easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

pettijohn

constringent

monotheistic

zelyakov

facetiousness

liebeszauber

wickawee

untackle

mcclennan

acajou

spikes

plaining

blackstreet

wearyworld

apyrene

auentinum

levities

pathros


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: praecepissem
cipher variations:
qsbfdfqjttfn rtcgegrkuugo sudhfhslvvhp tveigitmwwiq uwfjhjunxxjr
vxgkikvoyyks wyhljlwpzzlt xzimkmxqaamu yajnlnyrbbnv zbkomozsccow
aclpnpatddpx bdmqoqbueeqy cenrprcvffrz dfosqsdwggsa egptrtexhhtb
fhqusufyiiuc girvtvgzjjvd hjswuwhakkwe iktxvxibllxf jluywyjcmmyg
kmvzxzkdnnzh lnwayaleooai moxbzbmfppbj npycacngqqck oqzdbdohrrdl

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: praecepissem
Cipher: kizvxvkrhhvn

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: praecepissem
Cipher: ABBBA BAAAA AAAAA AABAA AAABA AABAA ABBBA ABAAA BAAAB BAAAB AABAA ABABB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: praecepissem
cipher variations:
qsbfdfqjttfnuabnhnuzddnlyibvlvypnnvjcqbdpdcfxxdhgybltlgvhhlfkgbtxtklrrtdswbjfjsrlljzwebrjrwhvvrx
ambznzaxffzveubhrhenpphticbpvpidzzprmkbxzxmtjjxprtcgegrkuugovbcoiovaeeomzjcwmwzqoowkdrceqedgyyei
hzcmumhwiimglhcuyulmssuetxckgktsmmkaxfcsksxiwwsybncaoabyggawfvcisifoqqiujdcqwqjeaaqsnlcyaynukkyq
sudhfhslvvhpwcdpjpwbffpnakdxnxarppxlesdfrfehzzfjiadnvnixjjnhmidvzvmnttvfuydlhlutnnlbygdtltyjxxtz
codbpbczhhbxgwdjtjgprrjvkedrxrkfbbrtomdzbzovllzrtveigitmwwiqxdeqkqxcggqobleyoybsqqymftegsgfiaagk
jbeowojykkoinjewawnouuwgvzemimvuoomczheumuzkyyuadpecqcdaiicyhxekukhqsskwlfesyslgccsupneacapwmmas
uwfjhjunxxjryefrlrydhhrpcmfzpzctrrzngufhthgjbbhlkcfpxpkzllpjokfxbxopvvxhwafnjnwvppndaifvnvalzzvb
eqfdrdebjjdziyflvlirttlxmgftztmhddtvqofbdbqxnnbtvxgkikvoyykszfgsmszeiisqdngaqadussaohvgiuihkccim
ldgqyqlammqkplgycypqwwyixbgokoxwqqoebjgwowbmaawcfrgesefckkeajzgmwmjsuumynhguaunieeuwrpgcecryoocu
wyhljlwpzzltaghtntafjjtreohbrbevttbpiwhjvjilddjnmehrzrmbnnrlqmhzdzqrxxzjychplpyxrrpfckhxpxcnbbxd
gshftfgdllfbkahnxnktvvnzoihvbvojffvxsqhdfdszppdvxzimkmxqaamubhiuoubgkkusfpicscfwuucqjxikwkjmeeko
nfisasncoosmrniaearsyyakzdiqmqzyssqgdliyqydoccyehtigughemmgclbioyoluwwoapjiwcwpkggwytriegetaqqew
yajnlnyrbbnvcijvpvchllvtgqjdtdgxvvdrkyjlxlknfflpogjtbtodpptnsojbfbstzzblaejrnrazttrhemjzrzepddzf
iujhvhifnnhdmcjpzpmvxxpbqkjxdxqlhhxzusjfhfubrrfxzbkomozsccowdjkwqwdimmwuhrkeuehywweslzkmymloggmq
phkucupeqquotpkcgctuaacmbfksosbauusifnkasafqeeagjvkiwijgooiendkqaqnwyyqcrlkyeyrmiiyavtkgigvcssgy
aclpnpatddpxeklxrxejnnxvislfvfizxxftmalnznmphhnrqilvdvqfrrvpuqldhduvbbdncgltptcbvvtjgolbtbgrffbh
kwljxjkhppjfoelrbroxzzrdsmlzfzsnjjzbwulhjhwdtthzbdmqoqbueeqyflmysyfkooywjtmgwgjayygunbmoaonqiios
rjmwewrgsswqvrmeievwcceodhmuqudcwwukhpmcuchsggcilxmkykliqqkgpfmscspyaasetnmagatokkacxvmikixeuuia
cenrprcvffrzgmnztzglppzxkunhxhkbzzhvocnpbporjjptsknxfxshttxrwsnfjfwxddfpeinvrvedxxvliqndvdithhdj
mynlzlmjrrlhqgntdtqzbbtfuonbhbupllbdywnjljyfvvjbdfosqsdwggsahnoauahmqqaylvoiyilcaaiwpdoqcqpskkqu
tloygytiuuysxtogkgxyeegqfjowswfeyywmjroewejuiieknzomamnkssmirhoueuraccugvpocicvqmmcezxokmkzgwwkc
egptrtexhhtbiopbvbinrrbzmwpjzjmdbbjxqeprdrqtllrvumpzhzujvvztyuphlhyzffhrgkpxtxgfzzxnkspfxfkvjjfl
oapnbnolttnjsipvfvsbddvhwqpdjdwrnndfayplnlahxxldfhqusufyiiucjpqcwcjosscanxqkaknecckyrfqsesrummsw
vnqaiavkwwauzvqimizaggishlqyuyhgaayoltqgyglwkkgmpbqocopmuuoktjqwgwtceewixrqekexsooegbzqmombiyyme
girvtvgzjjvdkqrdxdkpttdboyrlblofddlzsgrtftsvnntxworbjbwlxxbvawrjnjabhhjtimrzvzihbbzpmurhzhmxllhn
qcrpdpqnvvplukrxhxudffxjysrflfytppfhcarnpncjzznfhjswuwhakkwelrseyelquuecpzsmcmpgeemathsugutwoouy
xpsckcxmyycwbxskokbciikujnsawajiccaqnvsiainymmiordsqeqrowwqmvlsyiyveggykztsgmgzuqqgidbsoqodkaaog
iktxvxibllxfmstfzfmrvvfdqatndnqhffnbuitvhvuxppvzyqtdldynzzdxcytlplcdjjlvkotbxbkjddbrowtjbjoznnjp
setrfrspxxrnwmtzjzwfhhzlauthnhavrrhjectprpelbbphjluywyjcmmygntugagnswwgerbuoeoriggocvjuwiwvyqqwa
zruemezoaaeydzumqmdekkmwlpucyclkeecspxukckpaookqtfusgstqyysoxnuakaxgiiambvuioibwssikfduqsqfmccqi
kmvzxzkdnnzhouvhbhotxxhfscvpfpsjhhpdwkvxjxwzrrxbasvfnfapbbfzeavnrnefllnxmqvdzdmlffdtqyvldlqbpplr
ugvthturzztpyovblbyhjjbncwvjpjcxttjlgevrtrgnddrjlnwayaleooaipvwicipuyyigtdwqgqtkiiqexlwykyxassyc
btwgogbqccgafbwosofgmmoynrweaenmggeurzwmemrcqqmsvhwuiuvsaauqzpwcmczikkcodxwkqkdyuukmhfwsushoeesk
moxbzbmfppbjqwxjdjqvzzjhuexrhruljjrfymxzlzybttzdcuxhphcrddhbgcxptpghnnpzosxfbfonhhfvsaxnfnsdrrnt
wixvjvwtbbvraqxdndajlldpeyxlrlezvvlnigxtvtipfftlnpycacngqqckrxykekrwaakivfysisvmkksgznyamazcuuae
dvyiqidseeichdyquqhiooqaptygcgpoiigwtbyogotessouxjywkwxuccwsbryeoebkmmeqfzymsmfawwmojhyuwujqggum
oqzdbdohrrdlsyzlflsxbbljwgztjtwnllthaozbnbadvvbfewzjrjetffjdiezrvrijpprbquzhdhqpjjhxuczphpufttpv
ykzxlxyvddxtcszfpfclnnfrgazntngbxxnpkizvxvkrhhvnpraecepissemtzamgmtyccmkxhaukuxommuibpacocbewwcg
fxakskfuggkejfaswsjkqqscrvaieirqkkiyvdaqiqvguuqwzlaymyzweeyudtagqgdmoogshbaouohcyyoqljawywlsiiwo

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: praecepissem
Cipher: cenrprcvffrz

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: praecepissem
Cipher: 532411513151534234345123

Extended Methods:
Method #1

Plaintext: praecepissem
method variations:
uwfkhkuoxxkrzblpnpztccpwegqusueyhhubkmvzxzkdnnzg

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
p r a e c e p i s s e m 
5 2 1 5 3 5 5 4 3 3 5 2 
3 4 1 1 1 1 3 2 4 4 1 3 
They are then read out in rows:
521535543352341111324413
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: praecepissem
Cipher: kvxunksaahtl

Read more ...
Method #3

Plaintext: praecepissem
method variations:
hdvlvvsmoyfx dvlvvsmoyfxh vlvvsmoyfxhd
lvvsmoyfxhdv vvsmoyfxhdvl vsmoyfxhdvlv
smoyfxhdvlvv moyfxhdvlvvs oyfxhdvlvvsm
yfxhdvlvvsmo fxhdvlvvsmoy xhdvlvvsmoyf

