuaeequp praeciuaeeqpu praeciuaeeuqp praeciuaeeupq praeciuaeepuq praeciuaeepqu praeciuaqepue praeciuaqepeu praeciuaqeupe
praeciuaqeuep praeciuaqeeup praeciuaqeepu praeciuaqpeue praeciuaqpeeu praeciuaqpuee praeciuaqpuee praeciuaqpeue praeciuaqpeeu
praeciuaqupee praeciuaqupee praeciuaquepe praeciuaqueep praeciuaqueep praeciuaquepe praeciuaqepue praeciuaqepeu praeciuaqeupe
praeciuaqeuep praeciuaqeeup praeciuaqeepu praeciuaueqpe praeciuaueqep praeciuauepqe praeciuauepeq praeciuaueepq praeciuaueeqp
praeciuauqepe praeciuauqeep praeciuauqpee praeciuauqpee praeciuauqepe praeciuauqeep praeciuaupqee praeciuaupqee praeciuaupeqe
praeciuaupeeq praeciuaupeeq praeciuaupeqe praeciuaueqpe praeciuaueqep praeciuauepqe praeciuauepeq praeciuaueepq praeciuaueeqp
praeciuaeequp praeciuaeeqpu praeciuaeeuqp praeciuaeeupq praeciuaeepuq praeciuaeepqu praeciuaeqeup praeciuaeqepu praeciuaequep
praeciuaequpe praeciuaeqpue praeciuaeqpeu praeciuaeuqep praeciuaeuqpe praeciuaeueqp praeciuaeuepq praeciuaeupeq praeciuaeupqe
praeciuaepque praeciuaepqeu praeciuaepuqe praeciuaepueq praeciuaepeuq praeciuaepequ praeciueapque praeciueapqeu praeciueapuqe
praeciueapueq praeciueapeuq praeciueapequ praeciueaqpue praeciueaqpeu praeciueaqupe praeciueaquep praeciueaqeup praeciueaqepu
praeciueauqpe praeciueauqep praeciueaupqe praeciueaupeq praeciueauepq praeciueaueqp praeciueaequp praeciueaeqpu praeciueaeuqp
praeciueaeupq praeciueaepuq praeciueaepqu praeciuepaque praeciuepaqeu praeciuepauqe praeciuepaueq praeciuepaeuq praeciuepaequ
praeciuepqaue praeciuepqaeu praeciuepquae praeciuepquea praeciuepqeua praeciuepqeau praeciuepuqae praeciuepuqea praeciuepuaqe
praeciuepuaeq praeciuepueaq praeciuepueqa praeciuepequa praeciuepeqau praeciuepeuqa praeciuepeuaq praeciuepeauq praeciuepeaqu
praeciueqpaue praeciueqpaeu praeciueqpuae praeciueqpuea praeciueqpeua praeciueqpeau praeciueqapue praeciueqapeu praeciueqaupe
praeciueqauep praeciueqaeup praeciueqaepu praeciuequape praeciuequaep praeciuequpae praeciuequpea praeciuequepa praeciuequeap
praeciueqeaup praeciueqeapu praeciueqeuap praeciueqeupa praeciueqepua praeciueqepau praeciueupqae praeciueupqea praeciueupaqe
praeciueupaeq praeciueupeaq praeciueupeqa praeciueuqpae praeciueuqpea praeciueuqape praeciueuqaep praeciueuqeap praeciueuqepa
praeciueuaqpe praeciueuaqep praeciueuapqe praeciueuapeq praeciueuaepq praeciueuaeqp praeciueueqap praeciueueqpa praeciueueaqp
praeciueueapq praeciueuepaq praeciueuepqa praeciueepqua praeciueepqau praeciueepuqa praeciueepuaq praeciueepauq praeciueepaqu
praeciueeqpua praeciueeqpau praeciueequpa praeciueequap praeciueeqaup praeciueeqapu praeciueeuqpa praeciueeuqap praeciueeupqa
praeciueeupaq praeciueeuapq praeciueeuaqp praeciueeaqup praeciueeaqpu praeciueeauqp praeciueeaupq praeciueeapuq praeciueeapqu
praeciuqaepue praeciuqaepeu praeciuqaeupe praeciuqaeuep praeciuqaeeup praeciuqaeepu praeciuqapeue praeciuqapeeu praeciuqapuee
praeciuqapuee praeciuqapeue praeciuqapeeu praeciuqaupee praeciuqaupee praeciuqauepe praeciuqaueep praeciuqaueep praeciuqauepe
praeciuqaepue praeciuqaepeu praeciuqaeupe praeciuqaeuep praeciuqaeeup praeciuqaeepu praeciuqeapue praeciuqeapeu praeciuqeaupe
praeciuqeauep praeciuqeaeup praeciuqeaepu praeciuqepaue praeciuqepaeu praeciuqepuae praeciuqepuea praeciuqepeua praeciuqepeau
praeciuqeupae praeciuqeupea praeciuqeuape praeciuqeuaep praeciuqeueap praeciuqeuepa praeciuqeepua praeciuqeepau praeciuqeeupa
praeciuqeeuap praeciuqeeaup praeciuqeeapu praeciuqpeaue praeciuqpeaeu praeciuqpeuae praeciuqpeuea praeciuqpeeua praeciuqpeeau
praeciuqpaeue praeciuqpaeeu praeciuqpauee praeciuqpauee praeciuqpaeue praeciuqpaeeu praeciuqpuaee praeciuqpuaee praeciuqpueae
praeciuqpueea praeciuqpueea praeciuqpueae praeciuqpeaue praeciuqpeaeu praeciuqpeuae praeciuqpeuea praeciuqpeeua praeciuqpeeau
praeciuquepae praeciuquepea praeciuqueape praeciuqueaep praeciuqueeap praeciuqueepa praeciuqupeae praeciuqupeea praeciuqupaee
praeciuqupaee praeciuqupeae praeciuqupeea praeciuquapee praeciuquapee praeciuquaepe praeciuquaeep praeciuquaeep praeciuquaepe
praeciuquepae praeciuquepea praeciuqueape praeciuqueaep praeciuqueeap praeciuqueepa praeciuqeepua praeciuqeepau praeciuqeeupa
praeciuqeeuap praeciuqeeaup praeciuqeeapu praeciuqepeua praeciuqepeau praeciuqepuea praeciuqepuae praeciuqepaue praeciuqepaeu
praeciuqeupea praeciuqeupae praeciuqeuepa praeciuqeueap praeciuqeuaep praeciuqeuape praeciuqeapue praeciuqeapeu praeciuqeaupe
praeciuqeauep praeciuqeaeup praeciuqeaepu praeciuuaeqpe praeciuuaeqep praeciuuaepqe praeciuuaepeq praeciuuaeepq praeciuuaeeqp
praeciuuaqepe praeciuuaqeep praeciuuaqpee praeciuuaqpee praeciuuaqepe praeciuuaqeep praeciuuapqee praeciuuapqee praeciuuapeqe
praeciuuapeeq praeciuuapeeq praeciuuapeqe praeciuuaeqpe praeciuuaeqep praeciuuaepqe praeciuuaepeq praeciuuaeepq praeciuuaeeqp
praeciuueaqpe praeciuueaqep praeciuueapqe praeciuueapeq praeciuueaepq praeciuueaeqp praeciuueqape praeciuueqaep praeciuueqpae
praeciuueqpea praeciuueqepa praeciuueqeap praeciuuepqae praeciuuepqea praeciuuepaqe praeciuuepaeq praeciuuepeaq praeciuuepeqa
praeciuueeqpa praeciuueeqap praeciuueepqa praeciuueepaq praeciuueeapq praeciuueeaqp praeciuuqeape praeciuuqeaep praeciuuqepae
praeciuuqepea praeciuuqeepa praeciuuqeeap praeciuuqaepe praeciuuqaeep praeciuuqapee praeciuuqapee praeciuuqaepe praeciuuqaeep
praeciuuqpaee praeciuuqpaee praeciuuqpeae praeciuuqpeea praeciuuqpeea praeciuuqpeae praeciuuqeape praeciuuqeaep praeciuuqepae
praeciuuqepea praeciuuqeepa praeciuuqeeap praeciuupeqae praeciuupeqea praeciuupeaqe praeciuupeaeq praeciuupeeaq praeciuupeeqa
praeciuupqeae praeciuupqeea praeciuupqaee praeciuupqaee praeciuupqeae praeciuupqeea praeciuupaqee praeciuupaqee praeciuupaeqe
praeciuupaeeq praeciuupaeeq praeciuupaeqe praeciuupeqae praeciuupeqea praeciuupeaqe praeciuupeaeq praeciuupeeaq praeciuupeeqa
praeciuueeqpa praeciuueeqap praeciuueepqa praeciuueepaq praeciuueeapq praeciuueeaqp praeciuueqepa praeciuueqeap praeciuueqpea
praeciuueqpae praeciuueqape praeciuueqaep praeciuuepqea praeciuuepqae praeciuuepeqa praeciuuepeaq praeciuuepaeq praeciuuepaqe
praeciuueaqpe praeciuueaqep praeciuueapqe praeciuueapeq praeciuueaepq praeciuueaeqp praeciueaequp praeciueaeqpu praeciueaeuqp
praeciueaeupq praeciueaepuq praeciueaepqu praeciueaqeup praeciueaqepu praeciueaquep praeciueaqupe praeciueaqpue praeciueaqpeu
praeciueauqep praeciueauqpe praeciueaueqp praeciueauepq praeciueaupeq praeciueaupqe praeciueapque praeciueapqeu praeciueapuqe
praeciueapueq praeciueapeuq praeciueapequ praeciueeaqup praeciueeaqpu praeciueeauqp praeciueeaupq praeciueeapuq praeciueeapqu
praeciueeqaup praeciueeqapu praeciueequap praeciueequpa praeciueeqpua praeciueeqpau praeciueeuqap praeciueeuqpa praeciueeuaqp
praeciueeuapq praeciueeupaq praeciueeupqa praeciueepqua praeciueepqau praeciueepuqa praeciueepuaq praeciueepauq praeciueepaqu
praeciueqeaup praeciueqeapu praeciueqeuap praeciueqeupa praeciueqepua praeciueqepau praeciueqaeup praeciueqaepu praeciueqauep
praeciueqaupe praeciueqapue praeciueqapeu praeciuequaep praeciuequape praeciuequeap praeciuequepa praeciuequpea praeciuequpae
praeciueqpaue praeciueqpaeu praeciueqpuae praeciueqpuea praeciueqpeua praeciueqpeau praeciueueqap praeciueueqpa praeciueueaqp
praeciueueapq praeciueuepaq praeciueuepqa praeciueuqeap praeciueuqepa praeciueuqaep praeciueuqape praeciueuqpae praeciueuqpea
