easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

stereochromy

pokunt

tartar

interspecies

duffer

ithacae

chiarella

undulous

cyanogenes

recalculation

dicavimusque

decipherability

crampet

blueflag

frogmen

coeptae

auguin

ipock


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: potuimusque
cipher variations:
qpuvjnvtrvf rqvwkowuswg srwxlpxvtxh tsxymqywuyi utyznrzxvzj
vuzaosaywak wvabptbzxbl xwbcqucaycm yxcdrvdbzdn zydeswecaeo
azeftxfdbfp bafguygecgq cbghvzhfdhr dchiwaigeis edijxbjhfjt
fejkyckigku gfklzdljhlv hglmaemkimw ihmnbfnljnx jinocgomkoy
kjopdhpnlpz lkpqeiqomqa mlqrfjrpnrb nmrsgksqosc onsthltrptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: potuimusque
Cipher: klgfrnfhjfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: potuimusque
Cipher: ABBBA ABBAB BAABA BAABB ABAAA ABABB BAABB BAAAB ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: potuimusque
cipher variations:
qpuvjnvtrvfurgjzljdxjnytsxpjxndxvcvelfhlxjldgxqzvfzhpzlkzcnldnrvntsdaprzplhpjwfmdhxdvndr
ahyrxvrftrzejkfntfpzfhilwtdrtzftpmnihtphjlhxrqvwkowuswgvshkamkeykozutyqkyoeywdwfmgimykme
hyrawgaiqamladomeoswoutebqsaqmiqkxgneiyewoesbizsywsgusafklgougqagijmxuesuaguqnojiuqikmiy
srwxlpxvtxhwtilbnlfzlpavuzrlzpfzxexgnhjnzlnfizsbxhbjrbnmbepnfptxpvufcrtbrnjrlyhofjzfxpft
cjatzxthvtbglmhpvhrbhjknyvftvbhvropkjvrjlnjztsxymqywuyixujmcomgamqbwvasmaqgayfyhoikoamog
jatcyicksconcfqogquyqwvgdsucsoksmzipgkagyqgudkbuayuiwuchmniqwisciklozwguwciwspqlkwskmoka
utyznrzxvzjyvkndpnhbnrcxwbtnbrhbzgzipjlpbnphkbudzjdltdpodgrphrvzrxwhetvdtpltnajqhlbhzrhv
elcvbzvjxvdinojrxjtdjlmpaxhvxdjxtqrmlxtlnplbvuzaosaywakzwloeqoicosdyxcuocsicahajqkmqcoqi
lcveakemueqpehsqiswasyxifuweuqmuobkrimciasiwfmdwcawkywejopksykuekmnqbyiwyekyursnmyumoqmc
wvabptbzxblaxmpfrpjdptezydvpdtjdbibkrlnrdprjmdwfblfnvfrqfitrjtxbtzyjgvxfvrnvpclsjndjbtjx
gnexdbxlzxfkpqltzlvflnorczjxzflzvstonzvnprndxwbcqucaycmbynqgsqkequfazewqeukecjclsmoseqsk
nexgcmgowgsrgjuskuycuazkhwygwsowqdmtkoekcukyhofyecymayglqrmuamwgmopsdakyagmawtupoawoqsoe
yxcdrvdbzdnczorhtrlfrvgbafxrfvlfdkdmtnptfrtlofyhdnhpxhtshkvtlvzdvbalixzhxtpxrenulpfldvlz
ipgzfdznbzhmrsnvbnxhnpqteblzbhnbxuvqpbxprtpfzydeswecaeodapsiusmgswhcbgysgwmgelenuoqugsum
pgzieoiqyiutilwumwaewcbmjyaiyuqysfovmqgmewmajqhageaocainstowcoyioqrufcmaciocyvwrqcyqsuqg