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: praecepissem

first 5040 cipher variations(475687488 total)
praecepissem praecepissme praecepisesm praecepisems praecepismes praecepismse praecepissem praecepissme praecepisesm
praecepisems praecepismes praecepismse praecepiessm praecepiesms praecepiessm praecepiesms praecepiemss praecepiemss
praecepimses praecepimsse praecepimess praecepimess praecepimses praecepimsse praecepsisem praecepsisme praecepsiesm
praecepsiems praecepsimes praecepsimse praecepssiem praecepssime praecepsseim praecepssemi praecepssmei praecepssmie
praecepsesim praecepsesmi praecepseism praecepseims praecepsemis praecepsemsi praecepsmsei praecepsmsie praecepsmesi
praecepsmeis praecepsmies praecepsmise praecepssiem praecepssime praecepsseim praecepssemi praecepssmei praecepssmie
praecepsisem praecepsisme praecepsiesm praecepsiems praecepsimes praecepsimse praecepseism praecepseims praecepsesim
praecepsesmi praecepsemsi praecepsemis praecepsmies praecepsmise praecepsmeis praecepsmesi praecepsmsei praecepsmsie
praecepessim praecepessmi praecepesism praecepesims praecepesmis praecepesmsi praecepessim praecepessmi praecepesism
praecepesims praecepesmis praecepesmsi praecepeissm praecepeisms praecepeissm praecepeisms praecepeimss praecepeimss
praecepemsis praecepemssi praecepemiss praecepemiss praecepemsis praecepemssi praecepmssei praecepmssie praecepmsesi
praecepmseis praecepmsies praecepmsise praecepmssei praecepmssie praecepmsesi praecepmseis praecepmsies praecepmsise
praecepmessi praecepmesis praecepmessi praecepmesis praecepmeiss praecepmeiss praecepmises praecepmisse praecepmiess
praecepmiess praecepmises praecepmisse praeceipssem praeceipssme praeceipsesm praeceipsems praeceipsmes praeceipsmse
praeceipssem praeceipssme praeceipsesm praeceipsems praeceipsmes praeceipsmse praeceipessm praeceipesms praeceipessm
praeceipesms praeceipemss praeceipemss praeceipmses praeceipmsse praeceipmess praeceipmess praeceipmses praeceipmsse
praeceispsem praeceispsme praeceispesm praeceispems praeceispmes praeceispmse praeceisspem praeceisspme praeceissepm
praeceissemp praeceissmep praeceissmpe praeceisespm praeceisesmp praeceisepsm praeceisepms praeceisemps praeceisemsp
praeceismsep praeceismspe praeceismesp praeceismeps praeceismpes praeceismpse praeceisspem praeceisspme praeceissepm
praeceissemp praeceissmep praeceissmpe praeceispsem praeceispsme praeceispesm praeceispems praeceispmes praeceispmse
praeceisepsm praeceisepms praeceisespm praeceisesmp praeceisemsp praeceisemps praeceismpes praeceismpse praeceismeps
praeceismesp praeceismsep praeceismspe praeceiesspm praeceiessmp praeceiespsm praeceiespms praeceiesmps praeceiesmsp
praeceiesspm praeceiessmp praeceiespsm praeceiespms praeceiesmps praeceiesmsp praeceiepssm praeceiepsms praeceiepssm
praeceiepsms praeceiepmss praeceiepmss praeceiemsps praeceiemssp praeceiempss praeceiempss praeceiemsps praeceiemssp
praeceimssep praeceimsspe praeceimsesp praeceimseps praeceimspes praeceimspse praeceimssep praeceimsspe praeceimsesp
praeceimseps praeceimspes praeceimspse praeceimessp praeceimesps praeceimessp praeceimesps praeceimepss praeceimepss
praeceimpses praeceimpsse praeceimpess praeceimpess praeceimpses praeceimpsse praecesipsem praecesipsme praecesipesm
praecesipems praecesipmes praecesipmse praecesispem praecesispme praecesisepm praecesisemp praecesismep praecesismpe
praecesiespm praecesiesmp praecesiepsm praecesiepms praecesiemps praecesiemsp praecesimsep praecesimspe praecesimesp
praecesimeps praecesimpes praecesimpse praecespisem praecespisme praecespiesm praecespiems praecespimes praecespimse
praecespsiem praecespsime praecespseim praecespsemi praecespsmei praecespsmie praecespesim praecespesmi praecespeism
praecespeims praecespemis praecespemsi praecespmsei praecespmsie praecespmesi praecespmeis praecespmies praecespmise
praecesspiem praecesspime praecesspeim praecesspemi praecesspmei praecesspmie praecessipem praecessipme praecessiepm
praecessiemp praecessimep praecessimpe praecesseipm praecesseimp praecessepim praecessepmi praecessempi praecessemip
praecessmiep praecessmipe praecessmeip praecessmepi praecessmpei praecessmpie praecesepsim praecesepsmi praecesepism
praecesepims praecesepmis praecesepmsi praecesespim praecesespmi praecesesipm praecesesimp praecesesmip praecesesmpi
praeceseispm praeceseismp praeceseipsm praeceseipms praeceseimps praeceseimsp praecesemsip praecesemspi praecesemisp
praecesemips praecesempis praecesempsi praecesmpsei praecesmpsie praecesmpesi praecesmpeis praecesmpies praecesmpise
praecesmspei praecesmspie praecesmsepi praecesmseip praecesmsiep praecesmsipe praecesmespi praecesmesip praecesmepsi
praecesmepis praecesmeips praecesmeisp praecesmisep praecesmispe praecesmiesp praecesmieps praecesmipes praecesmipse
praecesispem praecesispme praecesisepm praecesisemp praecesismep praecesismpe praecesipsem praecesipsme praecesipesm
praecesipems praecesipmes praecesipmse praecesiepsm praecesiepms praecesiespm praecesiesmp praecesiemsp praecesiemps
praecesimpes praecesimpse praecesimeps praecesimesp praecesimsep praecesimspe praecessipem praecessipme praecessiepm
praecessiemp praecessimep praecessimpe praecesspiem praecesspime praecesspeim praecesspemi praecesspmei praecesspmie
praecessepim praecessepmi praecesseipm praecesseimp praecessemip praecessempi praecessmpei praecessmpie praecessmepi
praecessmeip praecessmiep praecessmipe praecespsiem praecespsime praecespseim praecespsemi praecespsmei praecespsmie
praecespisem praecespisme praecespiesm praecespiems praecespimes praecespimse praecespeism praecespeims praecespesim
praecespesmi praecespemsi praecespemis praecespmies praecespmise praecespmeis praecespmesi praecespmsei praecespmsie
praecesespim praecesespmi praecesesipm praecesesimp praecesesmip praecesesmpi praecesepsim praecesepsmi praecesepism
praecesepims praecesepmis praecesepmsi praeceseipsm praeceseipms praeceseispm praeceseismp praeceseimsp praeceseimps
praecesempis praecesempsi praecesemips praecesemisp praecesemsip praecesemspi praecesmspei praecesmspie praecesmsepi
praecesmseip praecesmsiep praecesmsipe praecesmpsei praecesmpsie praecesmpesi praecesmpeis praecesmpies praecesmpise
praecesmepsi praecesmepis praecesmespi praecesmesip praecesmeisp praecesmeips praecesmipes praecesmipse praecesmieps
praecesmiesp praecesmisep praecesmispe praeceeisspm praeceeissmp praeceeispsm praeceeispms praeceeismps praeceeismsp
praeceeisspm praeceeissmp praeceeispsm praeceeispms praeceeismps praeceeismsp praeceeipssm praeceeipsms praeceeipssm
praeceeipsms praeceeipmss praeceeipmss praeceeimsps praeceeimssp praeceeimpss praeceeimpss praeceeimsps praeceeimssp
praeceesispm praeceesismp praeceesipsm praeceesipms praeceesimps praeceesimsp praeceessipm praeceessimp praeceesspim
praeceesspmi praeceessmpi praeceessmip praeceespsim praeceespsmi praeceespism praeceespims praeceespmis praeceespmsi
praeceesmspi praeceesmsip praeceesmpsi praeceesmpis praeceesmips praeceesmisp praeceessipm praeceessimp praeceesspim
praeceesspmi praeceessmpi praeceessmip praeceesispm praeceesismp praeceesipsm praeceesipms praeceesimps praeceesimsp
praeceespism praeceespims praeceespsim praeceespsmi praeceespmsi praeceespmis praeceesmips praeceesmisp praeceesmpis
praeceesmpsi praeceesmspi praeceesmsip praeceepssim praeceepssmi praeceepsism praeceepsims praeceepsmis praeceepsmsi
praeceepssim praeceepssmi praeceepsism praeceepsims praeceepsmis praeceepsmsi praeceepissm praeceepisms praeceepissm
praeceepisms praeceepimss praeceepimss praeceepmsis praeceepmssi praeceepmiss praeceepmiss praeceepmsis praeceepmssi
praeceemsspi praeceemssip praeceemspsi praeceemspis praeceemsips praeceemsisp praeceemsspi praeceemssip praeceemspsi
praeceemspis praeceemsips praeceemsisp praeceempssi praeceempsis praeceempssi praeceempsis praeceempiss praeceempiss
praeceemisps praeceemissp praeceemipss praeceemipss praeceemisps praeceemissp praecemissep praecemisspe praecemisesp
praecemiseps praecemispes praecemispse praecemissep praecemisspe praecemisesp praecemiseps praecemispes praecemispse
praecemiessp praecemiesps praecemiessp praecemiesps praecemiepss praecemiepss praecemipses praecemipsse praecemipess
praecemipess praecemipses praecemipsse praecemsisep praecemsispe praecemsiesp praecemsieps praecemsipes praecemsipse
praecemssiep praecemssipe praecemsseip praecemssepi praecemsspei praecemsspie praecemsesip praecemsespi praecemseisp
praecemseips praecemsepis praecemsepsi praecemspsei praecemspsie praecemspesi praecemspeis praecemspies praecemspise
praecemssiep praecemssipe praecemsseip praecemssepi praecemsspei praecemsspie praecemsisep praecemsispe praecemsiesp
praecemsieps praecemsipes praecemsipse praecemseisp praecemseips praecemsesip praecemsespi praecemsepsi praecemsepis
praecemspies praecemspise praecemspeis praecemspesi praecemspsei praecemspsie praecemessip praecemesspi praecemesisp
praecemesips praecemespis praecemespsi praecemessip praecemesspi praecemesisp praecemesips praecemespis praecemespsi
praecemeissp praecemeisps praecemeissp praecemeisps praecemeipss praecemeipss praecemepsis praecemepssi praecemepiss
praecemepiss praecemepsis praecemepssi praecempssei praecempssie praecempsesi praecempseis praecempsies praecempsise
praecempssei praecempssie praecempsesi praecempseis praecempsies praecempsise praecempessi praecempesis praecempessi