praeciueuaqep praeciueuaqpe praeciueuaeqp praeciueuaepq praeciueuapeq praeciueuapqe praeciueupqae praeciueupqea praeciueupaqe
praeciueupaeq praeciueupeaq praeciueupeqa praeciuepequa praeciuepeqau praeciuepeuqa praeciuepeuaq praeciuepeauq praeciuepeaqu
praeciuepqeua praeciuepqeau praeciuepquea praeciuepquae praeciuepqaue praeciuepqaeu praeciuepuqea praeciuepuqae praeciuepueqa
praeciuepueaq praeciuepuaeq praeciuepuaqe praeciuepaque praeciuepaqeu praeciuepauqe praeciuepaueq praeciuepaeuq praeciuepaequ
praeciaupeque praeciaupeqeu praeciaupeuqe praeciaupeueq praeciaupeeuq praeciaupeequ praeciaupqeue praeciaupqeeu praeciaupquee
praeciaupquee praeciaupqeue praeciaupqeeu praeciaupuqee praeciaupuqee praeciaupueqe praeciaupueeq praeciaupueeq praeciaupueqe
praeciaupeque praeciaupeqeu praeciaupeuqe praeciaupeueq praeciaupeeuq praeciaupeequ praeciauepque praeciauepqeu praeciauepuqe
praeciauepueq praeciauepeuq praeciauepequ praeciaueqpue praeciaueqpeu praeciauequpe praeciauequep praeciaueqeup praeciaueqepu
praeciaueuqpe praeciaueuqep praeciaueupqe praeciaueupeq praeciaueuepq praeciaueueqp praeciaueequp praeciaueeqpu praeciaueeuqp
praeciaueeupq praeciaueepuq praeciaueepqu praeciauqepue praeciauqepeu praeciauqeupe praeciauqeuep praeciauqeeup praeciauqeepu
praeciauqpeue praeciauqpeeu praeciauqpuee praeciauqpuee praeciauqpeue praeciauqpeeu praeciauqupee praeciauqupee praeciauquepe
praeciauqueep praeciauqueep praeciauquepe praeciauqepue praeciauqepeu praeciauqeupe praeciauqeuep praeciauqeeup praeciauqeepu
praeciauueqpe praeciauueqep praeciauuepqe praeciauuepeq praeciauueepq praeciauueeqp praeciauuqepe praeciauuqeep praeciauuqpee
praeciauuqpee praeciauuqepe praeciauuqeep praeciauupqee praeciauupqee praeciauupeqe praeciauupeeq praeciauupeeq praeciauupeqe
praeciauueqpe praeciauueqep praeciauuepqe praeciauuepeq praeciauueepq praeciauueeqp praeciaueequp praeciaueeqpu praeciaueeuqp
praeciaueeupq praeciaueepuq praeciaueepqu praeciaueqeup praeciaueqepu praeciauequep praeciauequpe praeciaueqpue praeciaueqpeu
praeciaueuqep praeciaueuqpe praeciaueueqp praeciaueuepq praeciaueupeq praeciaueupqe praeciauepque praeciauepqeu praeciauepuqe
praeciauepueq praeciauepeuq praeciauepequ praeciapueque praeciapueqeu praeciapueuqe praeciapueueq praeciapueeuq praeciapueequ
praeciapuqeue praeciapuqeeu praeciapuquee praeciapuquee praeciapuqeue praeciapuqeeu praeciapuuqee praeciapuuqee praeciapuueqe
praeciapuueeq praeciapuueeq praeciapuueqe praeciapueque praeciapueqeu praeciapueuqe praeciapueueq praeciapueeuq praeciapueequ
praeciapeuque praeciapeuqeu praeciapeuuqe praeciapeuueq praeciapeueuq praeciapeuequ praeciapequue praeciapequeu praeciapequue
praeciapequeu praeciapeqeuu praeciapeqeuu praeciapeuque praeciapeuqeu praeciapeuuqe praeciapeuueq praeciapeueuq praeciapeuequ
praeciapeequu praeciapeequu praeciapeeuqu praeciapeeuuq praeciapeeuuq praeciapeeuqu praeciapqeuue praeciapqeueu praeciapqeuue
praeciapqeueu praeciapqeeuu praeciapqeeuu praeciapqueue praeciapqueeu praeciapquuee praeciapquuee praeciapqueue praeciapqueeu
praeciapquuee praeciapquuee praeciapqueue praeciapqueeu praeciapqueeu praeciapqueue praeciapqeuue praeciapqeueu praeciapqeuue
praeciapqeueu praeciapqeeuu praeciapqeeuu praeciapueque praeciapueqeu praeciapueuqe praeciapueueq praeciapueeuq praeciapueequ
praeciapuqeue praeciapuqeeu praeciapuquee praeciapuquee praeciapuqeue praeciapuqeeu praeciapuuqee praeciapuuqee praeciapuueqe
praeciapuueeq praeciapuueeq praeciapuueqe praeciapueque praeciapueqeu praeciapueuqe praeciapueueq praeciapueeuq praeciapueequ
praeciapeequu praeciapeequu praeciapeeuqu praeciapeeuuq praeciapeeuuq praeciapeeuqu praeciapeqeuu praeciapeqeuu praeciapequeu
praeciapequue praeciapequue praeciapequeu praeciapeuqeu praeciapeuque praeciapeuequ praeciapeueuq praeciapeuueq praeciapeuuqe
praeciapeuque praeciapeuqeu praeciapeuuqe praeciapeuueq praeciapeueuq praeciapeuequ praeciaepuque praeciaepuqeu praeciaepuuqe
praeciaepuueq praeciaepueuq praeciaepuequ praeciaepquue praeciaepqueu praeciaepquue praeciaepqueu praeciaepqeuu praeciaepqeuu
praeciaepuque praeciaepuqeu praeciaepuuqe praeciaepuueq praeciaepueuq praeciaepuequ praeciaepequu praeciaepequu praeciaepeuqu
praeciaepeuuq praeciaepeuuq praeciaepeuqu praeciaeupque praeciaeupqeu praeciaeupuqe praeciaeupueq praeciaeupeuq praeciaeupequ
praeciaeuqpue praeciaeuqpeu praeciaeuqupe praeciaeuquep praeciaeuqeup praeciaeuqepu praeciaeuuqpe praeciaeuuqep praeciaeuupqe
praeciaeuupeq praeciaeuuepq praeciaeuueqp praeciaeuequp praeciaeueqpu praeciaeueuqp praeciaeueupq praeciaeuepuq praeciaeuepqu
praeciaequpue praeciaequpeu praeciaequupe praeciaequuep praeciaequeup praeciaequepu praeciaeqpuue praeciaeqpueu praeciaeqpuue
praeciaeqpueu praeciaeqpeuu praeciaeqpeuu praeciaequpue praeciaequpeu praeciaequupe praeciaequuep praeciaequeup praeciaequepu
praeciaeqepuu praeciaeqepuu praeciaeqeupu praeciaeqeuup praeciaeqeuup praeciaeqeupu praeciaeuuqpe praeciaeuuqep praeciaeuupqe
praeciaeuupeq praeciaeuuepq praeciaeuueqp praeciaeuqupe praeciaeuquep praeciaeuqpue praeciaeuqpeu praeciaeuqepu praeciaeuqeup
praeciaeupque praeciaeupqeu praeciaeupuqe praeciaeupueq praeciaeupeuq praeciaeupequ praeciaeueqpu praeciaeuequp praeciaeuepqu
praeciaeuepuq praeciaeueupq praeciaeueuqp praeciaeeuqup praeciaeeuqpu praeciaeeuuqp praeciaeeuupq praeciaeeupuq praeciaeeupqu
praeciaeequup praeciaeequpu praeciaeequup praeciaeequpu praeciaeeqpuu praeciaeeqpuu praeciaeeuqup praeciaeeuqpu praeciaeeuuqp
praeciaeeuupq praeciaeeupuq praeciaeeupqu praeciaeepquu praeciaeepquu praeciaeepuqu praeciaeepuuq praeciaeepuuq praeciaeepuqu
praeciaqpeuue praeciaqpeueu praeciaqpeuue praeciaqpeueu praeciaqpeeuu praeciaqpeeuu praeciaqpueue praeciaqpueeu praeciaqpuuee
praeciaqpuuee praeciaqpueue praeciaqpueeu praeciaqpuuee praeciaqpuuee praeciaqpueue praeciaqpueeu praeciaqpueeu praeciaqpueue
praeciaqpeuue praeciaqpeueu praeciaqpeuue praeciaqpeueu praeciaqpeeuu praeciaqpeeuu praeciaqepuue praeciaqepueu praeciaqepuue
praeciaqepueu praeciaqepeuu praeciaqepeuu praeciaqeupue praeciaqeupeu praeciaqeuupe praeciaqeuuep praeciaqeueup praeciaqeuepu
praeciaqeuupe praeciaqeuuep praeciaqeupue praeciaqeupeu praeciaqeuepu praeciaqeueup praeciaqeeuup praeciaqeeupu praeciaqeeuup
praeciaqeeupu praeciaqeepuu praeciaqeepuu praeciaquepue praeciaquepeu praeciaqueupe praeciaqueuep praeciaqueeup praeciaqueepu
praeciaqupeue praeciaqupeeu praeciaqupuee praeciaqupuee praeciaqupeue praeciaqupeeu praeciaquupee praeciaquupee praeciaquuepe
praeciaquueep praeciaquueep praeciaquuepe praeciaquepue praeciaquepeu praeciaqueupe praeciaqueuep praeciaqueeup praeciaqueepu
praeciaqueupe praeciaqueuep praeciaquepue praeciaquepeu praeciaqueepu praeciaqueeup praeciaquuepe praeciaquueep praeciaquupee
praeciaquupee praeciaquuepe praeciaquueep praeciaqupuee praeciaqupuee praeciaqupeue praeciaqupeeu praeciaqupeeu praeciaqupeue
praeciaqueupe praeciaqueuep praeciaquepue praeciaquepeu praeciaqueepu praeciaqueeup praeciaqeeuup praeciaqeeupu praeciaqeeuup
praeciaqeeupu praeciaqeepuu praeciaqeepuu praeciaqeueup praeciaqeuepu praeciaqeuuep praeciaqeuupe praeciaqeupue praeciaqeupeu
praeciaqeuuep praeciaqeuupe praeciaqeueup praeciaqeuepu praeciaqeupeu praeciaqeupue praeciaqepuue praeciaqepueu praeciaqepuue
praeciaqepueu praeciaqepeuu praeciaqepeuu praeciaupeque praeciaupeqeu praeciaupeuqe praeciaupeueq praeciaupeeuq praeciaupeequ