azeftxfdbfpebqtjvtnhtxidchzthxnhfmfovprvhtvnqhajfpjrzjvujmxvnxbfxdcnkzbjzvrztgpwnrhnfxnb
kribhfbpdbjotupxdpzjprsvgdnbdjpdzwxsrdzrtvrhbafguygecgqfcrukwuoiuyjediauiyoigngpwqswiuwo
ribkgqksakwvknywoycgyedolackawsauhqxosiogyoclsjcigcqeckpuvqyeqakqstwheocekqeaxytseasuwsi
cbghvzhfdhrgdsvlxvpjvzkfejbvjzpjhohqxrtxjvxpsjclhrltblxwlozxpzdhzfepmbdlbxtbviryptjphzpd
mtkdjhdrfdlqvwrzfrblrtuxifpdflrfbyzutfbtvxtjdchiwaigeishetwmywqkwalgfkcwkaqkipirysuykwyq
tkdmismucmyxmpayqaeiagfqncemcyucwjszqukqiaqenulekiesgemrwxsagscmsuvyjgqegmsgczavugcuwyuk
edijxbjhfjtifuxnzxrlxbmhgldxlbrljqjsztvzlxzrulenjtnvdnzynqbzrbfjbhgrodfndzvdxktarvlrjbrf
ovmfljfthfnsxytbhtdntvwzkhrfhnthdabwvhdvxzvlfejkyckigkujgvyoaysmycnihmeymcsmkrktauwamyas
vmfokuoweoazorcascgkcihspegoeaweylubswmskcsgpwngmkguigotyzuciueouwxalisgiouiebcxwiewyawm
gfklzdljhlvkhwzpbztnzdojinfzndtnlslubvxbnzbtwngplvpxfpbapsdbtdhldjitqfhpfbxfzmvctxntldth
qxohnlhvjhpuzavdjvfpvxybmjthjpvjfcdyxjfxzbxnhglmaemkimwlixaqcauoaepkjogaoeuomtmvcwycoacu
xohqmwqygqcbqtecueimekjurgiqgcyganwduyoumeuirypiomiwkiqvabwekwgqwyzcnkuikqwkgdezykgyacyo
ihmnbfnljnxmjybrdbvpbfqlkphbpfvpnunwdxzdpbdvypirnxrzhrdcrufdvfjnflkvshjrhdzhboxevzpvnfvj
szqjpnjxljrwbcxflxhrxzadolvjlrxlhefazlhzbdzpjinocgomkoynkzcsecwqcgrmlqicqgwqovoxeyaeqcew
zqjsoysaisedsvgewgkogmlwtiksieaicpyfwaqwogwktarkqokymksxcdygmyisyabepmwkmsymifgbamiaceaq
kjopdhpnlpzoladtfdxrdhsnmrjdrhxrpwpyfzbfrdfxarktpztbjtfetwhfxhlphnmxujltjfbjdqzgxbrxphxl
ubslrplznltydezhnzjtzbcfqnxlntznjghcbnjbdfbrlkpqeiqomqapmbeugeyseitonskesiysqxqzgacgsegy
bsluqauckugfuxigyimqionyvkmukgckerahycsyqiymvctmsqmaomuzefaioakuacdgroymouaokhidcokcegcs
mlqrfjrpnrbqncfvhfztfjupotlftjztryrahbdhtfhzctmvrbvdlvhgvyjhzjnrjpozwlnvlhdlfsbizdtzrjzn
wduntrnbpnvafgbjpblvbdehspznpvbplijedpldfhdtnmrsgksqoscrodgwigaugkvqpumgukauszsbiceiugia
dunwscwemwihwzkiakoskqpaxmowmiemgtcjaeuaskaoxevousocqowbghckqcmwcefitqaoqwcqmjkfeqmegieu
onsthltrptdspehxjhbvhlwrqvnhvlbvtatcjdfjvhjbevoxtdxfnxjixaljblptlrqbynpxnjfnhudkbfvbtlbp
yfwpvtpdrpxchidlrdnxdfgjurbprxdrnklgfrnfhjfvpotuimusquetqfiykicwimxsrwoiwmcwubudkegkwikc
fwpyueygoykjybmkcmqumsrczoqyokgoivelcgwcumcqzgxqwuqesqydijemseoyeghkvscqsyesolmhgsogikgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: potuimusque
Cipher: cbghvzhfdhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: potuimusque
Cipher: 5343445442235434145451