praecempesis praecempeiss praecempeiss praecempises praecempisse praecempiess praecempiess praecempises praecempisse
praecpeissem praecpeissme praecpeisesm praecpeisems praecpeismes praecpeismse praecpeissem praecpeissme praecpeisesm
praecpeisems praecpeismes praecpeismse praecpeiessm praecpeiesms praecpeiessm praecpeiesms praecpeiemss praecpeiemss
praecpeimses praecpeimsse praecpeimess praecpeimess praecpeimses praecpeimsse praecpesisem praecpesisme praecpesiesm
praecpesiems praecpesimes praecpesimse praecpessiem praecpessime praecpesseim praecpessemi praecpessmei praecpessmie
praecpesesim praecpesesmi praecpeseism praecpeseims praecpesemis praecpesemsi praecpesmsei praecpesmsie praecpesmesi
praecpesmeis praecpesmies praecpesmise praecpessiem praecpessime praecpesseim praecpessemi praecpessmei praecpessmie
praecpesisem praecpesisme praecpesiesm praecpesiems praecpesimes praecpesimse praecpeseism praecpeseims praecpesesim
praecpesesmi praecpesemsi praecpesemis praecpesmies praecpesmise praecpesmeis praecpesmesi praecpesmsei praecpesmsie
praecpeessim praecpeessmi praecpeesism praecpeesims praecpeesmis praecpeesmsi praecpeessim praecpeessmi praecpeesism
praecpeesims praecpeesmis praecpeesmsi praecpeeissm praecpeeisms praecpeeissm praecpeeisms praecpeeimss praecpeeimss
praecpeemsis praecpeemssi praecpeemiss praecpeemiss praecpeemsis praecpeemssi praecpemssei praecpemssie praecpemsesi
praecpemseis praecpemsies praecpemsise praecpemssei praecpemssie praecpemsesi praecpemseis praecpemsies praecpemsise
praecpemessi praecpemesis praecpemessi praecpemesis praecpemeiss praecpemeiss praecpemises praecpemisse praecpemiess
praecpemiess praecpemises praecpemisse praecpiessem praecpiessme praecpiesesm praecpiesems praecpiesmes praecpiesmse
praecpiessem praecpiessme praecpiesesm praecpiesems praecpiesmes praecpiesmse praecpieessm praecpieesms praecpieessm
praecpieesms praecpieemss praecpieemss praecpiemses praecpiemsse praecpiemess praecpiemess praecpiemses praecpiemsse
praecpisesem praecpisesme praecpiseesm praecpiseems praecpisemes praecpisemse praecpisseem praecpisseme praecpisseem
praecpisseme praecpissmee praecpissmee praecpisesem praecpisesme praecpiseesm praecpiseems praecpisemes praecpisemse
praecpismsee praecpismsee praecpismese praecpismees praecpismees praecpismese praecpisseem praecpisseme praecpisseem
praecpisseme praecpissmee praecpissmee praecpisesem praecpisesme praecpiseesm praecpiseems praecpisemes praecpisemse
praecpiseesm praecpiseems praecpisesem praecpisesme praecpisemse praecpisemes praecpismees praecpismese praecpismees
praecpismese praecpismsee praecpismsee praecpiessem praecpiessme praecpiesesm praecpiesems praecpiesmes praecpiesmse
praecpiessem praecpiessme praecpiesesm praecpiesems praecpiesmes praecpiesmse praecpieessm praecpieesms praecpieessm
praecpieesms praecpieemss praecpieemss praecpiemses praecpiemsse praecpiemess praecpiemess praecpiemses praecpiemsse
praecpimssee praecpimssee praecpimsese praecpimsees praecpimsees praecpimsese praecpimssee praecpimssee praecpimsese
praecpimsees praecpimsees praecpimsese praecpimesse praecpimeses praecpimesse praecpimeses praecpimeess praecpimeess
praecpimeses praecpimesse praecpimeess praecpimeess praecpimeses praecpimesse praecpsiesem praecpsiesme praecpsieesm
praecpsieems praecpsiemes praecpsiemse praecpsiseem praecpsiseme praecpsiseem praecpsiseme praecpsismee praecpsismee
praecpsiesem praecpsiesme praecpsieesm praecpsieems praecpsiemes praecpsiemse praecpsimsee praecpsimsee praecpsimese
praecpsimees praecpsimees praecpsimese praecpseisem praecpseisme praecpseiesm praecpseiems praecpseimes praecpseimse
praecpsesiem praecpsesime praecpseseim praecpsesemi praecpsesmei praecpsesmie praecpseesim praecpseesmi praecpseeism
praecpseeims praecpseemis praecpseemsi praecpsemsei praecpsemsie praecpsemesi praecpsemeis praecpsemies praecpsemise
praecpsseiem praecpsseime praecpsseeim praecpsseemi praecpssemei praecpssemie praecpssieem praecpssieme praecpssieem
praecpssieme praecpssimee praecpssimee praecpsseiem praecpsseime praecpsseeim praecpsseemi praecpssemei praecpssemie
praecpssmiee praecpssmiee praecpssmeie praecpssmeei praecpssmeei praecpssmeie praecpseesim praecpseesmi praecpseeism
praecpseeims praecpseemis praecpseemsi praecpseseim praecpsesemi praecpsesiem praecpsesime praecpsesmie praecpsesmei
praecpseisem praecpseisme praecpseiesm praecpseiems praecpseimes praecpseimse praecpsemsie praecpsemsei praecpsemise
praecpsemies praecpsemeis praecpsemesi praecpsmesei praecpsmesie praecpsmeesi praecpsmeeis praecpsmeies praecpsmeise
praecpsmseei praecpsmseie praecpsmseei praecpsmseie praecpsmsiee praecpsmsiee praecpsmesei praecpsmesie praecpsmeesi
praecpsmeeis praecpsmeies praecpsmeise praecpsmisee praecpsmisee praecpsmiese praecpsmiees praecpsmiees praecpsmiese
praecpsiseem praecpsiseme praecpsiseem praecpsiseme praecpsismee praecpsismee praecpsiesem praecpsiesme praecpsieesm
praecpsieems praecpsiemes praecpsiemse praecpsieesm praecpsieems praecpsiesem praecpsiesme praecpsiemse praecpsiemes
praecpsimees praecpsimese praecpsimees praecpsimese praecpsimsee praecpsimsee praecpssieem praecpssieme praecpssieem
praecpssieme praecpssimee praecpssimee praecpsseiem praecpsseime praecpsseeim praecpsseemi praecpssemei praecpssemie
praecpsseeim praecpsseemi praecpsseiem praecpsseime praecpssemie praecpssemei praecpssmeei praecpssmeie praecpssmeei
praecpssmeie praecpssmiee praecpssmiee praecpsesiem praecpsesime praecpseseim praecpsesemi praecpsesmei praecpsesmie
praecpseisem praecpseisme praecpseiesm praecpseiems praecpseimes praecpseimse praecpseeism praecpseeims praecpseesim
praecpseesmi praecpseemsi praecpseemis praecpsemies praecpsemise praecpsemeis praecpsemesi praecpsemsei praecpsemsie
praecpseseim praecpsesemi praecpsesiem praecpsesime praecpsesmie praecpsesmei praecpseesim praecpseesmi praecpseeism
praecpseeims praecpseemis praecpseemsi praecpseiesm praecpseiems praecpseisem praecpseisme praecpseimse praecpseimes
praecpsemeis praecpsemesi praecpsemies praecpsemise praecpsemsie praecpsemsei praecpsmseei praecpsmseie praecpsmseei
praecpsmseie praecpsmsiee praecpsmsiee praecpsmesei praecpsmesie praecpsmeesi praecpsmeeis praecpsmeies praecpsmeise
praecpsmeesi praecpsmeeis praecpsmesei praecpsmesie praecpsmeise praecpsmeies praecpsmiees praecpsmiese praecpsmiees
praecpsmiese praecpsmisee praecpsmisee praecpeissem praecpeissme praecpeisesm praecpeisems praecpeismes praecpeismse
praecpeissem praecpeissme praecpeisesm praecpeisems praecpeismes praecpeismse praecpeiessm praecpeiesms praecpeiessm
praecpeiesms praecpeiemss praecpeiemss praecpeimses praecpeimsse praecpeimess praecpeimess praecpeimses praecpeimsse
praecpesisem praecpesisme praecpesiesm praecpesiems praecpesimes praecpesimse praecpessiem praecpessime praecpesseim
praecpessemi praecpessmei praecpessmie praecpesesim praecpesesmi praecpeseism praecpeseims praecpesemis praecpesemsi
praecpesmsei praecpesmsie praecpesmesi praecpesmeis praecpesmies praecpesmise praecpessiem praecpessime praecpesseim
praecpessemi praecpessmei praecpessmie praecpesisem praecpesisme praecpesiesm praecpesiems praecpesimes praecpesimse
praecpeseism praecpeseims praecpesesim praecpesesmi praecpesemsi praecpesemis praecpesmies praecpesmise praecpesmeis
praecpesmesi praecpesmsei praecpesmsie praecpeessim praecpeessmi praecpeesism praecpeesims praecpeesmis praecpeesmsi
praecpeessim praecpeessmi praecpeesism praecpeesims praecpeesmis praecpeesmsi praecpeeissm praecpeeisms praecpeeissm
praecpeeisms praecpeeimss praecpeeimss praecpeemsis praecpeemssi praecpeemiss praecpeemiss praecpeemsis praecpeemssi
praecpemssei praecpemssie praecpemsesi praecpemseis praecpemsies praecpemsise praecpemssei praecpemssie praecpemsesi
praecpemseis praecpemsies praecpemsise praecpemessi praecpemesis praecpemessi praecpemesis praecpemeiss praecpemeiss
praecpemises praecpemisse praecpemiess praecpemiess praecpemises praecpemisse praecpmissee praecpmissee praecpmisese
praecpmisees praecpmisees praecpmisese praecpmissee praecpmissee praecpmisese praecpmisees praecpmisees praecpmisese
praecpmiesse praecpmieses praecpmiesse praecpmieses praecpmieess praecpmieess praecpmieses praecpmiesse praecpmieess
praecpmieess praecpmieses praecpmiesse praecpmsisee praecpmsisee praecpmsiese praecpmsiees praecpmsiees praecpmsiese
praecpmssiee praecpmssiee praecpmsseie praecpmsseei praecpmsseei praecpmsseie praecpmsesie praecpmsesei praecpmseise
praecpmseies praecpmseeis praecpmseesi praecpmsesei praecpmsesie praecpmseesi praecpmseeis praecpmseies praecpmseise
praecpmssiee praecpmssiee praecpmsseie praecpmsseei praecpmsseei praecpmsseie praecpmsisee praecpmsisee praecpmsiese
praecpmsiees praecpmsiees praecpmsiese praecpmseise praecpmseies praecpmsesie praecpmsesei praecpmseesi praecpmseeis
praecpmseies praecpmseise praecpmseeis praecpmseesi praecpmsesei praecpmsesie praecpmessie praecpmessei praecpmesise
praecpmesies praecpmeseis praecpmesesi praecpmessie praecpmessei praecpmesise praecpmesies praecpmeseis praecpmesesi
praecpmeisse praecpmeises praecpmeisse praecpmeises praecpmeiess praecpmeiess praecpmeesis praecpmeessi praecpmeeiss
praecpmeeiss praecpmeesis praecpmeessi praecpmessei praecpmessie praecpmesesi praecpmeseis praecpmesies praecpmesise
praecpmessei praecpmessie praecpmesesi praecpmeseis praecpmesies praecpmesise praecpmeessi praecpmeesis praecpmeessi