praeciaupqeue praeciaupqeeu praeciaupquee praeciaupquee praeciaupqeue praeciaupqeeu praeciaupuqee praeciaupuqee praeciaupueqe
praeciaupueeq praeciaupueeq praeciaupueqe praeciaupeque praeciaupeqeu praeciaupeuqe praeciaupeueq praeciaupeeuq praeciaupeequ
praeciauepque praeciauepqeu praeciauepuqe praeciauepueq praeciauepeuq praeciauepequ praeciaueqpue praeciaueqpeu praeciauequpe
praeciauequep praeciaueqeup praeciaueqepu praeciaueuqpe praeciaueuqep praeciaueupqe praeciaueupeq praeciaueuepq praeciaueueqp
praeciaueequp praeciaueeqpu praeciaueeuqp praeciaueeupq praeciaueepuq praeciaueepqu praeciauqepue praeciauqepeu praeciauqeupe
praeciauqeuep praeciauqeeup praeciauqeepu praeciauqpeue praeciauqpeeu praeciauqpuee praeciauqpuee praeciauqpeue praeciauqpeeu
praeciauqupee praeciauqupee praeciauquepe praeciauqueep praeciauqueep praeciauquepe praeciauqepue praeciauqepeu praeciauqeupe
praeciauqeuep praeciauqeeup praeciauqeepu praeciauueqpe praeciauueqep praeciauuepqe praeciauuepeq praeciauueepq praeciauueeqp
praeciauuqepe praeciauuqeep praeciauuqpee praeciauuqpee praeciauuqepe praeciauuqeep praeciauupqee praeciauupqee praeciauupeqe
praeciauupeeq praeciauupeeq praeciauupeqe praeciauueqpe praeciauueqep praeciauuepqe praeciauuepeq praeciauueepq praeciauueeqp
praeciaueequp praeciaueeqpu praeciaueeuqp praeciaueeupq praeciaueepuq praeciaueepqu praeciaueqeup praeciaueqepu praeciauequep
praeciauequpe praeciaueqpue praeciaueqpeu praeciaueuqep praeciaueuqpe praeciaueueqp praeciaueuepq praeciaueupeq praeciaueupqe
praeciauepque praeciauepqeu praeciauepuqe praeciauepueq praeciauepeuq praeciauepequ praeciaepequu praeciaepequu praeciaepeuqu
praeciaepeuuq praeciaepeuuq praeciaepeuqu praeciaepqeuu praeciaepqeuu praeciaepqueu praeciaepquue praeciaepquue praeciaepqueu
praeciaepuqeu praeciaepuque praeciaepuequ praeciaepueuq praeciaepuueq praeciaepuuqe praeciaepuque praeciaepuqeu praeciaepuuqe
praeciaepuueq praeciaepueuq praeciaepuequ praeciaeepquu praeciaeepquu praeciaeepuqu praeciaeepuuq praeciaeepuuq praeciaeepuqu
praeciaeeqpuu praeciaeeqpuu praeciaeequpu praeciaeequup praeciaeequup praeciaeequpu praeciaeeuqpu praeciaeeuqup praeciaeeupqu
praeciaeeupuq praeciaeeuupq praeciaeeuuqp praeciaeeuqup praeciaeeuqpu praeciaeeuuqp praeciaeeuupq praeciaeeupuq praeciaeeupqu
praeciaeqepuu praeciaeqepuu praeciaeqeupu praeciaeqeuup praeciaeqeuup praeciaeqeupu praeciaeqpeuu praeciaeqpeuu praeciaeqpueu
praeciaeqpuue praeciaeqpuue praeciaeqpueu praeciaequpeu praeciaequpue praeciaequepu praeciaequeup praeciaequuep praeciaequupe
praeciaequpue praeciaequpeu praeciaequupe praeciaequuep praeciaequeup praeciaequepu praeciaeueqpu praeciaeuequp praeciaeuepqu
praeciaeuepuq praeciaeueupq praeciaeueuqp praeciaeuqepu praeciaeuqeup praeciaeuqpeu praeciaeuqpue praeciaeuqupe praeciaeuquep
praeciaeupqeu praeciaeupque praeciaeupequ praeciaeupeuq praeciaeupueq praeciaeupuqe praeciaeuuqpe praeciaeuuqep praeciaeuupqe
praeciaeuupeq praeciaeuuepq praeciaeuueqp praeciaeuequp praeciaeueqpu praeciaeueuqp praeciaeueupq praeciaeuepuq praeciaeuepqu
praeciaeuqeup praeciaeuqepu praeciaeuquep praeciaeuqupe praeciaeuqpue praeciaeuqpeu praeciaeuuqep praeciaeuuqpe praeciaeuueqp
praeciaeuuepq praeciaeuupeq praeciaeuupqe praeciaeupque praeciaeupqeu praeciaeupuqe praeciaeupueq praeciaeupeuq praeciaeupequ
praecieuapque praecieuapqeu praecieuapuqe praecieuapueq praecieuapeuq praecieuapequ praecieuaqpue praecieuaqpeu praecieuaqupe
praecieuaquep praecieuaqeup praecieuaqepu praecieuauqpe praecieuauqep praecieuaupqe praecieuaupeq praecieuauepq praecieuaueqp
praecieuaequp praecieuaeqpu praecieuaeuqp praecieuaeupq praecieuaepuq praecieuaepqu praecieupaque praecieupaqeu praecieupauqe
praecieupaueq praecieupaeuq praecieupaequ praecieupqaue praecieupqaeu praecieupquae praecieupquea praecieupqeua praecieupqeau
praecieupuqae praecieupuqea praecieupuaqe praecieupuaeq praecieupueaq praecieupueqa praecieupequa praecieupeqau praecieupeuqa
praecieupeuaq praecieupeauq praecieupeaqu praecieuqpaue praecieuqpaeu praecieuqpuae praecieuqpuea praecieuqpeua praecieuqpeau
praecieuqapue praecieuqapeu praecieuqaupe praecieuqauep praecieuqaeup praecieuqaepu praecieuquape praecieuquaep praecieuqupae
praecieuqupea praecieuquepa praecieuqueap praecieuqeaup praecieuqeapu praecieuqeuap praecieuqeupa praecieuqepua praecieuqepau
praecieuupqae praecieuupqea praecieuupaqe praecieuupaeq praecieuupeaq praecieuupeqa praecieuuqpae praecieuuqpea praecieuuqape
praecieuuqaep praecieuuqeap praecieuuqepa praecieuuaqpe praecieuuaqep praecieuuapqe praecieuuapeq praecieuuaepq praecieuuaeqp
praecieuueqap praecieuueqpa praecieuueaqp praecieuueapq praecieuuepaq praecieuuepqa praecieuepqua praecieuepqau praecieuepuqa
praecieuepuaq praecieuepauq praecieuepaqu praecieueqpua praecieueqpau praecieuequpa praecieuequap praecieueqaup praecieueqapu
praecieueuqpa praecieueuqap praecieueupqa praecieueupaq praecieueuapq praecieueuaqp praecieueaqup praecieueaqpu praecieueauqp
praecieueaupq praecieueapuq praecieueapqu praecieaupque praecieaupqeu praecieaupuqe praecieaupueq praecieaupeuq praecieaupequ
praecieauqpue praecieauqpeu praecieauqupe praecieauquep praecieauqeup praecieauqepu praecieauuqpe praecieauuqep praecieauupqe
praecieauupeq praecieauuepq praecieauueqp praecieauequp praecieaueqpu praecieaueuqp praecieaueupq praecieauepuq praecieauepqu
praecieapuque praecieapuqeu praecieapuuqe praecieapuueq praecieapueuq praecieapuequ praecieapquue praecieapqueu praecieapquue
praecieapqueu praecieapqeuu praecieapqeuu praecieapuque praecieapuqeu praecieapuuqe praecieapuueq praecieapueuq praecieapuequ
praecieapequu praecieapequu praecieapeuqu praecieapeuuq praecieapeuuq praecieapeuqu praecieaqpuue praecieaqpueu praecieaqpuue
praecieaqpueu praecieaqpeuu praecieaqpeuu praecieaqupue praecieaqupeu praecieaquupe praecieaquuep praecieaqueup praecieaquepu
praecieaquupe praecieaquuep praecieaqupue praecieaqupeu praecieaquepu praecieaqueup praecieaqeuup praecieaqeupu praecieaqeuup
praecieaqeupu praecieaqepuu praecieaqepuu praecieaupque praecieaupqeu praecieaupuqe praecieaupueq praecieaupeuq praecieaupequ
praecieauqpue praecieauqpeu praecieauqupe praecieauquep praecieauqeup praecieauqepu praecieauuqpe praecieauuqep praecieauupqe
praecieauupeq praecieauuepq praecieauueqp praecieauequp praecieaueqpu praecieaueuqp praecieaueupq praecieauepuq praecieauepqu
praecieaepquu praecieaepquu praecieaepuqu praecieaepuuq praecieaepuuq praecieaepuqu praecieaeqpuu praecieaeqpuu praecieaequpu
praecieaequup praecieaequup praecieaequpu praecieaeuqpu praecieaeuqup praecieaeupqu praecieaeupuq praecieaeuupq praecieaeuuqp
praecieaeuqup praecieaeuqpu praecieaeuuqp praecieaeuupq praecieaeupuq praecieaeupqu praeciepauque praeciepauqeu praeciepauuqe
praeciepauueq praeciepaueuq praeciepauequ praeciepaquue praeciepaqueu praeciepaquue praeciepaqueu praeciepaqeuu praeciepaqeuu
praeciepauque praeciepauqeu praeciepauuqe praeciepauueq praeciepaueuq praeciepauequ praeciepaequu praeciepaequu praeciepaeuqu
praeciepaeuuq praeciepaeuuq praeciepaeuqu praeciepuaque praeciepuaqeu praeciepuauqe praeciepuaueq praeciepuaeuq praeciepuaequ
praeciepuqaue praeciepuqaeu praeciepuquae praeciepuquea praeciepuqeua praeciepuqeau praeciepuuqae praeciepuuqea praeciepuuaqe