Extended Methods:
Method #1

Plaintext: potuimusque
method variations:
utyzorzxvzkzydetwecaepedikybkhfkukiopdgpnlpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
p o t u i m u s q u e 
5 4 4 5 4 2 5 3 1 5 5 
3 3 4 4 2 3 4 4 4 4 1 
They are then read out in rows:
5445425315533442344441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: potuimusque
Cipher: uyipvpsistd

Read more ...
Method #3

Plaintext: potuimusque
method variations:
ssytgxodyyv sytgxodyyvs ytgxodyyvss
tgxodyyvssy gxodyyvssyt xodyyvssytg
odyyvssytgx dyyvssytgxo yyvssytgxod
yvssytgxody vssytgxodyy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: potuimusque

first 5040 cipher variations(39615626 total)
potuimusque potuimusqeu potuimusuqe potuimusueq potuimuseuq potuimusequ potuimuqsue potuimuqseu potuimuquse potuimuques
potuimuqeus potuimuqesu potuimuuqse potuimuuqes potuimuusqe potuimuuseq potuimuuesq potuimuueqs potuimuequs potuimueqsu
potuimueuqs potuimueusq potuimuesuq potuimuesqu potuimsuque potuimsuqeu potuimsuuqe potuimsuueq potuimsueuq potuimsuequ
potuimsquue potuimsqueu potuimsquue potuimsqueu potuimsqeuu potuimsqeuu potuimsuque potuimsuqeu potuimsuuqe potuimsuueq
potuimsueuq potuimsuequ potuimsequu potuimsequu potuimseuqu potuimseuuq potuimseuuq potuimseuqu potuimqsuue potuimqsueu
potuimqsuue potuimqsueu potuimqseuu potuimqseuu potuimqusue potuimquseu potuimquuse potuimquues potuimqueus potuimquesu
potuimquuse potuimquues potuimqusue potuimquseu potuimquesu potuimqueus potuimqeuus potuimqeusu potuimqeuus potuimqeusu
potuimqesuu potuimqesuu potuimusque potuimusqeu potuimusuqe potuimusueq potuimuseuq potuimusequ potuimuqsue potuimuqseu
potuimuquse potuimuques potuimuqeus potuimuqesu potuimuuqse potuimuuqes potuimuusqe potuimuuseq potuimuuesq potuimuueqs
potuimuequs potuimueqsu potuimueuqs potuimueusq potuimuesuq potuimuesqu potuimesquu potuimesquu potuimesuqu potuimesuuq
potuimesuuq potuimesuqu potuimeqsuu potuimeqsuu potuimequsu potuimequus potuimequus potuimequsu potuimeuqsu potuimeuqus
potuimeusqu potuimeusuq potuimeuusq potuimeuuqs potuimeuqus potuimeuqsu potuimeuuqs potuimeuusq potuimeusuq potuimeusqu
potuiumsque potuiumsqeu potuiumsuqe potuiumsueq potuiumseuq potuiumsequ potuiumqsue potuiumqseu potuiumquse potuiumques
potuiumqeus potuiumqesu potuiumuqse potuiumuqes potuiumusqe potuiumuseq potuiumuesq potuiumueqs potuiumequs potuiumeqsu
potuiumeuqs potuiumeusq potuiumesuq potuiumesqu potuiusmque potuiusmqeu potuiusmuqe potuiusmueq potuiusmeuq potuiusmequ
potuiusqmue potuiusqmeu potuiusqume potuiusquem potuiusqeum potuiusqemu potuiusuqme potuiusuqem potuiusumqe potuiusumeq
potuiusuemq potuiusueqm potuiusequm potuiuseqmu potuiuseuqm potuiuseumq potuiusemuq potuiusemqu potuiuqsmue potuiuqsmeu
potuiuqsume potuiuqsuem potuiuqseum potuiuqsemu potuiuqmsue potuiuqmseu potuiuqmuse potuiuqmues potuiuqmeus potuiuqmesu
potuiuqumse potuiuqumes potuiuqusme potuiuqusem potuiuquesm potuiuquems potuiuqemus potuiuqemsu potuiuqeums potuiuqeusm
potuiuqesum potuiuqesmu potuiuusqme potuiuusqem potuiuusmqe potuiuusmeq potuiuusemq potuiuuseqm potuiuuqsme potuiuuqsem
potuiuuqmse potuiuuqmes potuiuuqems potuiuuqesm potuiuumqse potuiuumqes potuiuumsqe potuiuumseq potuiuumesq potuiuumeqs
potuiuueqms potuiuueqsm potuiuuemqs potuiuuemsq potuiuuesmq potuiuuesqm potuiuesqum potuiuesqmu potuiuesuqm potuiuesumq
potuiuesmuq potuiuesmqu potuiueqsum potuiueqsmu potuiuequsm potuiuequms potuiueqmus potuiueqmsu potuiueuqsm potuiueuqms
potuiueusqm potuiueusmq potuiueumsq potuiueumqs potuiuemqus potuiuemqsu potuiuemuqs potuiuemusq potuiuemsuq potuiuemsqu
potuisumque potuisumqeu potuisumuqe potuisumueq potuisumeuq potuisumequ potuisuqmue potuisuqmeu potuisuqume potuisuquem
potuisuqeum potuisuqemu potuisuuqme potuisuuqem potuisuumqe potuisuumeq potuisuuemq potuisuueqm potuisuequm potuisueqmu