praecpmeesis praecpmeeiss praecpmeeiss praecpmeises praecpmeisse praecpmeiess praecpmeiess praecpmeises praecpmeisse
praecipessem praecipessme praecipesesm praecipesems praecipesmes praecipesmse praecipessem praecipessme praecipesesm
praecipesems praecipesmes praecipesmse praecipeessm praecipeesms praecipeessm praecipeesms praecipeemss praecipeemss
praecipemses praecipemsse praecipemess praecipemess praecipemses praecipemsse praecipsesem praecipsesme praecipseesm
praecipseems praecipsemes praecipsemse praecipsseem praecipsseme praecipsseem praecipsseme praecipssmee praecipssmee
praecipsesem praecipsesme praecipseesm praecipseems praecipsemes praecipsemse praecipsmsee praecipsmsee praecipsmese
praecipsmees praecipsmees praecipsmese praecipsseem praecipsseme praecipsseem praecipsseme praecipssmee praecipssmee
praecipsesem praecipsesme praecipseesm praecipseems praecipsemes praecipsemse praecipseesm praecipseems praecipsesem
praecipsesme praecipsemse praecipsemes praecipsmees praecipsmese praecipsmees praecipsmese praecipsmsee praecipsmsee
praecipessem praecipessme praecipesesm praecipesems praecipesmes praecipesmse praecipessem praecipessme praecipesesm
praecipesems praecipesmes praecipesmse praecipeessm praecipeesms praecipeessm praecipeesms praecipeemss praecipeemss
praecipemses praecipemsse praecipemess praecipemess praecipemses praecipemsse praecipmssee praecipmssee praecipmsese
praecipmsees praecipmsees praecipmsese praecipmssee praecipmssee praecipmsese praecipmsees praecipmsees praecipmsese
praecipmesse praecipmeses praecipmesse praecipmeses praecipmeess praecipmeess praecipmeses praecipmesse praecipmeess
praecipmeess praecipmeses praecipmesse praeciepssem praeciepssme praeciepsesm praeciepsems praeciepsmes praeciepsmse
praeciepssem praeciepssme praeciepsesm praeciepsems praeciepsmes praeciepsmse praeciepessm praeciepesms praeciepessm
praeciepesms praeciepemss praeciepemss praeciepmses praeciepmsse praeciepmess praeciepmess praeciepmses praeciepmsse
praeciespsem praeciespsme praeciespesm praeciespems praeciespmes praeciespmse praeciesspem praeciesspme praeciessepm
praeciessemp praeciessmep praeciessmpe praeciesespm praeciesesmp praeciesepsm praeciesepms praeciesemps praeciesemsp
praeciesmsep praeciesmspe praeciesmesp praeciesmeps praeciesmpes praeciesmpse praeciesspem praeciesspme praeciessepm
praeciessemp praeciessmep praeciessmpe praeciespsem praeciespsme praeciespesm praeciespems praeciespmes praeciespmse
praeciesepsm praeciesepms praeciesespm praeciesesmp praeciesemsp praeciesemps praeciesmpes praeciesmpse praeciesmeps
praeciesmesp praeciesmsep praeciesmspe praecieesspm praecieessmp praecieespsm praecieespms praecieesmps praecieesmsp
praecieesspm praecieessmp praecieespsm praecieespms praecieesmps praecieesmsp praecieepssm praecieepsms praecieepssm
praecieepsms praecieepmss praecieepmss praecieemsps praecieemssp praecieempss praecieempss praecieemsps praecieemssp
praeciemssep praeciemsspe praeciemsesp praeciemseps praeciemspes praeciemspse praeciemssep praeciemsspe praeciemsesp
praeciemseps praeciemspes praeciemspse praeciemessp praeciemesps praeciemessp praeciemesps praeciemepss praeciemepss
praeciempses praeciempsse praeciempess praeciempess praeciempses praeciempsse praecisepsem praecisepsme praecisepesm
praecisepems praecisepmes praecisepmse praecisespem praecisespme praecisesepm praecisesemp praecisesmep praecisesmpe
praeciseespm praeciseesmp praeciseepsm praeciseepms praeciseemps praeciseemsp praecisemsep praecisemspe praecisemesp
praecisemeps praecisempes praecisempse praecispesem praecispesme praecispeesm praecispeems praecispemes praecispemse
praecispseem praecispseme praecispseem praecispseme praecispsmee praecispsmee praecispesem praecispesme praecispeesm
praecispeems praecispemes praecispemse praecispmsee praecispmsee praecispmese praecispmees praecispmees praecispmese
praecisspeem praecisspeme praecisspeem praecisspeme praecisspmee praecisspmee praecissepem praecissepme praecisseepm
praecisseemp praecissemep praecissempe praecisseepm praecisseemp praecissepem praecissepme praecissempe praecissemep
praecissmeep praecissmepe praecissmeep praecissmepe praecissmpee praecissmpee praecisepsem praecisepsme praecisepesm
praecisepems praecisepmes praecisepmse praecisespem praecisespme praecisesepm praecisesemp praecisesmep praecisesmpe
praeciseespm praeciseesmp praeciseepsm praeciseepms praeciseemps praeciseemsp praecisemsep praecisemspe praecisemesp
praecisemeps praecisempes praecisempse praecismpsee praecismpsee praecismpese praecismpees praecismpees praecismpese
praecismspee praecismspee praecismsepe praecismseep praecismseep praecismsepe praecismespe praecismesep praecismepse
praecismepes praecismeeps praecismeesp praecismesep praecismespe praecismeesp praecismeeps praecismepes praecismepse
praecisespem praecisespme praecisesepm praecisesemp praecisesmep praecisesmpe praecisepsem praecisepsme praecisepesm
praecisepems praecisepmes praecisepmse praeciseepsm praeciseepms praeciseespm praeciseesmp praeciseemsp praeciseemps
praecisempes praecisempse praecisemeps praecisemesp praecisemsep praecisemspe praecissepem praecissepme praecisseepm
praecisseemp praecissemep praecissempe praecisspeem praecisspeme praecisspeem praecisspeme praecisspmee praecisspmee
praecissepem praecissepme praecisseepm praecisseemp praecissemep praecissempe praecissmpee praecissmpee praecissmepe
praecissmeep praecissmeep praecissmepe praecispseem praecispseme praecispseem praecispseme praecispsmee praecispsmee
praecispesem praecispesme praecispeesm praecispeems praecispemes praecispemse praecispeesm praecispeems praecispesem
praecispesme praecispemse praecispemes praecispmees praecispmese praecispmees praecispmese praecispmsee praecispmsee
praecisespem praecisespme praecisesepm praecisesemp praecisesmep praecisesmpe praecisepsem praecisepsme praecisepesm
praecisepems praecisepmes praecisepmse praeciseepsm praeciseepms praeciseespm praeciseesmp praeciseemsp praeciseemps
praecisempes praecisempse praecisemeps praecisemesp praecisemsep praecisemspe praecismspee praecismspee praecismsepe
praecismseep praecismseep praecismsepe praecismpsee praecismpsee praecismpese praecismpees praecismpees praecismpese
praecismepse praecismepes praecismespe praecismesep praecismeesp praecismeeps praecismepes praecismepse praecismeeps
praecismeesp praecismesep praecismespe praecieesspm praecieessmp praecieespsm praecieespms praecieesmps praecieesmsp
praecieesspm praecieessmp praecieespsm praecieespms praecieesmps praecieesmsp praecieepssm praecieepsms praecieepssm
praecieepsms praecieepmss praecieepmss praecieemsps praecieemssp praecieempss praecieempss praecieemsps praecieemssp
praeciesespm praeciesesmp praeciesepsm praeciesepms praeciesemps praeciesemsp praeciessepm praeciessemp praeciesspem
praeciesspme praeciessmpe praeciessmep praeciespsem praeciespsme praeciespesm praeciespems praeciespmes praeciespmse
praeciesmspe praeciesmsep praeciesmpse praeciesmpes praeciesmeps praeciesmesp praeciessepm praeciessemp praeciesspem
praeciesspme praeciessmpe praeciessmep praeciesespm praeciesesmp praeciesepsm praeciesepms praeciesemps praeciesemsp
praeciespesm praeciespems praeciespsem praeciespsme praeciespmse praeciespmes praeciesmeps praeciesmesp praeciesmpes
praeciesmpse praeciesmspe praeciesmsep praeciepssem praeciepssme praeciepsesm praeciepsems praeciepsmes praeciepsmse
praeciepssem praeciepssme praeciepsesm praeciepsems praeciepsmes praeciepsmse praeciepessm praeciepesms praeciepessm
praeciepesms praeciepemss praeciepemss praeciepmses praeciepmsse praeciepmess praeciepmess praeciepmses praeciepmsse
praeciemsspe praeciemssep praeciemspse praeciemspes praeciemseps praeciemsesp praeciemsspe praeciemssep praeciemspse
praeciemspes praeciemseps praeciemsesp praeciempsse praeciempses praeciempsse praeciempses praeciempess praeciempess
praeciemesps praeciemessp praeciemepss praeciemepss praeciemesps praeciemessp praecimessep praecimesspe praecimesesp
praecimeseps praecimespes praecimespse praecimessep praecimesspe praecimesesp praecimeseps praecimespes praecimespse
praecimeessp praecimeesps praecimeessp praecimeesps praecimeepss praecimeepss praecimepses praecimepsse praecimepess
praecimepess praecimepses praecimepsse praecimsesep praecimsespe praecimseesp praecimseeps praecimsepes praecimsepse
praecimsseep praecimssepe praecimsseep praecimssepe praecimsspee praecimsspee praecimsesep praecimsespe praecimseesp
praecimseeps praecimsepes praecimsepse praecimspsee praecimspsee praecimspese praecimspees praecimspees praecimspese
praecimsseep praecimssepe praecimsseep praecimssepe praecimsspee praecimsspee praecimsesep praecimsespe praecimseesp
praecimseeps praecimsepes praecimsepse praecimseesp praecimseeps praecimsesep praecimsespe praecimsepse praecimsepes
praecimspees praecimspese praecimspees praecimspese praecimspsee praecimspsee praecimessep praecimesspe praecimesesp
praecimeseps praecimespes praecimespse praecimessep praecimesspe praecimesesp praecimeseps praecimespes praecimespse
praecimeessp praecimeesps praecimeessp praecimeesps praecimeepss praecimeepss praecimepses praecimepsse praecimepess
praecimepess praecimepses praecimepsse praecimpssee praecimpssee praecimpsese praecimpsees praecimpsees praecimpsese
praecimpssee praecimpssee praecimpsese praecimpsees praecimpsees praecimpsese praecimpesse praecimpeses praecimpesse
praecimpeses praecimpeess praecimpeess praecimpeses praecimpesse praecimpeess praecimpeess praecimpeses praecimpesse