praeciepuuaeq praeciepuueaq praeciepuueqa praeciepuequa praeciepueqau praeciepueuqa praeciepueuaq praeciepueauq praeciepueaqu
praeciepquaue praeciepquaeu praeciepquuae praeciepquuea praeciepqueua praeciepqueau praeciepqauue praeciepqaueu praeciepqauue
praeciepqaueu praeciepqaeuu praeciepqaeuu praeciepquaue praeciepquaeu praeciepquuae praeciepquuea praeciepqueua praeciepqueau
praeciepqeauu praeciepqeauu praeciepqeuau praeciepqeuua praeciepqeuua praeciepqeuau praeciepuuqae praeciepuuqea praeciepuuaqe
praeciepuuaeq praeciepuueaq praeciepuueqa praeciepuquae praeciepuquea praeciepuqaue praeciepuqaeu praeciepuqeau praeciepuqeua
praeciepuaque praeciepuaqeu praeciepuauqe praeciepuaueq praeciepuaeuq praeciepuaequ praeciepueqau praeciepuequa praeciepueaqu
praeciepueauq praeciepueuaq praeciepueuqa praeciepeuqua praeciepeuqau praeciepeuuqa praeciepeuuaq praeciepeuauq praeciepeuaqu
praeciepequua praeciepequau praeciepequua praeciepequau praeciepeqauu praeciepeqauu praeciepeuqua praeciepeuqau praeciepeuuqa
praeciepeuuaq praeciepeuauq praeciepeuaqu praeciepeaquu praeciepeaquu praeciepeauqu praeciepeauuq praeciepeauuq praeciepeauqu
praecieqapuue praecieqapueu praecieqapuue praecieqapueu praecieqapeuu praecieqapeuu praecieqaupue praecieqaupeu praecieqauupe
praecieqauuep praecieqaueup praecieqauepu praecieqauupe praecieqauuep praecieqaupue praecieqaupeu praecieqauepu praecieqaueup
praecieqaeuup praecieqaeupu praecieqaeuup praecieqaeupu praecieqaepuu praecieqaepuu praecieqpauue praecieqpaueu praecieqpauue
praecieqpaueu praecieqpaeuu praecieqpaeuu praecieqpuaue praecieqpuaeu praecieqpuuae praecieqpuuea praecieqpueua praecieqpueau
praecieqpuuae praecieqpuuea praecieqpuaue praecieqpuaeu praecieqpueau praecieqpueua praecieqpeuua praecieqpeuau praecieqpeuua
praecieqpeuau praecieqpeauu praecieqpeauu praeciequpaue praeciequpaeu praeciequpuae praeciequpuea praeciequpeua praeciequpeau
praeciequapue praeciequapeu praeciequaupe praeciequauep praeciequaeup praeciequaepu praeciequuape praeciequuaep praeciequupae
praeciequupea praeciequuepa praeciequueap praeciequeaup praeciequeapu praeciequeuap praeciequeupa praeciequepua praeciequepau
praeciequpuae praeciequpuea praeciequpaue praeciequpaeu praeciequpeau praeciequpeua praeciequupae praeciequupea praeciequuape
praeciequuaep praeciequueap praeciequuepa praeciequaupe praeciequauep praeciequapue praeciequapeu praeciequaepu praeciequaeup
praeciequeuap praeciequeupa praeciequeaup praeciequeapu praeciequepau praeciequepua praecieqepuua praecieqepuau praecieqepuua
praecieqepuau praecieqepauu praecieqepauu praecieqeupua praecieqeupau praecieqeuupa praecieqeuuap praecieqeuaup praecieqeuapu
praecieqeuupa praecieqeuuap praecieqeupua praecieqeupau praecieqeuapu praecieqeuaup praecieqeauup praecieqeaupu praecieqeauup
praecieqeaupu praecieqeapuu praecieqeapuu praecieuapque praecieuapqeu praecieuapuqe praecieuapueq praecieuapeuq praecieuapequ
praecieuaqpue praecieuaqpeu praecieuaqupe praecieuaquep praecieuaqeup praecieuaqepu praecieuauqpe praecieuauqep praecieuaupqe
praecieuaupeq praecieuauepq praecieuaueqp praecieuaequp praecieuaeqpu praecieuaeuqp praecieuaeupq praecieuaepuq praecieuaepqu
praecieupaque praecieupaqeu praecieupauqe praecieupaueq praecieupaeuq praecieupaequ praecieupqaue praecieupqaeu praecieupquae
praecieupquea praecieupqeua praecieupqeau praecieupuqae praecieupuqea praecieupuaqe praecieupuaeq praecieupueaq praecieupueqa
praecieupequa praecieupeqau praecieupeuqa praecieupeuaq praecieupeauq praecieupeaqu praecieuqpaue praecieuqpaeu praecieuqpuae
praecieuqpuea praecieuqpeua praecieuqpeau praecieuqapue praecieuqapeu praecieuqaupe praecieuqauep praecieuqaeup praecieuqaepu
praecieuquape praecieuquaep praecieuqupae praecieuqupea praecieuquepa praecieuqueap praecieuqeaup praecieuqeapu praecieuqeuap
praecieuqeupa praecieuqepua praecieuqepau praecieuupqae praecieuupqea praecieuupaqe praecieuupaeq praecieuupeaq praecieuupeqa
praecieuuqpae praecieuuqpea praecieuuqape praecieuuqaep praecieuuqeap praecieuuqepa praecieuuaqpe praecieuuaqep praecieuuapqe
praecieuuapeq praecieuuaepq praecieuuaeqp praecieuueqap praecieuueqpa praecieuueaqp praecieuueapq praecieuuepaq praecieuuepqa
praecieuepqua praecieuepqau praecieuepuqa praecieuepuaq praecieuepauq praecieuepaqu praecieueqpua praecieueqpau praecieuequpa
praecieuequap praecieueqaup praecieueqapu praecieueuqpa praecieueuqap praecieueupqa praecieueupaq praecieueuapq praecieueuaqp
praecieueaqup praecieueaqpu praecieueauqp praecieueaupq praecieueapuq praecieueapqu praecieeapquu praecieeapquu praecieeapuqu
praecieeapuuq praecieeapuuq praecieeapuqu praecieeaqpuu praecieeaqpuu praecieeaqupu praecieeaquup praecieeaquup praecieeaqupu
praecieeauqpu praecieeauqup praecieeaupqu praecieeaupuq praecieeauupq praecieeauuqp praecieeauqup praecieeauqpu praecieeauuqp
praecieeauupq praecieeaupuq praecieeaupqu praecieepaquu praecieepaquu praecieepauqu praecieepauuq praecieepauuq praecieepauqu
praecieepqauu praecieepqauu praecieepquau praecieepquua praecieepquua praecieepquau praecieepuqau praecieepuqua praecieepuaqu
praecieepuauq praecieepuuaq praecieepuuqa praecieepuqua praecieepuqau praecieepuuqa praecieepuuaq praecieepuauq praecieepuaqu
praecieeqpauu praecieeqpauu praecieeqpuau praecieeqpuua praecieeqpuua praecieeqpuau praecieeqapuu praecieeqapuu praecieeqaupu
praecieeqauup praecieeqauup praecieeqaupu praecieequapu praecieequaup praecieequpau praecieequpua praecieequupa praecieequuap
praecieequaup praecieequapu praecieequuap praecieequupa praecieequpua praecieequpau praecieeupqau praecieeupqua praecieeupaqu
praecieeupauq praecieeupuaq praecieeupuqa praecieeuqpau praecieeuqpua praecieeuqapu praecieeuqaup praecieeuquap praecieeuqupa
praecieeuaqpu praecieeuaqup praecieeuapqu praecieeuapuq praecieeuaupq praecieeuauqp praecieeuuqap praecieeuuqpa praecieeuuaqp
praecieeuuapq praecieeuupaq praecieeuupqa praecieeupqua praecieeupqau praecieeupuqa praecieeupuaq praecieeupauq praecieeupaqu
praecieeuqpua praecieeuqpau praecieeuqupa praecieeuquap praecieeuqaup praecieeuqapu praecieeuuqpa praecieeuuqap praecieeuupqa
praecieeuupaq praecieeuuapq praecieeuuaqp praecieeuaqup praecieeuaqpu praecieeuauqp praecieeuaupq praecieeuapuq praecieeuapqu
praeciquaepue praeciquaepeu praeciquaeupe praeciquaeuep praeciquaeeup praeciquaeepu praeciquapeue praeciquapeeu praeciquapuee
praeciquapuee praeciquapeue praeciquapeeu praeciquaupee praeciquaupee praeciquauepe praeciquaueep praeciquaueep praeciquauepe
praeciquaepue praeciquaepeu praeciquaeupe praeciquaeuep praeciquaeeup praeciquaeepu praeciqueapue praeciqueapeu praeciqueaupe
praeciqueauep praeciqueaeup praeciqueaepu praeciquepaue praeciquepaeu praeciquepuae praeciquepuea praeciquepeua praeciquepeau
praeciqueupae praeciqueupea praeciqueuape praeciqueuaep praeciqueueap praeciqueuepa praeciqueepua praeciqueepau praeciqueeupa
praeciqueeuap praeciqueeaup praeciqueeapu praeciqupeaue praeciqupeaeu praeciqupeuae praeciqupeuea praeciqupeeua praeciqupeeau
praeciqupaeue praeciqupaeeu praeciqupauee praeciqupauee praeciqupaeue praeciqupaeeu praeciqupuaee praeciqupuaee praeciqupueae
praeciqupueea praeciqupueea praeciqupueae praeciqupeaue praeciqupeaeu praeciqupeuae praeciqupeuea praeciqupeeua praeciqupeeau
praeciquuepae praeciquuepea praeciquueape praeciquueaep praeciquueeap praeciquueepa praeciquupeae praeciquupeea praeciquupaee