potuisueuqm potuisueumq potuisuemuq potuisuemqu potuismuque potuismuqeu potuismuuqe potuismuueq potuismueuq potuismuequ
potuismquue potuismqueu potuismquue potuismqueu potuismqeuu potuismqeuu potuismuque potuismuqeu potuismuuqe potuismuueq
potuismueuq potuismuequ potuismequu potuismequu potuismeuqu potuismeuuq potuismeuuq potuismeuqu potuisqmuue potuisqmueu
potuisqmuue potuisqmueu potuisqmeuu potuisqmeuu potuisqumue potuisqumeu potuisquume potuisquuem potuisqueum potuisquemu
potuisquume potuisquuem potuisqumue potuisqumeu potuisquemu potuisqueum potuisqeuum potuisqeumu potuisqeuum potuisqeumu
potuisqemuu potuisqemuu potuisumque potuisumqeu potuisumuqe potuisumueq potuisumeuq potuisumequ potuisuqmue potuisuqmeu
potuisuqume potuisuquem potuisuqeum potuisuqemu potuisuuqme potuisuuqem potuisuumqe potuisuumeq potuisuuemq potuisuueqm
potuisuequm potuisueqmu potuisueuqm potuisueumq potuisuemuq potuisuemqu potuisemquu potuisemquu potuisemuqu potuisemuuq
potuisemuuq potuisemuqu potuiseqmuu potuiseqmuu potuisequmu potuisequum potuisequum potuisequmu potuiseuqmu potuiseuqum
potuiseumqu potuiseumuq potuiseuumq potuiseuuqm potuiseuqum potuiseuqmu potuiseuuqm potuiseuumq potuiseumuq potuiseumqu
potuiqusmue potuiqusmeu potuiqusume potuiqusuem potuiquseum potuiqusemu potuiqumsue potuiqumseu potuiqumuse potuiqumues
potuiqumeus potuiqumesu potuiquumse potuiquumes potuiquusme potuiquusem potuiquuesm potuiquuems potuiquemus potuiquemsu
potuiqueums potuiqueusm potuiquesum potuiquesmu potuiqsumue potuiqsumeu potuiqsuume potuiqsuuem potuiqsueum potuiqsuemu
potuiqsmuue potuiqsmueu potuiqsmuue potuiqsmueu potuiqsmeuu potuiqsmeuu potuiqsumue potuiqsumeu potuiqsuume potuiqsuuem
potuiqsueum potuiqsuemu potuiqsemuu potuiqsemuu potuiqseumu potuiqseuum potuiqseuum potuiqseumu potuiqmsuue potuiqmsueu
potuiqmsuue potuiqmsueu potuiqmseuu potuiqmseuu potuiqmusue potuiqmuseu potuiqmuuse potuiqmuues potuiqmueus potuiqmuesu
potuiqmuuse potuiqmuues potuiqmusue potuiqmuseu potuiqmuesu potuiqmueus potuiqmeuus potuiqmeusu potuiqmeuus potuiqmeusu
potuiqmesuu potuiqmesuu potuiqusmue potuiqusmeu potuiqusume potuiqusuem potuiquseum potuiqusemu potuiqumsue potuiqumseu
potuiqumuse potuiqumues potuiqumeus potuiqumesu potuiquumse potuiquumes potuiquusme potuiquusem potuiquuesm potuiquuems
potuiquemus potuiquemsu potuiqueums potuiqueusm potuiquesum potuiquesmu potuiqesmuu potuiqesmuu potuiqesumu potuiqesuum
potuiqesuum potuiqesumu potuiqemsuu potuiqemsuu potuiqemusu potuiqemuus potuiqemuus potuiqemusu potuiqeumsu potuiqeumus
potuiqeusmu potuiqeusum potuiqeuusm potuiqeuums potuiqeumus potuiqeumsu potuiqeuums potuiqeuusm potuiqeusum potuiqeusmu
potuiuusqme potuiuusqem potuiuusmqe potuiuusmeq potuiuusemq potuiuuseqm potuiuuqsme potuiuuqsem potuiuuqmse potuiuuqmes
potuiuuqems potuiuuqesm potuiuumqse potuiuumqes potuiuumsqe potuiuumseq potuiuumesq potuiuumeqs potuiuueqms potuiuueqsm
potuiuuemqs potuiuuemsq potuiuuesmq potuiuuesqm potuiusuqme potuiusuqem potuiusumqe potuiusumeq potuiusuemq potuiusueqm
potuiusqume potuiusquem potuiusqmue potuiusqmeu potuiusqemu potuiusqeum potuiusmque potuiusmqeu potuiusmuqe potuiusmueq
potuiusmeuq potuiusmequ potuiuseqmu potuiusequm potuiusemqu potuiusemuq potuiuseumq potuiuseuqm potuiuqsume potuiuqsuem
potuiuqsmue potuiuqsmeu potuiuqsemu potuiuqseum potuiuqusme potuiuqusem potuiuqumse potuiuqumes potuiuquems potuiuquesm
potuiuqmuse potuiuqmues potuiuqmsue potuiuqmseu potuiuqmesu potuiuqmeus potuiuqeums potuiuqeusm potuiuqemus potuiuqemsu
potuiuqesmu potuiuqesum potuiumsque potuiumsqeu potuiumsuqe potuiumsueq potuiumseuq potuiumsequ potuiumqsue potuiumqseu
potuiumquse potuiumques potuiumqeus potuiumqesu potuiumuqse potuiumuqes potuiumusqe potuiumuseq potuiumuesq potuiumueqs
potuiumequs potuiumeqsu potuiumeuqs potuiumeusq potuiumesuq potuiumesqu potuiuesqmu potuiuesqum potuiuesmqu potuiuesmuq