praecspiesem praecspiesme praecspieesm praecspieems praecspiemes praecspiemse praecspiseem praecspiseme praecspiseem
praecspiseme praecspismee praecspismee praecspiesem praecspiesme praecspieesm praecspieems praecspiemes praecspiemse
praecspimsee praecspimsee praecspimese praecspimees praecspimees praecspimese praecspeisem praecspeisme praecspeiesm
praecspeiems praecspeimes praecspeimse praecspesiem praecspesime praecspeseim praecspesemi praecspesmei praecspesmie
praecspeesim praecspeesmi praecspeeism praecspeeims praecspeemis praecspeemsi praecspemsei praecspemsie praecspemesi
praecspemeis praecspemies praecspemise praecspseiem praecspseime praecspseeim praecspseemi praecspsemei praecspsemie
praecspsieem praecspsieme praecspsieem praecspsieme praecspsimee praecspsimee praecspseiem praecspseime praecspseeim
praecspseemi praecspsemei praecspsemie praecspsmiee praecspsmiee praecspsmeie praecspsmeei praecspsmeei praecspsmeie
praecspeesim praecspeesmi praecspeeism praecspeeims praecspeemis praecspeemsi praecspeseim praecspesemi praecspesiem
praecspesime praecspesmie praecspesmei praecspeisem praecspeisme praecspeiesm praecspeiems praecspeimes praecspeimse
praecspemsie praecspemsei praecspemise praecspemies praecspemeis praecspemesi praecspmesei praecspmesie praecspmeesi
praecspmeeis praecspmeies praecspmeise praecspmseei praecspmseie praecspmseei praecspmseie praecspmsiee praecspmsiee
praecspmesei praecspmesie praecspmeesi praecspmeeis praecspmeies praecspmeise praecspmisee praecspmisee praecspmiese
praecspmiees praecspmiees praecspmiese praecsipesem praecsipesme praecsipeesm praecsipeems praecsipemes praecsipemse
praecsipseem praecsipseme praecsipseem praecsipseme praecsipsmee praecsipsmee praecsipesem praecsipesme praecsipeesm
praecsipeems praecsipemes praecsipemse praecsipmsee praecsipmsee praecsipmese praecsipmees praecsipmees praecsipmese
praecsiepsem praecsiepsme praecsiepesm praecsiepems praecsiepmes praecsiepmse praecsiespem praecsiespme praecsiesepm
praecsiesemp praecsiesmep praecsiesmpe praecsieespm praecsieesmp praecsieepsm praecsieepms praecsieemps praecsieemsp
praecsiemsep praecsiemspe praecsiemesp praecsiemeps praecsiempes praecsiempse praecsisepem praecsisepme praecsiseepm
praecsiseemp praecsisemep praecsisempe praecsispeem praecsispeme praecsispeem praecsispeme praecsispmee praecsispmee
praecsisepem praecsisepme praecsiseepm praecsiseemp praecsisemep praecsisempe praecsismpee praecsismpee praecsismepe
praecsismeep praecsismeep praecsismepe praecsieespm praecsieesmp praecsieepsm praecsieepms praecsieemps praecsieemsp
praecsiesepm praecsiesemp praecsiespem praecsiespme praecsiesmpe praecsiesmep praecsiepsem praecsiepsme praecsiepesm
praecsiepems praecsiepmes praecsiepmse praecsiemspe praecsiemsep praecsiempse praecsiempes praecsiemeps praecsiemesp
praecsimesep praecsimespe praecsimeesp praecsimeeps praecsimepes praecsimepse praecsimseep praecsimsepe praecsimseep
praecsimsepe praecsimspee praecsimspee praecsimesep praecsimespe praecsimeesp praecsimeeps praecsimepes praecsimepse
praecsimpsee praecsimpsee praecsimpese praecsimpees praecsimpees praecsimpese praecseipsem praecseipsme praecseipesm
praecseipems praecseipmes praecseipmse praecseispem praecseispme praecseisepm praecseisemp praecseismep praecseismpe
praecseiespm praecseiesmp praecseiepsm praecseiepms praecseiemps praecseiemsp praecseimsep praecseimspe praecseimesp
praecseimeps praecseimpes praecseimpse praecsepisem praecsepisme praecsepiesm praecsepiems praecsepimes praecsepimse
praecsepsiem praecsepsime praecsepseim praecsepsemi praecsepsmei praecsepsmie praecsepesim praecsepesmi praecsepeism
praecsepeims praecsepemis praecsepemsi praecsepmsei praecsepmsie praecsepmesi praecsepmeis praecsepmies praecsepmise
praecsespiem praecsespime praecsespeim praecsespemi praecsespmei praecsespmie praecsesipem praecsesipme praecsesiepm
praecsesiemp praecsesimep praecsesimpe praecseseipm praecseseimp praecsesepim praecsesepmi praecsesempi praecsesemip
praecsesmiep praecsesmipe praecsesmeip praecsesmepi praecsesmpei praecsesmpie praecseepsim praecseepsmi praecseepism
praecseepims praecseepmis praecseepmsi praecseespim praecseespmi praecseesipm praecseesimp praecseesmip praecseesmpi
praecseeispm praecseeismp praecseeipsm praecseeipms praecseeimps praecseeimsp praecseemsip praecseemspi praecseemisp
praecseemips praecseempis praecseempsi praecsempsei praecsempsie praecsempesi praecsempeis praecsempies praecsempise
praecsemspei praecsemspie praecsemsepi praecsemseip praecsemsiep praecsemsipe praecsemespi praecsemesip praecsemepsi
praecsemepis praecsemeips praecsemeisp praecsemisep praecsemispe praecsemiesp praecsemieps praecsemipes praecsemipse
praecssiepem praecssiepme praecssieepm praecssieemp praecssiemep praecssiempe praecssipeem praecssipeme praecssipeem
praecssipeme praecssipmee praecssipmee praecssiepem praecssiepme praecssieepm praecssieemp praecssiemep praecssiempe
praecssimpee praecssimpee praecssimepe praecssimeep praecssimeep praecssimepe praecsseipem praecsseipme praecsseiepm
praecsseiemp praecsseimep praecsseimpe praecssepiem praecssepime praecssepeim praecssepemi praecssepmei praecssepmie
praecsseepim praecsseepmi praecsseeipm praecsseeimp praecsseemip praecsseempi praecssempei praecssempie praecssemepi
praecssemeip praecssemiep praecssemipe praecsspeiem praecsspeime praecsspeeim praecsspeemi praecsspemei praecsspemie
praecsspieem praecsspieme praecsspieem praecsspieme praecsspimee praecsspimee praecsspeiem praecsspeime praecsspeeim
praecsspeemi praecsspemei praecsspemie praecsspmiee praecsspmiee praecsspmeie praecsspmeei praecsspmeei praecsspmeie
praecsseepim praecsseepmi praecsseeipm praecsseeimp praecsseemip praecsseempi praecssepeim praecssepemi praecssepiem
praecssepime praecssepmie praecssepmei praecsseipem praecsseipme praecsseiepm praecsseiemp praecsseimep praecsseimpe
praecssempie praecssempei praecssemipe praecssemiep praecssemeip praecssemepi praecssmepei praecssmepie praecssmeepi
praecssmeeip praecssmeiep praecssmeipe praecssmpeei praecssmpeie praecssmpeei praecssmpeie praecssmpiee praecssmpiee
praecssmepei praecssmepie praecssmeepi praecssmeeip praecssmeiep praecssmeipe praecssmipee praecssmipee praecssmiepe
praecssmieep praecssmieep praecssmiepe praecseiespm praecseiesmp praecseiepsm praecseiepms praecseiemps praecseiemsp
praecseisepm praecseisemp praecseispem praecseispme praecseismpe praecseismep praecseipsem praecseipsme praecseipesm
praecseipems praecseipmes praecseipmse praecseimspe praecseimsep praecseimpse praecseimpes praecseimeps praecseimesp
praecseeispm praecseeismp praecseeipsm praecseeipms praecseeimps praecseeimsp praecseesipm praecseesimp praecseespim
praecseespmi praecseesmpi praecseesmip praecseepsim praecseepsmi praecseepism praecseepims praecseepmis praecseepmsi
praecseemspi praecseemsip praecseempsi praecseempis praecseemips praecseemisp praecseseipm praecseseimp praecsesepim
praecsesepmi praecsesempi praecsesemip praecsesiepm praecsesiemp praecsesipem praecsesipme praecsesimpe praecsesimep
praecsespiem praecsespime praecsespeim praecsespemi praecsespmei praecsespmie praecsesmipe praecsesmiep praecsesmpie
praecsesmpei praecsesmepi praecsesmeip praecsepesim praecsepesmi praecsepeism praecsepeims praecsepemis praecsepemsi
praecsepseim praecsepsemi praecsepsiem praecsepsime praecsepsmie praecsepsmei praecsepisem praecsepisme praecsepiesm
praecsepiems praecsepimes praecsepimse praecsepmsie praecsepmsei praecsepmise praecsepmies praecsepmeis praecsepmesi
praecsemespi praecsemesip praecsemepsi praecsemepis praecsemeips praecsemeisp praecsemsepi praecsemseip praecsemspei
praecsemspie praecsemsipe praecsemsiep praecsempsei praecsempsie praecsempesi praecsempeis praecsempies praecsempise
praecsemispe praecsemisep praecsemipse praecsemipes praecsemieps praecsemiesp praecsmiesep praecsmiespe praecsmieesp
praecsmieeps praecsmiepes praecsmiepse praecsmiseep praecsmisepe praecsmiseep praecsmisepe praecsmispee praecsmispee
praecsmiesep praecsmiespe praecsmieesp praecsmieeps praecsmiepes praecsmiepse praecsmipsee praecsmipsee praecsmipese
praecsmipees praecsmipees praecsmipese praecsmeisep praecsmeispe praecsmeiesp praecsmeieps praecsmeipes praecsmeipse
praecsmesiep praecsmesipe praecsmeseip praecsmesepi praecsmespei praecsmespie praecsmeesip praecsmeespi praecsmeeisp
praecsmeeips praecsmeepis praecsmeepsi praecsmepsei praecsmepsie praecsmepesi praecsmepeis praecsmepies praecsmepise
praecsmseiep praecsmseipe praecsmseeip praecsmseepi praecsmsepei praecsmsepie praecsmsieep praecsmsiepe praecsmsieep
praecsmsiepe praecsmsipee praecsmsipee praecsmseiep praecsmseipe praecsmseeip praecsmseepi praecsmsepei praecsmsepie
praecsmspiee praecsmspiee praecsmspeie praecsmspeei praecsmspeei praecsmspeie praecsmeesip praecsmeespi praecsmeeisp
praecsmeeips praecsmeepis praecsmeepsi praecsmeseip praecsmesepi praecsmesiep praecsmesipe praecsmespie praecsmespei
praecsmeisep praecsmeispe praecsmeiesp praecsmeieps praecsmeipes praecsmeipse praecsmepsie praecsmepsei praecsmepise
praecsmepies praecsmepeis praecsmepesi praecsmpesei praecsmpesie praecsmpeesi praecsmpeeis praecsmpeies praecsmpeise
praecsmpseei praecsmpseie praecsmpseei praecsmpseie praecsmpsiee praecsmpsiee praecsmpesei praecsmpesie praecsmpeesi
praecsmpeeis praecsmpeies praecsmpeise praecsmpisee praecsmpisee praecsmpiese praecsmpiees praecsmpiees praecsmpiese