praeciquupaee praeciquupeae praeciquupeea praeciquuapee praeciquuapee praeciquuaepe praeciquuaeep praeciquuaeep praeciquuaepe
praeciquuepae praeciquuepea praeciquueape praeciquueaep praeciquueeap praeciquueepa praeciqueepua praeciqueepau praeciqueeupa
praeciqueeuap praeciqueeaup praeciqueeapu praeciquepeua praeciquepeau praeciquepuea praeciquepuae praeciquepaue praeciquepaeu
praeciqueupea praeciqueupae praeciqueuepa praeciqueueap praeciqueuaep praeciqueuape praeciqueapue praeciqueapeu praeciqueaupe
praeciqueauep praeciqueaeup praeciqueaepu praeciqauepue praeciqauepeu praeciqaueupe praeciqaueuep praeciqaueeup praeciqaueepu
praeciqaupeue praeciqaupeeu praeciqaupuee praeciqaupuee praeciqaupeue praeciqaupeeu praeciqauupee praeciqauupee praeciqauuepe
praeciqauueep praeciqauueep praeciqauuepe praeciqauepue praeciqauepeu praeciqaueupe praeciqaueuep praeciqaueeup praeciqaueepu
praeciqaeupue praeciqaeupeu praeciqaeuupe praeciqaeuuep praeciqaeueup praeciqaeuepu praeciqaepuue praeciqaepueu praeciqaepuue
praeciqaepueu praeciqaepeuu praeciqaepeuu praeciqaeupue praeciqaeupeu praeciqaeuupe praeciqaeuuep praeciqaeueup praeciqaeuepu
praeciqaeepuu praeciqaeepuu praeciqaeeupu praeciqaeeuup praeciqaeeuup praeciqaeeupu praeciqapeuue praeciqapeueu praeciqapeuue
praeciqapeueu praeciqapeeuu praeciqapeeuu praeciqapueue praeciqapueeu praeciqapuuee praeciqapuuee praeciqapueue praeciqapueeu
praeciqapuuee praeciqapuuee praeciqapueue praeciqapueeu praeciqapueeu praeciqapueue praeciqapeuue praeciqapeueu praeciqapeuue
praeciqapeueu praeciqapeeuu praeciqapeeuu praeciqauepue praeciqauepeu praeciqaueupe praeciqaueuep praeciqaueeup praeciqaueepu
praeciqaupeue praeciqaupeeu praeciqaupuee praeciqaupuee praeciqaupeue praeciqaupeeu praeciqauupee praeciqauupee praeciqauuepe
praeciqauueep praeciqauueep praeciqauuepe praeciqauepue praeciqauepeu praeciqaueupe praeciqaueuep praeciqaueeup praeciqaueepu
praeciqaeepuu praeciqaeepuu praeciqaeeupu praeciqaeeuup praeciqaeeuup praeciqaeeupu praeciqaepeuu praeciqaepeuu praeciqaepueu
praeciqaepuue praeciqaepuue praeciqaepueu praeciqaeupeu praeciqaeupue praeciqaeuepu praeciqaeueup praeciqaeuuep praeciqaeuupe
praeciqaeupue praeciqaeupeu praeciqaeuupe praeciqaeuuep praeciqaeueup praeciqaeuepu praeciqeaupue praeciqeaupeu praeciqeauupe
praeciqeauuep praeciqeaueup praeciqeauepu praeciqeapuue praeciqeapueu praeciqeapuue praeciqeapueu praeciqeapeuu praeciqeapeuu
praeciqeaupue praeciqeaupeu praeciqeauupe praeciqeauuep praeciqeaueup praeciqeauepu praeciqeaepuu praeciqeaepuu praeciqeaeupu
praeciqeaeuup praeciqeaeuup praeciqeaeupu praeciqeuapue praeciqeuapeu praeciqeuaupe praeciqeuauep praeciqeuaeup praeciqeuaepu
praeciqeupaue praeciqeupaeu praeciqeupuae praeciqeupuea praeciqeupeua praeciqeupeau praeciqeuupae praeciqeuupea praeciqeuuape
praeciqeuuaep praeciqeuueap praeciqeuuepa praeciqeuepua praeciqeuepau praeciqeueupa praeciqeueuap praeciqeueaup praeciqeueapu
praeciqepuaue praeciqepuaeu praeciqepuuae praeciqepuuea praeciqepueua praeciqepueau praeciqepauue praeciqepaueu praeciqepauue
praeciqepaueu praeciqepaeuu praeciqepaeuu praeciqepuaue praeciqepuaeu praeciqepuuae praeciqepuuea praeciqepueua praeciqepueau
praeciqepeauu praeciqepeauu praeciqepeuau praeciqepeuua praeciqepeuua praeciqepeuau praeciqeuupae praeciqeuupea praeciqeuuape
praeciqeuuaep praeciqeuueap praeciqeuuepa praeciqeupuae praeciqeupuea praeciqeupaue praeciqeupaeu praeciqeupeau praeciqeupeua
praeciqeuapue praeciqeuapeu praeciqeuaupe praeciqeuauep praeciqeuaeup praeciqeuaepu praeciqeuepau praeciqeuepua praeciqeueapu
praeciqeueaup praeciqeueuap praeciqeueupa praeciqeeupua praeciqeeupau praeciqeeuupa praeciqeeuuap praeciqeeuaup praeciqeeuapu
praeciqeepuua praeciqeepuau praeciqeepuua praeciqeepuau praeciqeepauu praeciqeepauu praeciqeeupua praeciqeeupau praeciqeeuupa
praeciqeeuuap praeciqeeuaup praeciqeeuapu praeciqeeapuu praeciqeeapuu praeciqeeaupu praeciqeeauup praeciqeeauup praeciqeeaupu
praeciqpaeuue praeciqpaeueu praeciqpaeuue praeciqpaeueu praeciqpaeeuu praeciqpaeeuu praeciqpaueue praeciqpaueeu praeciqpauuee
praeciqpauuee praeciqpaueue praeciqpaueeu praeciqpauuee praeciqpauuee praeciqpaueue praeciqpaueeu praeciqpaueeu praeciqpaueue
praeciqpaeuue praeciqpaeueu praeciqpaeuue praeciqpaeueu praeciqpaeeuu praeciqpaeeuu praeciqpeauue praeciqpeaueu praeciqpeauue
praeciqpeaueu praeciqpeaeuu praeciqpeaeuu praeciqpeuaue praeciqpeuaeu praeciqpeuuae praeciqpeuuea praeciqpeueua praeciqpeueau
praeciqpeuuae praeciqpeuuea praeciqpeuaue praeciqpeuaeu praeciqpeueau praeciqpeueua praeciqpeeuua praeciqpeeuau praeciqpeeuua
praeciqpeeuau praeciqpeeauu praeciqpeeauu praeciqpueaue praeciqpueaeu praeciqpueuae praeciqpueuea praeciqpueeua praeciqpueeau
praeciqpuaeue praeciqpuaeeu praeciqpuauee praeciqpuauee praeciqpuaeue praeciqpuaeeu praeciqpuuaee praeciqpuuaee praeciqpuueae
praeciqpuueea praeciqpuueea praeciqpuueae praeciqpueaue praeciqpueaeu praeciqpueuae praeciqpueuea praeciqpueeua praeciqpueeau
praeciqpueuae praeciqpueuea praeciqpueaue praeciqpueaeu praeciqpueeau praeciqpueeua praeciqpuueae praeciqpuueea praeciqpuuaee
praeciqpuuaee praeciqpuueae praeciqpuueea praeciqpuauee praeciqpuauee praeciqpuaeue praeciqpuaeeu praeciqpuaeeu praeciqpuaeue
praeciqpueuae praeciqpueuea praeciqpueaue praeciqpueaeu praeciqpueeau praeciqpueeua praeciqpeeuua praeciqpeeuau praeciqpeeuua
praeciqpeeuau praeciqpeeauu praeciqpeeauu praeciqpeueua praeciqpeueau praeciqpeuuea praeciqpeuuae praeciqpeuaue praeciqpeuaeu
praeciqpeuuea praeciqpeuuae praeciqpeueua praeciqpeueau praeciqpeuaeu praeciqpeuaue praeciqpeauue praeciqpeaueu praeciqpeauue
praeciqpeaueu praeciqpeaeuu praeciqpeaeuu praeciquaepue praeciquaepeu praeciquaeupe praeciquaeuep praeciquaeeup praeciquaeepu
praeciquapeue praeciquapeeu praeciquapuee praeciquapuee praeciquapeue praeciquapeeu praeciquaupee praeciquaupee praeciquauepe
praeciquaueep praeciquaueep praeciquauepe praeciquaepue praeciquaepeu praeciquaeupe praeciquaeuep praeciquaeeup praeciquaeepu
praeciqueapue praeciqueapeu praeciqueaupe praeciqueauep praeciqueaeup praeciqueaepu praeciquepaue praeciquepaeu praeciquepuae
praeciquepuea praeciquepeua praeciquepeau praeciqueupae praeciqueupea praeciqueuape praeciqueuaep praeciqueueap praeciqueuepa
praeciqueepua praeciqueepau praeciqueeupa praeciqueeuap praeciqueeaup praeciqueeapu praeciqupeaue praeciqupeaeu praeciqupeuae
praeciqupeuea praeciqupeeua praeciqupeeau praeciqupaeue praeciqupaeeu praeciqupauee praeciqupauee praeciqupaeue praeciqupaeeu
praeciqupuaee praeciqupuaee praeciqupueae praeciqupueea praeciqupueea praeciqupueae praeciqupeaue praeciqupeaeu praeciqupeuae
praeciqupeuea praeciqupeeua praeciqupeeau praeciquuepae praeciquuepea praeciquueape praeciquueaep praeciquueeap praeciquueepa
praeciquupeae praeciquupeea praeciquupaee praeciquupaee praeciquupeae praeciquupeea praeciquuapee praeciquuapee praeciquuaepe
praeciquuaeep praeciquuaeep praeciquuaepe praeciquuepae praeciquuepea praeciquueape praeciquueaep praeciquueeap praeciquueepa
praeciqueepua praeciqueepau praeciqueeupa praeciqueeuap praeciqueeaup praeciqueeapu praeciquepeua praeciquepeau praeciquepuea
praeciquepuae praeciquepaue praeciquepaeu praeciqueupea praeciqueupae praeciqueuepa praeciqueueap praeciqueuaep praeciqueuape
praeciqueapue praeciqueapeu praeciqueaupe praeciqueauep praeciqueaeup praeciqueaepu praeciqeaepuu praeciqeaepuu praeciqeaeupu