potuiuesumq potuiuesuqm potuiueqsmu potuiueqsum potuiueqmsu potuiueqmus potuiuequms potuiuequsm potuiuemqsu potuiuemqus
potuiuemsqu potuiuemsuq potuiuemusq potuiuemuqs potuiueuqms potuiueuqsm potuiueumqs potuiueumsq potuiueusmq potuiueusqm
potuieusqum potuieusqmu potuieusuqm potuieusumq potuieusmuq potuieusmqu potuieuqsum potuieuqsmu potuieuqusm potuieuqums
potuieuqmus potuieuqmsu potuieuuqsm potuieuuqms potuieuusqm potuieuusmq potuieuumsq potuieuumqs potuieumqus potuieumqsu
potuieumuqs potuieumusq potuieumsuq potuieumsqu potuiesuqum potuiesuqmu potuiesuuqm potuiesuumq potuiesumuq potuiesumqu
potuiesquum potuiesqumu potuiesquum potuiesqumu potuiesqmuu potuiesqmuu potuiesuqum potuiesuqmu potuiesuuqm potuiesuumq
potuiesumuq potuiesumqu potuiesmquu potuiesmquu potuiesmuqu potuiesmuuq potuiesmuuq potuiesmuqu potuieqsuum potuieqsumu
potuieqsuum potuieqsumu potuieqsmuu potuieqsmuu potuiequsum potuiequsmu potuiequusm potuiequums potuiequmus potuiequmsu
potuiequusm potuiequums potuiequsum potuiequsmu potuiequmsu potuiequmus potuieqmuus potuieqmusu potuieqmuus potuieqmusu
potuieqmsuu potuieqmsuu potuieusqum potuieusqmu potuieusuqm potuieusumq potuieusmuq potuieusmqu potuieuqsum potuieuqsmu
potuieuqusm potuieuqums potuieuqmus potuieuqmsu potuieuuqsm potuieuuqms potuieuusqm potuieuusmq potuieuumsq potuieuumqs
potuieumqus potuieumqsu potuieumuqs potuieumusq potuieumsuq potuieumsqu potuiemsquu potuiemsquu potuiemsuqu potuiemsuuq
potuiemsuuq potuiemsuqu potuiemqsuu potuiemqsuu potuiemqusu potuiemquus potuiemquus potuiemqusu potuiemuqsu potuiemuqus
potuiemusqu potuiemusuq potuiemuusq potuiemuuqs potuiemuqus potuiemuqsu potuiemuuqs potuiemuusq potuiemusuq potuiemusqu
potumiusque potumiusqeu potumiusuqe potumiusueq potumiuseuq potumiusequ potumiuqsue potumiuqseu potumiuquse potumiuques
potumiuqeus potumiuqesu potumiuuqse potumiuuqes potumiuusqe potumiuuseq potumiuuesq potumiuueqs potumiuequs potumiueqsu
potumiueuqs potumiueusq potumiuesuq potumiuesqu potumisuque potumisuqeu potumisuuqe potumisuueq potumisueuq potumisuequ
potumisquue potumisqueu potumisquue potumisqueu potumisqeuu potumisqeuu potumisuque potumisuqeu potumisuuqe potumisuueq
potumisueuq potumisuequ potumisequu potumisequu potumiseuqu potumiseuuq potumiseuuq potumiseuqu potumiqsuue potumiqsueu
potumiqsuue potumiqsueu potumiqseuu potumiqseuu potumiqusue potumiquseu potumiquuse potumiquues potumiqueus potumiquesu
potumiquuse potumiquues potumiqusue potumiquseu potumiquesu potumiqueus potumiqeuus potumiqeusu potumiqeuus potumiqeusu
potumiqesuu potumiqesuu potumiusque potumiusqeu potumiusuqe potumiusueq potumiuseuq potumiusequ potumiuqsue potumiuqseu
potumiuquse potumiuques potumiuqeus potumiuqesu potumiuuqse potumiuuqes potumiuusqe potumiuuseq potumiuuesq potumiuueqs
potumiuequs potumiueqsu potumiueuqs potumiueusq potumiuesuq potumiuesqu potumiesquu potumiesquu potumiesuqu potumiesuuq
potumiesuuq potumiesuqu potumieqsuu potumieqsuu potumiequsu potumiequus potumiequus potumiequsu potumieuqsu potumieuqus
potumieusqu potumieusuq potumieuusq potumieuuqs potumieuqus potumieuqsu potumieuuqs potumieuusq potumieusuq potumieusqu
potumuisque potumuisqeu potumuisuqe potumuisueq potumuiseuq potumuisequ potumuiqsue potumuiqseu potumuiquse potumuiques
potumuiqeus potumuiqesu potumuiuqse potumuiuqes potumuiusqe potumuiuseq potumuiuesq potumuiueqs potumuiequs potumuieqsu
potumuieuqs potumuieusq potumuiesuq potumuiesqu potumusique potumusiqeu potumusiuqe potumusiueq potumusieuq potumusiequ
potumusqiue potumusqieu potumusquie potumusquei potumusqeui potumusqeiu potumusuqie potumusuqei potumusuiqe potumusuieq
potumusueiq potumusueqi potumusequi potumuseqiu potumuseuqi potumuseuiq potumuseiuq potumuseiqu potumuqsiue potumuqsieu