praecspiseem praecspiseme praecspiseem praecspiseme praecspismee praecspismee praecspiesem praecspiesme praecspieesm
praecspieems praecspiemes praecspiemse praecspieesm praecspieems praecspiesem praecspiesme praecspiemse praecspiemes
praecspimees praecspimese praecspimees praecspimese praecspimsee praecspimsee praecspsieem praecspsieme praecspsieem
praecspsieme praecspsimee praecspsimee praecspseiem praecspseime praecspseeim praecspseemi praecspsemei praecspsemie
praecspseeim praecspseemi praecspseiem praecspseime praecspsemie praecspsemei praecspsmeei praecspsmeie praecspsmeei
praecspsmeie praecspsmiee praecspsmiee praecspesiem praecspesime praecspeseim praecspesemi praecspesmei praecspesmie
praecspeisem praecspeisme praecspeiesm praecspeiems praecspeimes praecspeimse praecspeeism praecspeeims praecspeesim
praecspeesmi praecspeemsi praecspeemis praecspemies praecspemise praecspemeis praecspemesi praecspemsei praecspemsie
praecspeseim praecspesemi praecspesiem praecspesime praecspesmie praecspesmei praecspeesim praecspeesmi praecspeeism
praecspeeims praecspeemis praecspeemsi praecspeiesm praecspeiems praecspeisem praecspeisme praecspeimse praecspeimes
praecspemeis praecspemesi praecspemies praecspemise praecspemsie praecspemsei praecspmseei praecspmseie praecspmseei
praecspmseie praecspmsiee praecspmsiee praecspmesei praecspmesie praecspmeesi praecspmeeis praecspmeies praecspmeise
praecspmeesi praecspmeeis praecspmesei praecspmesie praecspmeise praecspmeies praecspmiees praecspmiese praecspmiees
praecspmiese praecspmisee praecspmisee praecsipseem praecsipseme praecsipseem praecsipseme praecsipsmee praecsipsmee
praecsipesem praecsipesme praecsipeesm praecsipeems praecsipemes praecsipemse praecsipeesm praecsipeems praecsipesem
praecsipesme praecsipemse praecsipemes praecsipmees praecsipmese praecsipmees praecsipmese praecsipmsee praecsipmsee
praecsispeem praecsispeme praecsispeem praecsispeme praecsispmee praecsispmee praecsisepem praecsisepme praecsiseepm
praecsiseemp praecsisemep praecsisempe praecsiseepm praecsiseemp praecsisepem praecsisepme praecsisempe praecsisemep
praecsismeep praecsismepe praecsismeep praecsismepe praecsismpee praecsismpee praecsiespem praecsiespme praecsiesepm
praecsiesemp praecsiesmep praecsiesmpe praecsiepsem praecsiepsme praecsiepesm praecsiepems praecsiepmes praecsiepmse
praecsieepsm praecsieepms praecsieespm praecsieesmp praecsieemsp praecsieemps praecsiempes praecsiempse praecsiemeps
praecsiemesp praecsiemsep praecsiemspe praecsiesepm praecsiesemp praecsiespem praecsiespme praecsiesmpe praecsiesmep
praecsieespm praecsieesmp praecsieepsm praecsieepms praecsieemps praecsieemsp praecsiepesm praecsiepems praecsiepsem
praecsiepsme praecsiepmse praecsiepmes praecsiemeps praecsiemesp praecsiempes praecsiempse praecsiemspe praecsiemsep
praecsimseep praecsimsepe praecsimseep praecsimsepe praecsimspee praecsimspee praecsimesep praecsimespe praecsimeesp
praecsimeeps praecsimepes praecsimepse praecsimeesp praecsimeeps praecsimesep praecsimespe praecsimepse praecsimepes
praecsimpees praecsimpese praecsimpees praecsimpese praecsimpsee praecsimpsee praecssipeem praecssipeme praecssipeem
praecssipeme praecssipmee praecssipmee praecssiepem praecssiepme praecssieepm praecssieemp praecssiemep praecssiempe
praecssieepm praecssieemp praecssiepem praecssiepme praecssiempe praecssiemep praecssimeep praecssimepe praecssimeep
praecssimepe praecssimpee praecssimpee praecsspieem praecsspieme praecsspieem praecsspieme praecsspimee praecsspimee
praecsspeiem praecsspeime praecsspeeim praecsspeemi praecsspemei praecsspemie praecsspeeim praecsspeemi praecsspeiem
praecsspeime praecsspemie praecsspemei praecsspmeei praecsspmeie praecsspmeei praecsspmeie praecsspmiee praecsspmiee
praecssepiem praecssepime praecssepeim praecssepemi praecssepmei praecssepmie praecsseipem praecsseipme praecsseiepm
praecsseiemp praecsseimep praecsseimpe praecsseeipm praecsseeimp praecsseepim praecsseepmi praecsseempi praecsseemip
praecssemiep praecssemipe praecssemeip praecssemepi praecssempei praecssempie praecssepeim praecssepemi praecssepiem
praecssepime praecssepmie praecssepmei praecsseepim praecsseepmi praecsseeipm praecsseeimp praecsseemip praecsseempi
praecsseiepm praecsseiemp praecsseipem praecsseipme praecsseimpe praecsseimep praecssemeip praecssemepi praecssemiep
praecssemipe praecssempie praecssempei praecssmpeei praecssmpeie praecssmpeei praecssmpeie praecssmpiee praecssmpiee
praecssmepei praecssmepie praecssmeepi praecssmeeip praecssmeiep praecssmeipe praecssmeepi praecssmeeip praecssmepei
praecssmepie praecssmeipe praecssmeiep praecssmieep praecssmiepe praecssmieep praecssmiepe praecssmipee praecssmipee
praecseispem praecseispme praecseisepm praecseisemp praecseismep praecseismpe praecseipsem praecseipsme praecseipesm
praecseipems praecseipmes praecseipmse praecseiepsm praecseiepms praecseiespm praecseiesmp praecseiemsp praecseiemps
praecseimpes praecseimpse praecseimeps praecseimesp praecseimsep praecseimspe praecsesipem praecsesipme praecsesiepm
praecsesiemp praecsesimep praecsesimpe praecsespiem praecsespime praecsespeim praecsespemi praecsespmei praecsespmie
praecsesepim praecsesepmi praecseseipm praecseseimp praecsesemip praecsesempi praecsesmpei praecsesmpie praecsesmepi
praecsesmeip praecsesmiep praecsesmipe praecsepsiem praecsepsime praecsepseim praecsepsemi praecsepsmei praecsepsmie
praecsepisem praecsepisme praecsepiesm praecsepiems praecsepimes praecsepimse praecsepeism praecsepeims praecsepesim
praecsepesmi praecsepemsi praecsepemis praecsepmies praecsepmise praecsepmeis praecsepmesi praecsepmsei praecsepmsie
praecseespim praecseespmi praecseesipm praecseesimp praecseesmip praecseesmpi praecseepsim praecseepsmi praecseepism
praecseepims praecseepmis praecseepmsi praecseeipsm praecseeipms praecseeispm praecseeismp praecseeimsp praecseeimps
praecseempis praecseempsi praecseemips praecseemisp praecseemsip praecseemspi praecsemspei praecsemspie praecsemsepi
praecsemseip praecsemsiep praecsemsipe praecsempsei praecsempsie praecsempesi praecsempeis praecsempies praecsempise
praecsemepsi praecsemepis praecsemespi praecsemesip praecsemeisp praecsemeips praecsemipes praecsemipse praecsemieps
praecsemiesp praecsemisep praecsemispe praecseisepm praecseisemp praecseispem praecseispme praecseismpe praecseismep
praecseiespm praecseiesmp praecseiepsm praecseiepms praecseiemps praecseiemsp praecseipesm praecseipems praecseipsem
praecseipsme praecseipmse praecseipmes praecseimeps praecseimesp praecseimpes praecseimpse praecseimspe praecseimsep
praecsesiepm praecsesiemp praecsesipem praecsesipme praecsesimpe praecsesimep praecseseipm praecseseimp praecsesepim
praecsesepmi praecsesempi praecsesemip praecsespeim praecsespemi praecsespiem praecsespime praecsespmie praecsespmei
praecsesmepi praecsesmeip praecsesmpei praecsesmpie praecsesmipe praecsesmiep praecseesipm praecseesimp praecseespim
praecseespmi praecseesmpi praecseesmip praecseeispm praecseeismp praecseeipsm praecseeipms praecseeimps praecseeimsp
praecseepism praecseepims praecseepsim praecseepsmi praecseepmsi praecseepmis praecseemips praecseemisp praecseempis
praecseempsi praecseemspi praecseemsip praecsepseim praecsepsemi praecsepsiem praecsepsime praecsepsmie praecsepsmei
praecsepesim praecsepesmi praecsepeism praecsepeims praecsepemis praecsepemsi praecsepiesm praecsepiems praecsepisem
praecsepisme praecsepimse praecsepimes praecsepmeis praecsepmesi praecsepmies praecsepmise praecsepmsie praecsepmsei
praecsemsepi praecsemseip praecsemspei praecsemspie praecsemsipe praecsemsiep praecsemespi praecsemesip praecsemepsi
praecsemepis praecsemeips praecsemeisp praecsempesi praecsempeis praecsempsei praecsempsie praecsempise praecsempies
praecsemieps praecsemiesp praecsemipes praecsemipse praecsemispe praecsemisep praecsmiseep praecsmisepe praecsmiseep
praecsmisepe praecsmispee praecsmispee praecsmiesep praecsmiespe praecsmieesp praecsmieeps praecsmiepes praecsmiepse
praecsmieesp praecsmieeps praecsmiesep praecsmiespe praecsmiepse praecsmiepes praecsmipees praecsmipese praecsmipees
praecsmipese praecsmipsee praecsmipsee praecsmsieep praecsmsiepe praecsmsieep praecsmsiepe praecsmsipee praecsmsipee
praecsmseiep praecsmseipe praecsmseeip praecsmseepi praecsmsepei praecsmsepie praecsmseeip praecsmseepi praecsmseiep
praecsmseipe praecsmsepie praecsmsepei praecsmspeei praecsmspeie praecsmspeei praecsmspeie praecsmspiee praecsmspiee
praecsmesiep praecsmesipe praecsmeseip praecsmesepi praecsmespei praecsmespie praecsmeisep praecsmeispe praecsmeiesp
praecsmeieps praecsmeipes praecsmeipse praecsmeeisp praecsmeeips praecsmeesip praecsmeespi praecsmeepsi praecsmeepis
praecsmepies praecsmepise praecsmepeis praecsmepesi praecsmepsei praecsmepsie praecsmeseip praecsmesepi praecsmesiep
praecsmesipe praecsmespie praecsmespei praecsmeesip praecsmeespi praecsmeeisp praecsmeeips praecsmeepis praecsmeepsi
praecsmeiesp praecsmeieps praecsmeisep praecsmeispe praecsmeipse praecsmeipes praecsmepeis praecsmepesi praecsmepies
praecsmepise praecsmepsie praecsmepsei praecsmpseei praecsmpseie praecsmpseei praecsmpseie praecsmpsiee praecsmpsiee
praecsmpesei praecsmpesie praecsmpeesi praecsmpeeis praecsmpeies praecsmpeise praecsmpeesi praecsmpeeis praecsmpesei
praecsmpesie praecsmpeise praecsmpeies praecsmpiees praecsmpiese praecsmpiees praecsmpiese praecsmpisee praecsmpisee