praeciqeaeuup praeciqeaeuup praeciqeaeupu praeciqeapeuu praeciqeapeuu praeciqeapueu praeciqeapuue praeciqeapuue praeciqeapueu
praeciqeaupeu praeciqeaupue praeciqeauepu praeciqeaueup praeciqeauuep praeciqeauupe praeciqeaupue praeciqeaupeu praeciqeauupe
praeciqeauuep praeciqeaueup praeciqeauepu praeciqeeapuu praeciqeeapuu praeciqeeaupu praeciqeeauup praeciqeeauup praeciqeeaupu
praeciqeepauu praeciqeepauu praeciqeepuau praeciqeepuua praeciqeepuua praeciqeepuau praeciqeeupau praeciqeeupua praeciqeeuapu
praeciqeeuaup praeciqeeuuap praeciqeeuupa praeciqeeupua praeciqeeupau praeciqeeuupa praeciqeeuuap praeciqeeuaup praeciqeeuapu
praeciqepeauu praeciqepeauu praeciqepeuau praeciqepeuua praeciqepeuua praeciqepeuau praeciqepaeuu praeciqepaeuu praeciqepaueu
praeciqepauue praeciqepauue praeciqepaueu praeciqepuaeu praeciqepuaue praeciqepueau praeciqepueua praeciqepuuea praeciqepuuae
praeciqepuaue praeciqepuaeu praeciqepuuae praeciqepuuea praeciqepueua praeciqepueau praeciqeuepau praeciqeuepua praeciqeueapu
praeciqeueaup praeciqeueuap praeciqeueupa praeciqeupeau praeciqeupeua praeciqeupaeu praeciqeupaue praeciqeupuae praeciqeupuea
praeciqeuapeu praeciqeuapue praeciqeuaepu praeciqeuaeup praeciqeuauep praeciqeuaupe praeciqeuupae praeciqeuupea praeciqeuuape
praeciqeuuaep praeciqeuueap praeciqeuuepa praeciqeuepua praeciqeuepau praeciqeueupa praeciqeueuap praeciqeueaup praeciqeueapu
praeciqeupeua praeciqeupeau praeciqeupuea praeciqeupuae praeciqeupaue praeciqeupaeu praeciqeuupea praeciqeuupae praeciqeuuepa
praeciqeuueap praeciqeuuaep praeciqeuuape praeciqeuapue praeciqeuapeu praeciqeuaupe praeciqeuauep praeciqeuaeup praeciqeuaepu
praeciuuaeqpe praeciuuaeqep praeciuuaepqe praeciuuaepeq praeciuuaeepq praeciuuaeeqp praeciuuaqepe praeciuuaqeep praeciuuaqpee
praeciuuaqpee praeciuuaqepe praeciuuaqeep praeciuuapqee praeciuuapqee praeciuuapeqe praeciuuapeeq praeciuuapeeq praeciuuapeqe
praeciuuaeqpe praeciuuaeqep praeciuuaepqe praeciuuaepeq praeciuuaeepq praeciuuaeeqp praeciuueaqpe praeciuueaqep praeciuueapqe
praeciuueapeq praeciuueaepq praeciuueaeqp praeciuueqape praeciuueqaep praeciuueqpae praeciuueqpea praeciuueqepa praeciuueqeap
praeciuuepqae praeciuuepqea praeciuuepaqe praeciuuepaeq praeciuuepeaq praeciuuepeqa praeciuueeqpa praeciuueeqap praeciuueepqa
praeciuueepaq praeciuueeapq praeciuueeaqp praeciuuqeape praeciuuqeaep praeciuuqepae praeciuuqepea praeciuuqeepa praeciuuqeeap
praeciuuqaepe praeciuuqaeep praeciuuqapee praeciuuqapee praeciuuqaepe praeciuuqaeep praeciuuqpaee praeciuuqpaee praeciuuqpeae
praeciuuqpeea praeciuuqpeea praeciuuqpeae praeciuuqeape praeciuuqeaep praeciuuqepae praeciuuqepea praeciuuqeepa praeciuuqeeap
praeciuupeqae praeciuupeqea praeciuupeaqe praeciuupeaeq praeciuupeeaq praeciuupeeqa praeciuupqeae praeciuupqeea praeciuupqaee
praeciuupqaee praeciuupqeae praeciuupqeea praeciuupaqee praeciuupaqee praeciuupaeqe praeciuupaeeq praeciuupaeeq praeciuupaeqe
praeciuupeqae praeciuupeqea praeciuupeaqe praeciuupeaeq praeciuupeeaq praeciuupeeqa praeciuueeqpa praeciuueeqap praeciuueepqa
praeciuueepaq praeciuueeapq praeciuueeaqp praeciuueqepa praeciuueqeap praeciuueqpea praeciuueqpae praeciuueqape praeciuueqaep
praeciuuepqea praeciuuepqae praeciuuepeqa praeciuuepeaq praeciuuepaeq praeciuuepaqe praeciuueaqpe praeciuueaqep praeciuueapqe
praeciuueapeq praeciuueaepq praeciuueaeqp praeciuaueqpe praeciuaueqep praeciuauepqe praeciuauepeq praeciuaueepq praeciuaueeqp
praeciuauqepe praeciuauqeep praeciuauqpee praeciuauqpee praeciuauqepe praeciuauqeep praeciuaupqee praeciuaupqee praeciuaupeqe
praeciuaupeeq praeciuaupeeq praeciuaupeqe praeciuaueqpe praeciuaueqep praeciuauepqe praeciuauepeq praeciuaueepq praeciuaueeqp
praeciuaeuqpe praeciuaeuqep praeciuaeupqe praeciuaeupeq praeciuaeuepq praeciuaeueqp praeciuaequpe praeciuaequep praeciuaeqpue
praeciuaeqpeu praeciuaeqepu praeciuaeqeup praeciuaepque praeciuaepqeu praeciuaepuqe praeciuaepueq praeciuaepeuq praeciuaepequ
praeciuaeeqpu praeciuaeequp praeciuaeepqu praeciuaeepuq praeciuaeeupq praeciuaeeuqp praeciuaqeupe praeciuaqeuep praeciuaqepue
praeciuaqepeu praeciuaqeepu praeciuaqeeup praeciuaquepe praeciuaqueep praeciuaqupee praeciuaqupee praeciuaquepe praeciuaqueep
praeciuaqpuee praeciuaqpuee praeciuaqpeue praeciuaqpeeu praeciuaqpeeu praeciuaqpeue praeciuaqeupe praeciuaqeuep praeciuaqepue
praeciuaqepeu praeciuaqeepu praeciuaqeeup praeciuapeque praeciuapeqeu praeciuapeuqe praeciuapeueq praeciuapeeuq praeciuapeequ
praeciuapqeue praeciuapqeeu praeciuapquee praeciuapquee praeciuapqeue praeciuapqeeu praeciuapuqee praeciuapuqee praeciuapueqe
praeciuapueeq praeciuapueeq praeciuapueqe praeciuapeque praeciuapeqeu praeciuapeuqe praeciuapeueq praeciuapeeuq praeciuapeequ
praeciuaeeqpu praeciuaeequp praeciuaeepqu praeciuaeepuq praeciuaeeupq praeciuaeeuqp praeciuaeqepu praeciuaeqeup praeciuaeqpeu
praeciuaeqpue praeciuaequpe praeciuaequep praeciuaepqeu praeciuaepque praeciuaepequ praeciuaepeuq praeciuaepueq praeciuaepuqe
praeciuaeuqpe praeciuaeuqep praeciuaeupqe praeciuaeupeq praeciuaeuepq praeciuaeueqp praeciueauqpe praeciueauqep praeciueaupqe
praeciueaupeq praeciueauepq praeciueaueqp praeciueaqupe praeciueaquep praeciueaqpue praeciueaqpeu praeciueaqepu praeciueaqeup
praeciueapque praeciueapqeu praeciueapuqe praeciueapueq praeciueapeuq praeciueapequ praeciueaeqpu praeciueaequp praeciueaepqu
praeciueaepuq praeciueaeupq praeciueaeuqp praeciueuaqpe praeciueuaqep praeciueuapqe praeciueuapeq praeciueuaepq praeciueuaeqp
praeciueuqape praeciueuqaep praeciueuqpae praeciueuqpea praeciueuqepa praeciueuqeap praeciueupqae praeciueupqea praeciueupaqe
praeciueupaeq praeciueupeaq praeciueupeqa praeciueueqpa praeciueueqap praeciueuepqa praeciueuepaq praeciueueapq praeciueueaqp
praeciuequape praeciuequaep praeciuequpae praeciuequpea praeciuequepa praeciuequeap praeciueqaupe praeciueqauep praeciueqapue
praeciueqapeu praeciueqaepu praeciueqaeup praeciueqpaue praeciueqpaeu praeciueqpuae praeciueqpuea praeciueqpeua praeciueqpeau
praeciueqeapu praeciueqeaup praeciueqepau praeciueqepua praeciueqeupa praeciueqeuap praeciuepuqae praeciuepuqea praeciuepuaqe
praeciuepuaeq praeciuepueaq praeciuepueqa praeciuepquae praeciuepquea praeciuepqaue praeciuepqaeu praeciuepqeau praeciuepqeua
praeciuepaque praeciuepaqeu praeciuepauqe praeciuepaueq praeciuepaeuq praeciuepaequ praeciuepeqau praeciuepequa praeciuepeaqu
praeciuepeauq praeciuepeuaq praeciuepeuqa praeciueeuqpa praeciueeuqap praeciueeupqa praeciueeupaq praeciueeuapq praeciueeuaqp
praeciueequpa praeciueequap praeciueeqpua praeciueeqpau praeciueeqapu praeciueeqaup praeciueepqua praeciueepqau praeciueepuqa
praeciueepuaq praeciueepauq praeciueepaqu praeciueeaqpu praeciueeaqup praeciueeapqu praeciueeapuq praeciueeaupq praeciueeauqp
praeciuqaeupe praeciuqaeuep praeciuqaepue praeciuqaepeu praeciuqaeepu praeciuqaeeup praeciuqauepe praeciuqaueep praeciuqaupee
praeciuqaupee praeciuqauepe praeciuqaueep praeciuqapuee praeciuqapuee praeciuqapeue praeciuqapeeu praeciuqapeeu praeciuqapeue
praeciuqaeupe praeciuqaeuep praeciuqaepue praeciuqaepeu praeciuqaeepu praeciuqaeeup praeciuqeaupe praeciuqeauep praeciuqeapue
praeciuqeapeu praeciuqeaepu praeciuqeaeup praeciuqeuape praeciuqeuaep praeciuqeupae praeciuqeupea praeciuqeuepa praeciuqeueap
praeciuqepuae praeciuqepuea praeciuqepaue praeciuqepaeu praeciuqepeau praeciuqepeua praeciuqeeupa praeciuqeeuap praeciuqeepua