potumuqsuie potumuqsuei potumuqseui potumuqseiu potumuqisue potumuqiseu potumuqiuse potumuqiues potumuqieus potumuqiesu
potumuquise potumuquies potumuqusie potumuqusei potumuquesi potumuqueis potumuqeius potumuqeisu potumuqeuis potumuqeusi
potumuqesui potumuqesiu potumuusqie potumuusqei potumuusiqe potumuusieq potumuuseiq potumuuseqi potumuuqsie potumuuqsei
potumuuqise potumuuqies potumuuqeis potumuuqesi potumuuiqse potumuuiqes potumuuisqe potumuuiseq potumuuiesq potumuuieqs
potumuueqis potumuueqsi potumuueiqs potumuueisq potumuuesiq potumuuesqi potumuesqui potumuesqiu potumuesuqi potumuesuiq
potumuesiuq potumuesiqu potumueqsui potumueqsiu potumuequsi potumuequis potumueqius potumueqisu potumueuqsi potumueuqis
potumueusqi potumueusiq potumueuisq potumueuiqs potumueiqus potumueiqsu potumueiuqs potumueiusq potumueisuq potumueisqu
potumsuique potumsuiqeu potumsuiuqe potumsuiueq potumsuieuq potumsuiequ potumsuqiue potumsuqieu potumsuquie potumsuquei
potumsuqeui potumsuqeiu potumsuuqie potumsuuqei potumsuuiqe potumsuuieq potumsuueiq potumsuueqi potumsuequi potumsueqiu
potumsueuqi potumsueuiq potumsueiuq potumsueiqu potumsiuque potumsiuqeu potumsiuuqe potumsiuueq potumsiueuq potumsiuequ
potumsiquue potumsiqueu potumsiquue potumsiqueu potumsiqeuu potumsiqeuu potumsiuque potumsiuqeu potumsiuuqe potumsiuueq
potumsiueuq potumsiuequ potumsiequu potumsiequu potumsieuqu potumsieuuq potumsieuuq potumsieuqu potumsqiuue potumsqiueu
potumsqiuue potumsqiueu potumsqieuu potumsqieuu potumsquiue potumsquieu potumsquuie potumsquuei potumsqueui potumsqueiu
potumsquuie potumsquuei potumsquiue potumsquieu potumsqueiu potumsqueui potumsqeuui potumsqeuiu potumsqeuui potumsqeuiu
potumsqeiuu potumsqeiuu potumsuique potumsuiqeu potumsuiuqe potumsuiueq potumsuieuq potumsuiequ potumsuqiue potumsuqieu
potumsuquie potumsuquei potumsuqeui potumsuqeiu potumsuuqie potumsuuqei potumsuuiqe potumsuuieq potumsuueiq potumsuueqi
potumsuequi potumsueqiu potumsueuqi potumsueuiq potumsueiuq potumsueiqu potumseiquu potumseiquu potumseiuqu potumseiuuq
potumseiuuq potumseiuqu potumseqiuu potumseqiuu potumsequiu potumsequui potumsequui potumsequiu potumseuqiu potumseuqui
potumseuiqu potumseuiuq potumseuuiq potumseuuqi potumseuqui potumseuqiu potumseuuqi potumseuuiq potumseuiuq potumseuiqu
potumqusiue potumqusieu potumqusuie potumqusuei potumquseui potumquseiu potumquisue potumquiseu potumquiuse potumquiues
potumquieus potumquiesu potumquuise potumquuies potumquusie potumquusei potumquuesi potumquueis potumqueius potumqueisu
potumqueuis potumqueusi potumquesui potumquesiu potumqsuiue potumqsuieu potumqsuuie potumqsuuei potumqsueui potumqsueiu
potumqsiuue potumqsiueu potumqsiuue potumqsiueu potumqsieuu potumqsieuu potumqsuiue potumqsuieu potumqsuuie potumqsuuei
potumqsueui potumqsueiu potumqseiuu potumqseiuu potumqseuiu potumqseuui potumqseuui potumqseuiu potumqisuue potumqisueu
potumqisuue potumqisueu potumqiseuu potumqiseuu potumqiusue potumqiuseu potumqiuuse potumqiuues potumqiueus potumqiuesu
potumqiuuse potumqiuues potumqiusue potumqiuseu potumqiuesu potumqiueus potumqieuus potumqieusu potumqieuus potumqieusu
potumqiesuu potumqiesuu potumqusiue potumqusieu potumqusuie potumqusuei potumquseui potumquseiu potumquisue potumquiseu
potumquiuse potumquiues potumquieus potumquiesu potumquuise potumquuies potumquusie potumquusei potumquuesi potumquueis
potumqueius potumqueisu potumqueuis potumqueusi potumquesui potumquesiu potumqesiuu potumqesiuu potumqesuiu potumqesuui
potumqesuui potumqesuiu potumqeisuu potumqeisuu potumqeiusu potumqeiuus potumqeiuus potumqeiusu potumqeuisu potumqeuius
potumqeusiu potumqeusui potumqeuusi potumqeuuis potumqeuius potumqeuisu potumqeuuis potumqeuusi potumqeusui potumqeusiu
potumuusqie potumuusqei potumuusiqe potumuusieq potumuuseiq potumuuseqi potumuuqsie potumuuqsei potumuuqise potumuuqies