praecepissem praecepissme praecepisesm praecepisems praecepismes praecepismse praecepissem praecepissme praecepisesm
praecepisems praecepismes praecepismse praecepiessm praecepiesms praecepiessm praecepiesms praecepiemss praecepiemss
praecepimses praecepimsse praecepimess praecepimess praecepimses praecepimsse praecepsisem praecepsisme praecepsiesm
praecepsiems praecepsimes praecepsimse praecepssiem praecepssime praecepsseim praecepssemi praecepssmei praecepssmie
praecepsesim praecepsesmi praecepseism praecepseims praecepsemis praecepsemsi praecepsmsei praecepsmsie praecepsmesi
praecepsmeis praecepsmies praecepsmise praecepssiem praecepssime praecepsseim praecepssemi praecepssmei praecepssmie
praecepsisem praecepsisme praecepsiesm praecepsiems praecepsimes praecepsimse praecepseism praecepseims praecepsesim
praecepsesmi praecepsemsi praecepsemis praecepsmies praecepsmise praecepsmeis praecepsmesi praecepsmsei praecepsmsie
praecepessim praecepessmi praecepesism praecepesims praecepesmis praecepesmsi praecepessim praecepessmi praecepesism
praecepesims praecepesmis praecepesmsi praecepeissm praecepeisms praecepeissm praecepeisms praecepeimss praecepeimss
praecepemsis praecepemssi praecepemiss praecepemiss praecepemsis praecepemssi praecepmssei praecepmssie praecepmsesi
praecepmseis praecepmsies praecepmsise praecepmssei praecepmssie praecepmsesi praecepmseis praecepmsies praecepmsise
praecepmessi praecepmesis praecepmessi praecepmesis praecepmeiss praecepmeiss praecepmises praecepmisse praecepmiess
praecepmiess praecepmises praecepmisse praeceipssem praeceipssme praeceipsesm praeceipsems praeceipsmes praeceipsmse
praeceipssem praeceipssme praeceipsesm praeceipsems praeceipsmes praeceipsmse praeceipessm praeceipesms praeceipessm
praeceipesms praeceipemss praeceipemss praeceipmses praeceipmsse praeceipmess praeceipmess praeceipmses praeceipmsse
praeceispsem praeceispsme praeceispesm praeceispems praeceispmes praeceispmse praeceisspem praeceisspme praeceissepm
praeceissemp praeceissmep praeceissmpe praeceisespm praeceisesmp praeceisepsm praeceisepms praeceisemps praeceisemsp
praeceismsep praeceismspe praeceismesp praeceismeps praeceismpes praeceismpse praeceisspem praeceisspme praeceissepm
praeceissemp praeceissmep praeceissmpe praeceispsem praeceispsme praeceispesm praeceispems praeceispmes praeceispmse
praeceisepsm praeceisepms praeceisespm praeceisesmp praeceisemsp praeceisemps praeceismpes praeceismpse praeceismeps
praeceismesp praeceismsep praeceismspe praeceiesspm praeceiessmp praeceiespsm praeceiespms praeceiesmps praeceiesmsp
praeceiesspm praeceiessmp praeceiespsm praeceiespms praeceiesmps praeceiesmsp praeceiepssm praeceiepsms praeceiepssm
praeceiepsms praeceiepmss praeceiepmss praeceiemsps praeceiemssp praeceiempss praeceiempss praeceiemsps praeceiemssp
praeceimssep praeceimsspe praeceimsesp praeceimseps praeceimspes praeceimspse praeceimssep praeceimsspe praeceimsesp
praeceimseps praeceimspes praeceimspse praeceimessp praeceimesps praeceimessp praeceimesps praeceimepss praeceimepss
praeceimpses praeceimpsse praeceimpess praeceimpess praeceimpses praeceimpsse praecesipsem praecesipsme praecesipesm
praecesipems praecesipmes praecesipmse praecesispem praecesispme praecesisepm praecesisemp praecesismep praecesismpe
praecesiespm praecesiesmp praecesiepsm praecesiepms praecesiemps praecesiemsp praecesimsep praecesimspe praecesimesp
praecesimeps praecesimpes praecesimpse praecespisem praecespisme praecespiesm praecespiems praecespimes praecespimse
praecespsiem praecespsime praecespseim praecespsemi praecespsmei praecespsmie praecespesim praecespesmi praecespeism
praecespeims praecespemis praecespemsi praecespmsei praecespmsie praecespmesi praecespmeis praecespmies praecespmise
praecesspiem praecesspime praecesspeim praecesspemi praecesspmei praecesspmie praecessipem praecessipme praecessiepm
praecessiemp praecessimep praecessimpe praecesseipm praecesseimp praecessepim praecessepmi praecessempi praecessemip
praecessmiep praecessmipe praecessmeip praecessmepi praecessmpei praecessmpie praecesepsim praecesepsmi praecesepism
praecesepims praecesepmis praecesepmsi praecesespim praecesespmi praecesesipm praecesesimp praecesesmip praecesesmpi
praeceseispm praeceseismp praeceseipsm praeceseipms praeceseimps praeceseimsp praecesemsip praecesemspi praecesemisp
praecesemips praecesempis praecesempsi praecesmpsei praecesmpsie praecesmpesi praecesmpeis praecesmpies praecesmpise
praecesmspei praecesmspie praecesmsepi praecesmseip praecesmsiep praecesmsipe praecesmespi praecesmesip praecesmepsi
praecesmepis praecesmeips praecesmeisp praecesmisep praecesmispe praecesmiesp praecesmieps praecesmipes praecesmipse
praecesispem praecesispme praecesisepm praecesisemp praecesismep praecesismpe praecesipsem praecesipsme praecesipesm
praecesipems praecesipmes praecesipmse praecesiepsm praecesiepms praecesiespm praecesiesmp praecesiemsp praecesiemps
praecesimpes praecesimpse praecesimeps praecesimesp praecesimsep praecesimspe praecessipem praecessipme praecessiepm
praecessiemp praecessimep praecessimpe praecesspiem praecesspime praecesspeim praecesspemi praecesspmei praecesspmie
praecessepim praecessepmi praecesseipm praecesseimp praecessemip praecessempi praecessmpei praecessmpie praecessmepi
praecessmeip praecessmiep praecessmipe praecespsiem praecespsime praecespseim praecespsemi praecespsmei praecespsmie
praecespisem praecespisme praecespiesm praecespiems praecespimes praecespimse praecespeism praecespeims praecespesim
praecespesmi praecespemsi praecespemis praecespmies praecespmise praecespmeis praecespmesi praecespmsei praecespmsie
praecesespim praecesespmi praecesesipm praecesesimp praecesesmip praecesesmpi praecesepsim praecesepsmi praecesepism
praecesepims praecesepmis praecesepmsi praeceseipsm praeceseipms praeceseispm praeceseismp praeceseimsp praeceseimps
praecesempis praecesempsi praecesemips praecesemisp praecesemsip praecesemspi praecesmspei praecesmspie praecesmsepi
praecesmseip praecesmsiep praecesmsipe praecesmpsei praecesmpsie praecesmpesi praecesmpeis praecesmpies praecesmpise
praecesmepsi praecesmepis praecesmespi praecesmesip praecesmeisp praecesmeips praecesmipes praecesmipse praecesmieps
praecesmiesp praecesmisep praecesmispe praeceeisspm praeceeissmp praeceeispsm praeceeispms praeceeismps praeceeismsp
praeceeisspm praeceeissmp praeceeispsm praeceeispms praeceeismps praeceeismsp praeceeipssm praeceeipsms praeceeipssm
praeceeipsms praeceeipmss praeceeipmss praeceeimsps praeceeimssp praeceeimpss praeceeimpss praeceeimsps praeceeimssp
praeceesispm praeceesismp praeceesipsm praeceesipms praeceesimps praeceesimsp praeceessipm praeceessimp praeceesspim
praeceesspmi praeceessmpi praeceessmip praeceespsim praeceespsmi praeceespism praeceespims praeceespmis praeceespmsi
praeceesmspi praeceesmsip praeceesmpsi praeceesmpis praeceesmips praeceesmisp praeceessipm praeceessimp praeceesspim
praeceesspmi praeceessmpi praeceessmip praeceesispm praeceesismp praeceesipsm praeceesipms praeceesimps praeceesimsp
praeceespism praeceespims praeceespsim praeceespsmi praeceespmsi praeceespmis praeceesmips praeceesmisp praeceesmpis
praeceesmpsi praeceesmspi praeceesmsip praeceepssim praeceepssmi praeceepsism praeceepsims praeceepsmis praeceepsmsi
praeceepssim praeceepssmi praeceepsism praeceepsims praeceepsmis praeceepsmsi praeceepissm praeceepisms praeceepissm
praeceepisms praeceepimss praeceepimss praeceepmsis praeceepmssi praeceepmiss praeceepmiss praeceepmsis praeceepmssi
praeceemsspi praeceemssip praeceemspsi praeceemspis praeceemsips praeceemsisp praeceemsspi praeceemssip praeceemspsi
praeceemspis praeceemsips praeceemsisp praeceempssi praeceempsis praeceempssi praeceempsis praeceempiss praeceempiss
praeceemisps praeceemissp praeceemipss praeceemipss praeceemisps praeceemissp praecemissep praecemisspe praecemisesp
praecemiseps praecemispes praecemispse praecemissep praecemisspe praecemisesp praecemiseps praecemispes praecemispse
praecemiessp praecemiesps praecemiessp praecemiesps praecemiepss praecemiepss praecemipses praecemipsse praecemipess
praecemipess praecemipses praecemipsse praecemsisep praecemsispe praecemsiesp praecemsieps praecemsipes praecemsipse
praecemssiep praecemssipe praecemsseip praecemssepi praecemsspei praecemsspie praecemsesip praecemsespi praecemseisp
praecemseips praecemsepis praecemsepsi praecemspsei praecemspsie praecemspesi praecemspeis praecemspies praecemspise
praecemssiep praecemssipe praecemsseip praecemssepi praecemsspei praecemsspie praecemsisep praecemsispe praecemsiesp
praecemsieps praecemsipes praecemsipse praecemseisp praecemseips praecemsesip praecemsespi praecemsepsi praecemsepis
praecemspies praecemspise praecemspeis praecemspesi praecemspsei praecemspsie praecemessip praecemesspi praecemesisp
praecemesips praecemespis praecemespsi praecemessip praecemesspi praecemesisp praecemesips praecemespis praecemespsi
praecemeissp praecemeisps praecemeissp praecemeisps praecemeipss praecemeipss praecemepsis praecemepssi praecemepiss
praecemepiss praecemepsis praecemepssi praecempssei praecempssie praecempsesi praecempseis praecempsies praecempsise
praecempssei praecempssie praecempsesi praecempseis praecempsies praecempsise praecempessi praecempesis praecempessi
praecempesis praecempeiss praecempeiss praecempises praecempisse praecempiess praecempiess praecempises praecempisse