praeciuqeepau praeciuqeeapu praeciuqeeaup praeciuqueape praeciuqueaep praeciuquepae praeciuquepea praeciuqueepa praeciuqueeap
praeciuquaepe praeciuquaeep praeciuquapee praeciuquapee praeciuquaepe praeciuquaeep praeciuqupaee praeciuqupaee praeciuqupeae
praeciuqupeea praeciuqupeea praeciuqupeae praeciuqueape praeciuqueaep praeciuquepae praeciuquepea praeciuqueepa praeciuqueeap
praeciuqpeuae praeciuqpeuea praeciuqpeaue praeciuqpeaeu praeciuqpeeau praeciuqpeeua praeciuqpueae praeciuqpueea praeciuqpuaee
praeciuqpuaee praeciuqpueae praeciuqpueea praeciuqpauee praeciuqpauee praeciuqpaeue praeciuqpaeeu praeciuqpaeeu praeciuqpaeue
praeciuqpeuae praeciuqpeuea praeciuqpeaue praeciuqpeaeu praeciuqpeeau praeciuqpeeua praeciuqeeupa praeciuqeeuap praeciuqeepua
praeciuqeepau praeciuqeeapu praeciuqeeaup praeciuqeuepa praeciuqeueap praeciuqeupea praeciuqeupae praeciuqeuape praeciuqeuaep
praeciuqepuea praeciuqepuae praeciuqepeua praeciuqepeau praeciuqepaeu praeciuqepaue praeciuqeaupe praeciuqeauep praeciuqeapue
praeciuqeapeu praeciuqeaepu praeciuqeaeup praeciupaeque praeciupaeqeu praeciupaeuqe praeciupaeueq praeciupaeeuq praeciupaeequ
praeciupaqeue praeciupaqeeu praeciupaquee praeciupaquee praeciupaqeue praeciupaqeeu praeciupauqee praeciupauqee praeciupaueqe
praeciupaueeq praeciupaueeq praeciupaueqe praeciupaeque praeciupaeqeu praeciupaeuqe praeciupaeueq praeciupaeeuq praeciupaeequ
praeciupeaque praeciupeaqeu praeciupeauqe praeciupeaueq praeciupeaeuq praeciupeaequ praeciupeqaue praeciupeqaeu praeciupequae
praeciupequea praeciupeqeua praeciupeqeau praeciupeuqae praeciupeuqea praeciupeuaqe praeciupeuaeq praeciupeueaq praeciupeueqa
praeciupeequa praeciupeeqau praeciupeeuqa praeciupeeuaq praeciupeeauq praeciupeeaqu praeciupqeaue praeciupqeaeu praeciupqeuae
praeciupqeuea praeciupqeeua praeciupqeeau praeciupqaeue praeciupqaeeu praeciupqauee praeciupqauee praeciupqaeue praeciupqaeeu
praeciupquaee praeciupquaee praeciupqueae praeciupqueea praeciupqueea praeciupqueae praeciupqeaue praeciupqeaeu praeciupqeuae
praeciupqeuea praeciupqeeua praeciupqeeau praeciupueqae praeciupueqea praeciupueaqe praeciupueaeq praeciupueeaq praeciupueeqa
praeciupuqeae praeciupuqeea praeciupuqaee praeciupuqaee praeciupuqeae praeciupuqeea praeciupuaqee praeciupuaqee praeciupuaeqe
praeciupuaeeq praeciupuaeeq praeciupuaeqe praeciupueqae praeciupueqea praeciupueaqe praeciupueaeq praeciupueeaq praeciupueeqa
praeciupeequa praeciupeeqau praeciupeeuqa praeciupeeuaq praeciupeeauq praeciupeeaqu praeciupeqeua praeciupeqeau praeciupequea
praeciupequae praeciupeqaue praeciupeqaeu praeciupeuqea praeciupeuqae praeciupeueqa praeciupeueaq praeciupeuaeq praeciupeuaqe
praeciupeaque praeciupeaqeu praeciupeauqe praeciupeaueq praeciupeaeuq praeciupeaequ praeciueaeqpu praeciueaequp praeciueaepqu
praeciueaepuq praeciueaeupq praeciueaeuqp praeciueaqepu praeciueaqeup praeciueaqpeu praeciueaqpue praeciueaqupe praeciueaquep
praeciueapqeu praeciueapque praeciueapequ praeciueapeuq praeciueapueq praeciueapuqe praeciueauqpe praeciueauqep praeciueaupqe
praeciueaupeq praeciueauepq praeciueaueqp praeciueeaqpu praeciueeaqup praeciueeapqu praeciueeapuq praeciueeaupq praeciueeauqp
praeciueeqapu praeciueeqaup praeciueeqpau praeciueeqpua praeciueequpa praeciueequap praeciueepqau praeciueepqua praeciueepaqu
praeciueepauq praeciueepuaq praeciueepuqa praeciueeuqpa praeciueeuqap praeciueeupqa praeciueeupaq praeciueeuapq praeciueeuaqp
praeciueqeapu praeciueqeaup praeciueqepau praeciueqepua praeciueqeupa praeciueqeuap praeciueqaepu praeciueqaeup praeciueqapeu
praeciueqapue praeciueqaupe praeciueqauep praeciueqpaeu praeciueqpaue praeciueqpeau praeciueqpeua praeciueqpuea praeciueqpuae
praeciuequape praeciuequaep praeciuequpae praeciuequpea praeciuequepa praeciuequeap praeciuepeqau praeciuepequa praeciuepeaqu
praeciuepeauq praeciuepeuaq praeciuepeuqa praeciuepqeau praeciuepqeua praeciuepqaeu praeciuepqaue praeciuepquae praeciuepquea
praeciuepaqeu praeciuepaque praeciuepaequ praeciuepaeuq praeciuepaueq praeciuepauqe praeciuepuqae praeciuepuqea praeciuepuaqe
praeciuepuaeq praeciuepueaq praeciuepueqa praeciueueqpa praeciueueqap praeciueuepqa praeciueuepaq praeciueueapq praeciueueaqp
praeciueuqepa praeciueuqeap praeciueuqpea praeciueuqpae praeciueuqape praeciueuqaep praeciueupqea praeciueupqae praeciueupeqa
praeciueupeaq praeciueupaeq praeciueupaqe praeciueuaqpe praeciueuaqep praeciueuapqe praeciueuapeq praeciueuaepq praeciueuaeqp
praecieuaequp praecieuaeqpu praecieuaeuqp praecieuaeupq praecieuaepuq praecieuaepqu praecieuaqeup praecieuaqepu praecieuaquep
praecieuaqupe praecieuaqpue praecieuaqpeu praecieuauqep praecieuauqpe praecieuaueqp praecieuauepq praecieuaupeq praecieuaupqe
praecieuapque praecieuapqeu praecieuapuqe praecieuapueq praecieuapeuq praecieuapequ praecieueaqup praecieueaqpu praecieueauqp
praecieueaupq praecieueapuq praecieueapqu praecieueqaup praecieueqapu praecieuequap praecieuequpa praecieueqpua praecieueqpau
praecieueuqap praecieueuqpa praecieueuaqp praecieueuapq praecieueupaq praecieueupqa praecieuepqua praecieuepqau praecieuepuqa
praecieuepuaq praecieuepauq praecieuepaqu praecieuqeaup praecieuqeapu praecieuqeuap praecieuqeupa praecieuqepua praecieuqepau
praecieuqaeup praecieuqaepu praecieuqauep praecieuqaupe praecieuqapue praecieuqapeu praecieuquaep praecieuquape praecieuqueap
praecieuquepa praecieuqupea praecieuqupae praecieuqpaue praecieuqpaeu praecieuqpuae praecieuqpuea praecieuqpeua praecieuqpeau
praecieuueqap praecieuueqpa praecieuueaqp praecieuueapq praecieuuepaq praecieuuepqa praecieuuqeap praecieuuqepa praecieuuqaep
praecieuuqape praecieuuqpae praecieuuqpea praecieuuaqep praecieuuaqpe praecieuuaeqp praecieuuaepq praecieuuapeq praecieuuapqe
praecieuupqae praecieuupqea praecieuupaqe praecieuupaeq praecieuupeaq praecieuupeqa praecieupequa praecieupeqau praecieupeuqa
praecieupeuaq praecieupeauq praecieupeaqu praecieupqeua praecieupqeau praecieupquea praecieupquae praecieupqaue praecieupqaeu
praecieupuqea praecieupuqae praecieupueqa praecieupueaq praecieupuaeq praecieupuaqe praecieupaque praecieupaqeu praecieupauqe
praecieupaueq praecieupaeuq praecieupaequ praecieauequp praecieaueqpu praecieaueuqp praecieaueupq praecieauepuq praecieauepqu
praecieauqeup praecieauqepu praecieauquep praecieauqupe praecieauqpue praecieauqpeu praecieauuqep praecieauuqpe praecieauueqp
praecieauuepq praecieauupeq praecieauupqe praecieaupque praecieaupqeu praecieaupuqe praecieaupueq praecieaupeuq praecieaupequ
praecieaeuqup praecieaeuqpu praecieaeuuqp praecieaeuupq praecieaeupuq praecieaeupqu praecieaequup praecieaequpu praecieaequup
praecieaequpu praecieaeqpuu praecieaeqpuu praecieaeuqup praecieaeuqpu praecieaeuuqp praecieaeuupq praecieaeupuq praecieaeupqu
praecieaepquu praecieaepquu praecieaepuqu praecieaepuuq praecieaepuuq praecieaepuqu praecieaqeuup praecieaqeupu praecieaqeuup
praecieaqeupu praecieaqepuu praecieaqepuu praecieaqueup praecieaquepu praecieaquuep praecieaquupe praecieaqupue praecieaqupeu
praecieaquuep praecieaquupe praecieaqueup praecieaquepu praecieaqupeu praecieaqupue praecieaqpuue praecieaqpueu praecieaqpuue
praecieaqpueu praecieaqpeuu praecieaqpeuu praecieauequp praecieaueqpu praecieaueuqp praecieaueupq praecieauepuq praecieauepqu
praecieauqeup praecieauqepu praecieauquep praecieauqupe praecieauqpue praecieauqpeu praecieauuqep praecieauuqpe praecieauueqp