potumuuqeis potumuuqesi potumuuiqse potumuuiqes potumuuisqe potumuuiseq potumuuiesq potumuuieqs potumuueqis potumuueqsi
potumuueiqs potumuueisq potumuuesiq potumuuesqi potumusuqie potumusuqei potumusuiqe potumusuieq potumusueiq potumusueqi
potumusquie potumusquei potumusqiue potumusqieu potumusqeiu potumusqeui potumusique potumusiqeu potumusiuqe potumusiueq
potumusieuq potumusiequ potumuseqiu potumusequi potumuseiqu potumuseiuq potumuseuiq potumuseuqi potumuqsuie potumuqsuei
potumuqsiue potumuqsieu potumuqseiu potumuqseui potumuqusie potumuqusei potumuquise potumuquies potumuqueis potumuquesi
potumuqiuse potumuqiues potumuqisue potumuqiseu potumuqiesu potumuqieus potumuqeuis potumuqeusi potumuqeius potumuqeisu
potumuqesiu potumuqesui potumuisque potumuisqeu potumuisuqe potumuisueq potumuiseuq potumuisequ potumuiqsue potumuiqseu
potumuiquse potumuiques potumuiqeus potumuiqesu potumuiuqse potumuiuqes potumuiusqe potumuiuseq potumuiuesq potumuiueqs
potumuiequs potumuieqsu potumuieuqs potumuieusq potumuiesuq potumuiesqu potumuesqiu potumuesqui potumuesiqu potumuesiuq
potumuesuiq potumuesuqi potumueqsiu potumueqsui potumueqisu potumueqius potumuequis potumuequsi potumueiqsu potumueiqus
potumueisqu potumueisuq potumueiusq potumueiuqs potumueuqis potumueuqsi potumueuiqs potumueuisq potumueusiq potumueusqi
potumeusqui potumeusqiu potumeusuqi potumeusuiq potumeusiuq potumeusiqu potumeuqsui potumeuqsiu potumeuqusi potumeuquis
potumeuqius potumeuqisu potumeuuqsi potumeuuqis potumeuusqi potumeuusiq potumeuuisq potumeuuiqs potumeuiqus potumeuiqsu
potumeuiuqs potumeuiusq potumeuisuq potumeuisqu potumesuqui potumesuqiu potumesuuqi potumesuuiq potumesuiuq potumesuiqu
potumesquui potumesquiu potumesquui potumesquiu potumesqiuu potumesqiuu potumesuqui potumesuqiu potumesuuqi potumesuuiq
potumesuiuq potumesuiqu potumesiquu potumesiquu potumesiuqu potumesiuuq potumesiuuq potumesiuqu potumeqsuui potumeqsuiu
potumeqsuui potumeqsuiu potumeqsiuu potumeqsiuu potumequsui potumequsiu potumequusi potumequuis potumequius potumequisu
potumequusi potumequuis potumequsui potumequsiu potumequisu potumequius potumeqiuus potumeqiusu potumeqiuus potumeqiusu
potumeqisuu potumeqisuu potumeusqui potumeusqiu potumeusuqi potumeusuiq potumeusiuq potumeusiqu potumeuqsui potumeuqsiu
potumeuqusi potumeuquis potumeuqius potumeuqisu potumeuuqsi potumeuuqis potumeuusqi potumeuusiq potumeuuisq potumeuuiqs
potumeuiqus potumeuiqsu potumeuiuqs potumeuiusq potumeuisuq potumeuisqu potumeisquu potumeisquu potumeisuqu potumeisuuq
potumeisuuq potumeisuqu potumeiqsuu potumeiqsuu potumeiqusu potumeiquus potumeiquus potumeiqusu potumeiuqsu potumeiuqus
potumeiusqu potumeiusuq potumeiuusq potumeiuuqs potumeiuqus potumeiuqsu potumeiuuqs potumeiuusq potumeiusuq potumeiusqu
potuumisque potuumisqeu potuumisuqe potuumisueq potuumiseuq potuumisequ potuumiqsue potuumiqseu potuumiquse potuumiques
potuumiqeus potuumiqesu potuumiuqse potuumiuqes potuumiusqe potuumiuseq potuumiuesq potuumiueqs potuumiequs potuumieqsu
potuumieuqs potuumieusq potuumiesuq potuumiesqu potuumsique potuumsiqeu potuumsiuqe potuumsiueq potuumsieuq potuumsiequ
potuumsqiue potuumsqieu potuumsquie potuumsquei potuumsqeui potuumsqeiu potuumsuqie potuumsuqei potuumsuiqe potuumsuieq
potuumsueiq potuumsueqi potuumsequi potuumseqiu potuumseuqi potuumseuiq potuumseiuq potuumseiqu potuumqsiue potuumqsieu
potuumqsuie potuumqsuei potuumqseui potuumqseiu potuumqisue potuumqiseu potuumqiuse potuumqiues potuumqieus potuumqiesu
potuumquise potuumquies potuumqusie potuumqusei potuumquesi potuumqueis potuumqeius potuumqeisu potuumqeuis potuumqeusi
potuumqesui potuumqesiu potuumusqie potuumusqei potuumusiqe potuumusieq potuumuseiq potuumuseqi potuumuqsie potuumuqsei
potuumuqise potuumuqies potuumuqeis potuumuqesi potuumuiqse potuumuiqes potuumuisqe potuumuiseq potuumuiesq potuumuieqs