praecmpissee praecmpissee praecmpisese praecmpisees praecmpisees praecmpisese praecmpissee praecmpissee praecmpisese
praecmpisees praecmpisees praecmpisese praecmpiesse praecmpieses praecmpiesse praecmpieses praecmpieess praecmpieess
praecmpieses praecmpiesse praecmpieess praecmpieess praecmpieses praecmpiesse praecmpsisee praecmpsisee praecmpsiese
praecmpsiees praecmpsiees praecmpsiese praecmpssiee praecmpssiee praecmpsseie praecmpsseei praecmpsseei praecmpsseie
praecmpsesie praecmpsesei praecmpseise praecmpseies praecmpseeis praecmpseesi praecmpsesei praecmpsesie praecmpseesi
praecmpseeis praecmpseies praecmpseise praecmpssiee praecmpssiee praecmpsseie praecmpsseei praecmpsseei praecmpsseie
praecmpsisee praecmpsisee praecmpsiese praecmpsiees praecmpsiees praecmpsiese praecmpseise praecmpseies praecmpsesie
praecmpsesei praecmpseesi praecmpseeis praecmpseies praecmpseise praecmpseeis praecmpseesi praecmpsesei praecmpsesie
praecmpessie praecmpessei praecmpesise praecmpesies praecmpeseis praecmpesesi praecmpessie praecmpessei praecmpesise
praecmpesies praecmpeseis praecmpesesi praecmpeisse praecmpeises praecmpeisse praecmpeises praecmpeiess praecmpeiess
praecmpeesis praecmpeessi praecmpeeiss praecmpeeiss praecmpeesis praecmpeessi praecmpessei praecmpessie praecmpesesi
praecmpeseis praecmpesies praecmpesise praecmpessei praecmpessie praecmpesesi praecmpeseis praecmpesies praecmpesise
praecmpeessi praecmpeesis praecmpeessi praecmpeesis praecmpeeiss praecmpeeiss praecmpeises praecmpeisse praecmpeiess
praecmpeiess praecmpeises praecmpeisse praecmipssee praecmipssee praecmipsese praecmipsees praecmipsees praecmipsese
praecmipssee praecmipssee praecmipsese praecmipsees praecmipsees praecmipsese praecmipesse praecmipeses praecmipesse
praecmipeses praecmipeess praecmipeess praecmipeses praecmipesse praecmipeess praecmipeess praecmipeses praecmipesse
praecmispsee praecmispsee praecmispese praecmispees praecmispees praecmispese praecmisspee praecmisspee praecmissepe
praecmisseep praecmisseep praecmissepe praecmisespe praecmisesep praecmisepse praecmisepes praecmiseeps praecmiseesp
praecmisesep praecmisespe praecmiseesp praecmiseeps praecmisepes praecmisepse praecmisspee praecmisspee praecmissepe
praecmisseep praecmisseep praecmissepe praecmispsee praecmispsee praecmispese praecmispees praecmispees praecmispese
praecmisepse praecmisepes praecmisespe praecmisesep praecmiseesp praecmiseeps praecmisepes praecmisepse praecmiseeps
praecmiseesp praecmisesep praecmisespe praecmiesspe praecmiessep praecmiespse praecmiespes praecmieseps praecmiesesp
praecmiesspe praecmiessep praecmiespse praecmiespes praecmieseps praecmiesesp praecmiepsse praecmiepses praecmiepsse
praecmiepses praecmiepess praecmiepess praecmieesps praecmieessp praecmieepss praecmieepss praecmieesps praecmieessp
praecmiessep praecmiesspe praecmiesesp praecmieseps praecmiespes praecmiespse praecmiessep praecmiesspe praecmiesesp
praecmieseps praecmiespes praecmiespse praecmieessp praecmieesps praecmieessp praecmieesps praecmieepss praecmieepss
praecmiepses praecmiepsse praecmiepess praecmiepess praecmiepses praecmiepsse praecmsipsee praecmsipsee praecmsipese
praecmsipees praecmsipees praecmsipese praecmsispee praecmsispee praecmsisepe praecmsiseep praecmsiseep praecmsisepe
praecmsiespe praecmsiesep praecmsiepse praecmsiepes praecmsieeps praecmsieesp praecmsiesep praecmsiespe praecmsieesp
praecmsieeps praecmsiepes praecmsiepse praecmspisee praecmspisee praecmspiese praecmspiees praecmspiees praecmspiese
praecmspsiee praecmspsiee praecmspseie praecmspseei praecmspseei praecmspseie praecmspesie praecmspesei praecmspeise
praecmspeies praecmspeeis praecmspeesi praecmspesei praecmspesie praecmspeesi praecmspeeis praecmspeies praecmspeise
praecmsspiee praecmsspiee praecmsspeie praecmsspeei praecmsspeei praecmsspeie praecmssipee praecmssipee praecmssiepe
praecmssieep praecmssieep praecmssiepe praecmsseipe praecmsseiep praecmssepie praecmssepei praecmsseepi praecmsseeip
praecmsseiep praecmsseipe praecmsseeip praecmsseepi praecmssepei praecmssepie praecmsepsie praecmsepsei praecmsepise
praecmsepies praecmsepeis praecmsepesi praecmsespie praecmsespei praecmsesipe praecmsesiep praecmseseip praecmsesepi
praecmseispe praecmseisep praecmseipse praecmseipes praecmseieps praecmseiesp praecmseesip praecmseespi praecmseeisp
praecmseeips praecmseepis praecmseepsi praecmsepsei praecmsepsie praecmsepesi praecmsepeis praecmsepies praecmsepise
praecmsespei praecmsespie praecmsesepi praecmseseip praecmsesiep praecmsesipe praecmseespi praecmseesip praecmseepsi
praecmseepis praecmseeips praecmseeisp praecmseisep praecmseispe praecmseiesp praecmseieps praecmseipes praecmseipse
praecmsispee praecmsispee praecmsisepe praecmsiseep praecmsiseep praecmsisepe praecmsipsee praecmsipsee praecmsipese
praecmsipees praecmsipees praecmsipese praecmsiepse praecmsiepes praecmsiespe praecmsiesep praecmsieesp praecmsieeps
praecmsiepes praecmsiepse praecmsieeps praecmsieesp praecmsiesep praecmsiespe praecmssipee praecmssipee praecmssiepe
praecmssieep praecmssieep praecmssiepe praecmsspiee praecmsspiee praecmsspeie praecmsspeei praecmsspeei praecmsspeie
praecmssepie praecmssepei praecmsseipe praecmsseiep praecmsseeip praecmsseepi praecmssepei praecmssepie praecmsseepi
praecmsseeip praecmsseiep praecmsseipe praecmspsiee praecmspsiee praecmspseie praecmspseei praecmspseei praecmspseie
praecmspisee praecmspisee praecmspiese praecmspiees praecmspiees praecmspiese praecmspeise praecmspeies praecmspesie
praecmspesei praecmspeesi praecmspeeis praecmspeies praecmspeise praecmspeeis praecmspeesi praecmspesei praecmspesie
praecmsespie praecmsespei praecmsesipe praecmsesiep praecmseseip praecmsesepi praecmsepsie praecmsepsei praecmsepise
praecmsepies praecmsepeis praecmsepesi praecmseipse praecmseipes praecmseispe praecmseisep praecmseiesp praecmseieps
praecmseepis praecmseepsi praecmseeips praecmseeisp praecmseesip praecmseespi praecmsespei praecmsespie praecmsesepi
praecmseseip praecmsesiep praecmsesipe praecmsepsei praecmsepsie praecmsepesi praecmsepeis praecmsepies praecmsepise
praecmseepsi praecmseepis praecmseespi praecmseesip praecmseeisp praecmseeips praecmseipes praecmseipse praecmseieps
praecmseiesp praecmseisep praecmseispe praecmeisspe praecmeissep praecmeispse praecmeispes praecmeiseps praecmeisesp
praecmeisspe praecmeissep praecmeispse praecmeispes praecmeiseps praecmeisesp praecmeipsse praecmeipses praecmeipsse
praecmeipses praecmeipess praecmeipess praecmeiesps praecmeiessp praecmeiepss praecmeiepss praecmeiesps praecmeiessp
praecmesispe praecmesisep praecmesipse praecmesipes praecmesieps praecmesiesp praecmessipe praecmessiep praecmesspie
praecmesspei praecmessepi praecmesseip praecmespsie praecmespsei praecmespise praecmespies praecmespeis praecmespesi
praecmesespi praecmesesip praecmesepsi praecmesepis praecmeseips praecmeseisp praecmessipe praecmessiep praecmesspie
praecmesspei praecmessepi praecmesseip praecmesispe praecmesisep praecmesipse praecmesipes praecmesieps praecmesiesp
praecmespise praecmespies praecmespsie praecmespsei praecmespesi praecmespeis praecmeseips praecmeseisp praecmesepis
praecmesepsi praecmesespi praecmesesip praecmepssie praecmepssei praecmepsise praecmepsies praecmepseis praecmepsesi
praecmepssie praecmepssei praecmepsise praecmepsies praecmepseis praecmepsesi praecmepisse praecmepises praecmepisse
praecmepises praecmepiess praecmepiess praecmepesis praecmepessi praecmepeiss praecmepeiss praecmepesis praecmepessi
praecmeesspi praecmeessip praecmeespsi praecmeespis praecmeesips praecmeesisp praecmeesspi praecmeessip praecmeespsi
praecmeespis praecmeesips praecmeesisp praecmeepssi praecmeepsis praecmeepssi praecmeepsis praecmeepiss praecmeepiss
praecmeeisps praecmeeissp praecmeeipss praecmeeipss praecmeeisps praecmeeissp praecmeissep praecmeisspe praecmeisesp
praecmeiseps praecmeispes praecmeispse praecmeissep praecmeisspe praecmeisesp praecmeiseps praecmeispes praecmeispse
praecmeiessp praecmeiesps praecmeiessp praecmeiesps praecmeiepss praecmeiepss praecmeipses praecmeipsse praecmeipess
praecmeipess praecmeipses praecmeipsse praecmesisep praecmesispe praecmesiesp praecmesieps praecmesipes praecmesipse
praecmessiep praecmessipe praecmesseip praecmessepi praecmesspei praecmesspie praecmesesip praecmesespi praecmeseisp
praecmeseips praecmesepis praecmesepsi praecmespsei praecmespsie praecmespesi praecmespeis praecmespies praecmespise
praecmessiep praecmessipe praecmesseip praecmessepi praecmesspei praecmesspie praecmesisep praecmesispe praecmesiesp
praecmesieps praecmesipes praecmesipse praecmeseisp praecmeseips praecmesesip praecmesespi praecmesepsi praecmesepis
praecmespies praecmespise praecmespeis praecmespesi praecmespsei praecmespsie praecmeessip praecmeesspi praecmeesisp
praecmeesips praecmeespis praecmeespsi praecmeessip praecmeesspi praecmeesisp praecmeesips praecmeespis praecmeespsi
praecmeeissp praecmeeisps praecmeeissp praecmeeisps praecmeeipss praecmeeipss praecmeepsis praecmeepssi praecmeepiss
praecmeepiss praecmeepsis praecmeepssi praecmepssei praecmepssie praecmepsesi praecmepseis praecmepsies praecmepsise
praecmepssei praecmepssie praecmepsesi praecmepseis praecmepsies praecmepsise praecmepessi praecmepesis praecmepessi
praecmepesis praecmepeiss praecmepeiss praecmepises praecmepisse praecmepiess praecmepiess praecmepises praecmepisse

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us