praecieauuepq praecieauupeq praecieauupqe praecieaupque praecieaupqeu praecieaupuqe praecieaupueq praecieaupeuq praecieaupequ
praecieapequu praecieapequu praecieapeuqu praecieapeuuq praecieapeuuq praecieapeuqu praecieapqeuu praecieapqeuu praecieapqueu
praecieapquue praecieapquue praecieapqueu praecieapuqeu praecieapuque praecieapuequ praecieapueuq praecieapuueq praecieapuuqe
praecieapuque praecieapuqeu praecieapuuqe praecieapuueq praecieapueuq praecieapuequ praecieeauqup praecieeauqpu praecieeauuqp
praecieeauupq praecieeaupuq praecieeaupqu praecieeaquup praecieeaqupu praecieeaquup praecieeaqupu praecieeaqpuu praecieeaqpuu
praecieeauqup praecieeauqpu praecieeauuqp praecieeauupq praecieeaupuq praecieeaupqu praecieeapquu praecieeapquu praecieeapuqu
praecieeapuuq praecieeapuuq praecieeapuqu praecieeuaqup praecieeuaqpu praecieeuauqp praecieeuaupq praecieeuapuq praecieeuapqu
praecieeuqaup praecieeuqapu praecieeuquap praecieeuqupa praecieeuqpua praecieeuqpau praecieeuuqap praecieeuuqpa praecieeuuaqp
praecieeuuapq praecieeuupaq praecieeuupqa praecieeupqua praecieeupqau praecieeupuqa praecieeupuaq praecieeupauq praecieeupaqu
praecieequaup praecieequapu praecieequuap praecieequupa praecieequpua praecieequpau praecieeqauup praecieeqaupu praecieeqauup
praecieeqaupu praecieeqapuu praecieeqapuu praecieequaup praecieequapu praecieequuap praecieequupa praecieequpua praecieequpau
praecieeqpauu praecieeqpauu praecieeqpuau praecieeqpuua praecieeqpuua praecieeqpuau praecieeuuqap praecieeuuqpa praecieeuuaqp
praecieeuuapq praecieeuupaq praecieeuupqa praecieeuquap praecieeuqupa praecieeuqaup praecieeuqapu praecieeuqpau praecieeuqpua
praecieeuaqup praecieeuaqpu praecieeuauqp praecieeuaupq praecieeuapuq praecieeuapqu praecieeupqau praecieeupqua praecieeupaqu
praecieeupauq praecieeupuaq praecieeupuqa praecieepuqua praecieepuqau praecieepuuqa praecieepuuaq praecieepuauq praecieepuaqu
praecieepquua praecieepquau praecieepquua praecieepquau praecieepqauu praecieepqauu praecieepuqua praecieepuqau praecieepuuqa
praecieepuuaq praecieepuauq praecieepuaqu praecieepaquu praecieepaquu praecieepauqu praecieepauuq praecieepauuq praecieepauqu
praecieqaeuup praecieqaeupu praecieqaeuup praecieqaeupu praecieqaepuu praecieqaepuu praecieqaueup praecieqauepu praecieqauuep
praecieqauupe praecieqaupue praecieqaupeu praecieqauuep praecieqauupe praecieqaueup praecieqauepu praecieqaupeu praecieqaupue
praecieqapuue praecieqapueu praecieqapuue praecieqapueu praecieqapeuu praecieqapeuu praecieqeauup praecieqeaupu praecieqeauup
praecieqeaupu praecieqeapuu praecieqeapuu praecieqeuaup praecieqeuapu praecieqeuuap praecieqeuupa praecieqeupua praecieqeupau
praecieqeuuap praecieqeuupa praecieqeuaup praecieqeuapu praecieqeupau praecieqeupua praecieqepuua praecieqepuau praecieqepuua
praecieqepuau praecieqepauu praecieqepauu praeciequeaup praeciequeapu praeciequeuap praeciequeupa praeciequepua praeciequepau
praeciequaeup praeciequaepu praeciequauep praeciequaupe praeciequapue praeciequapeu praeciequuaep praeciequuape praeciequueap
praeciequuepa praeciequupea praeciequupae praeciequpaue praeciequpaeu praeciequpuae praeciequpuea praeciequpeua praeciequpeau
praeciequeuap praeciequeupa praeciequeaup praeciequeapu praeciequepau praeciequepua praeciequueap praeciequuepa praeciequuaep
praeciequuape praeciequupae praeciequupea praeciequauep praeciequaupe praeciequaeup praeciequaepu praeciequapeu praeciequapue
praeciequpuae praeciequpuea praeciequpaue praeciequpaeu praeciequpeau praeciequpeua praecieqpeuua praecieqpeuau praecieqpeuua
praecieqpeuau praecieqpeauu praecieqpeauu praecieqpueua praecieqpueau praecieqpuuea praecieqpuuae praecieqpuaue praecieqpuaeu
praecieqpuuea praecieqpuuae praecieqpueua praecieqpueau praecieqpuaeu praecieqpuaue praecieqpauue praecieqpaueu praecieqpauue
praecieqpaueu praecieqpaeuu praecieqpaeuu praecieuaequp praecieuaeqpu praecieuaeuqp praecieuaeupq praecieuaepuq praecieuaepqu
praecieuaqeup praecieuaqepu praecieuaquep praecieuaqupe praecieuaqpue praecieuaqpeu praecieuauqep praecieuauqpe praecieuaueqp
praecieuauepq praecieuaupeq praecieuaupqe praecieuapque praecieuapqeu praecieuapuqe praecieuapueq praecieuapeuq praecieuapequ
praecieueaqup praecieueaqpu praecieueauqp praecieueaupq praecieueapuq praecieueapqu praecieueqaup praecieueqapu praecieuequap
praecieuequpa praecieueqpua praecieueqpau praecieueuqap praecieueuqpa praecieueuaqp praecieueuapq praecieueupaq praecieueupqa
praecieuepqua praecieuepqau praecieuepuqa praecieuepuaq praecieuepauq praecieuepaqu praecieuqeaup praecieuqeapu praecieuqeuap
praecieuqeupa praecieuqepua praecieuqepau praecieuqaeup praecieuqaepu praecieuqauep praecieuqaupe praecieuqapue praecieuqapeu
praecieuquaep praecieuquape praecieuqueap praecieuquepa praecieuqupea praecieuqupae praecieuqpaue praecieuqpaeu praecieuqpuae
praecieuqpuea praecieuqpeua praecieuqpeau praecieuueqap praecieuueqpa praecieuueaqp praecieuueapq praecieuuepaq praecieuuepqa
praecieuuqeap praecieuuqepa praecieuuqaep praecieuuqape praecieuuqpae praecieuuqpea praecieuuaqep praecieuuaqpe praecieuuaeqp
praecieuuaepq praecieuuapeq praecieuuapqe praecieuupqae praecieuupqea praecieuupaqe praecieuupaeq praecieuupeaq praecieuupeqa
praecieupequa praecieupeqau praecieupeuqa praecieupeuaq praecieupeauq praecieupeaqu praecieupqeua praecieupqeau praecieupquea
praecieupquae praecieupqaue praecieupqaeu praecieupuqea praecieupuqae praecieupueqa praecieupueaq praecieupuaeq praecieupuaqe
praecieupaque praecieupaqeu praecieupauqe praecieupaueq praecieupaeuq praecieupaequ praeciepaequu praeciepaequu praeciepaeuqu
praeciepaeuuq praeciepaeuuq praeciepaeuqu praeciepaqeuu praeciepaqeuu praeciepaqueu praeciepaquue praeciepaquue praeciepaqueu
praeciepauqeu praeciepauque praeciepauequ praeciepaueuq praeciepauueq praeciepauuqe praeciepauque praeciepauqeu praeciepauuqe
praeciepauueq praeciepaueuq praeciepauequ praeciepeaquu praeciepeaquu praeciepeauqu praeciepeauuq praeciepeauuq praeciepeauqu
praeciepeqauu praeciepeqauu praeciepequau praeciepequua praeciepequua praeciepequau praeciepeuqau praeciepeuqua praeciepeuaqu
praeciepeuauq praeciepeuuaq praeciepeuuqa praeciepeuqua praeciepeuqau praeciepeuuqa praeciepeuuaq praeciepeuauq praeciepeuaqu
praeciepqeauu praeciepqeauu praeciepqeuau praeciepqeuua praeciepqeuua praeciepqeuau praeciepqaeuu praeciepqaeuu praeciepqaueu
praeciepqauue praeciepqauue praeciepqaueu praeciepquaeu praeciepquaue praeciepqueau praeciepqueua praeciepquuea praeciepquuae
praeciepquaue praeciepquaeu praeciepquuae praeciepquuea praeciepqueua praeciepqueau praeciepueqau praeciepuequa praeciepueaqu
praeciepueauq praeciepueuaq praeciepueuqa praeciepuqeau praeciepuqeua praeciepuqaeu praeciepuqaue praeciepuquae praeciepuquea
praeciepuaqeu praeciepuaque praeciepuaequ praeciepuaeuq praeciepuaueq praeciepuauqe praeciepuuqae praeciepuuqea praeciepuuaqe
praeciepuuaeq praeciepuueaq praeciepuueqa praeciepuequa praeciepueqau praeciepueuqa praeciepueuaq praeciepueauq praeciepueaqu
praeciepuqeua praeciepuqeau praeciepuquea praeciepuquae praeciepuqaue praeciepuqaeu praeciepuuqea praeciepuuqae praeciepuueqa
praeciepuueaq praeciepuuaeq praeciepuuaqe praeciepuaque praeciepuaqeu praeciepuauqe praeciepuaueq praeciepuaeuq praeciepuaequ

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us