potuumueqis potuumueqsi potuumueiqs potuumueisq potuumuesiq potuumuesqi potuumesqui potuumesqiu potuumesuqi potuumesuiq
potuumesiuq potuumesiqu potuumeqsui potuumeqsiu potuumequsi potuumequis potuumeqius potuumeqisu potuumeuqsi potuumeuqis
potuumeusqi potuumeusiq potuumeuisq potuumeuiqs potuumeiqus potuumeiqsu potuumeiuqs potuumeiusq potuumeisuq potuumeisqu
potuuimsque potuuimsqeu potuuimsuqe potuuimsueq potuuimseuq potuuimsequ potuuimqsue potuuimqseu potuuimquse potuuimques
potuuimqeus potuuimqesu potuuimuqse potuuimuqes potuuimusqe potuuimuseq potuuimuesq potuuimueqs potuuimequs potuuimeqsu
potuuimeuqs potuuimeusq potuuimesuq potuuimesqu potuuismque potuuismqeu potuuismuqe potuuismueq potuuismeuq potuuismequ
potuuisqmue potuuisqmeu potuuisqume potuuisquem potuuisqeum potuuisqemu potuuisuqme potuuisuqem potuuisumqe potuuisumeq
potuuisuemq potuuisueqm potuuisequm potuuiseqmu potuuiseuqm potuuiseumq potuuisemuq potuuisemqu potuuiqsmue potuuiqsmeu
potuuiqsume potuuiqsuem potuuiqseum potuuiqsemu potuuiqmsue potuuiqmseu potuuiqmuse potuuiqmues potuuiqmeus potuuiqmesu
potuuiqumse potuuiqumes potuuiqusme potuuiqusem potuuiquesm potuuiquems potuuiqemus potuuiqemsu potuuiqeums potuuiqeusm
potuuiqesum potuuiqesmu potuuiusqme potuuiusqem potuuiusmqe potuuiusmeq potuuiusemq potuuiuseqm potuuiuqsme potuuiuqsem
potuuiuqmse potuuiuqmes potuuiuqems potuuiuqesm potuuiumqse potuuiumqes potuuiumsqe potuuiumseq potuuiumesq potuuiumeqs
potuuiueqms potuuiueqsm potuuiuemqs potuuiuemsq potuuiuesmq potuuiuesqm potuuiesqum potuuiesqmu potuuiesuqm potuuiesumq
potuuiesmuq potuuiesmqu potuuieqsum potuuieqsmu potuuiequsm potuuiequms potuuieqmus potuuieqmsu potuuieuqsm potuuieuqms
potuuieusqm potuuieusmq potuuieumsq potuuieumqs potuuiemqus potuuiemqsu potuuiemuqs potuuiemusq potuuiemsuq potuuiemsqu
potuusimque potuusimqeu potuusimuqe potuusimueq potuusimeuq potuusimequ potuusiqmue potuusiqmeu potuusiqume potuusiquem
potuusiqeum potuusiqemu potuusiuqme potuusiuqem potuusiumqe potuusiumeq potuusiuemq potuusiueqm potuusiequm potuusieqmu
potuusieuqm potuusieumq potuusiemuq potuusiemqu potuusmique potuusmiqeu potuusmiuqe potuusmiueq potuusmieuq potuusmiequ
potuusmqiue potuusmqieu potuusmquie potuusmquei potuusmqeui potuusmqeiu potuusmuqie potuusmuqei potuusmuiqe potuusmuieq
potuusmueiq potuusmueqi potuusmequi potuusmeqiu potuusmeuqi potuusmeuiq potuusmeiuq potuusmeiqu potuusqmiue potuusqmieu
potuusqmuie potuusqmuei potuusqmeui potuusqmeiu potuusqimue potuusqimeu potuusqiume potuusqiuem potuusqieum potuusqiemu
potuusquime potuusquiem potuusqumie potuusqumei potuusquemi potuusqueim potuusqeium potuusqeimu potuusqeuim potuusqeumi
potuusqemui potuusqemiu potuusumqie potuusumqei potuusumiqe potuusumieq potuusumeiq potuusumeqi potuusuqmie potuusuqmei
potuusuqime potuusuqiem potuusuqeim potuusuqemi potuusuiqme potuusuiqem potuusuimqe potuusuimeq potuusuiemq potuusuieqm
potuusueqim potuusueqmi potuusueiqm potuusueimq potuusuemiq potuusuemqi potuusemqui potuusemqiu potuusemuqi potuusemuiq
potuusemiuq potuusemiqu potuuseqmui potuuseqmiu potuusequmi potuusequim potuuseqium potuuseqimu potuuseuqmi potuuseuqim
potuuseumqi potuuseumiq potuuseuimq potuuseuiqm potuuseiqum potuuseiqmu potuuseiuqm potuuseiumq potuuseimuq potuuseimqu
potuuqismue potuuqismeu potuuqisume potuuqisuem potuuqiseum potuuqisemu potuuqimsue potuuqimseu potuuqimuse potuuqimues
potuuqimeus potuuqimesu potuuqiumse potuuqiumes potuuqiusme potuuqiusem potuuqiuesm potuuqiuems potuuqiemus potuuqiemsu
potuuqieums potuuqieusm potuuqiesum potuuqiesmu potuuqsimue potuuqsimeu potuuqsiume potuuqsiuem potuuqsieum potuuqsiemu
potuuqsmiue potuuqsmieu potuuqsmuie potuuqsmuei potuuqsmeui potuuqsmeiu potuuqsumie potuuqsumei potuuqsuime potuuqsuiem
potuuqsueim potuuqsuemi potuuqsemui potuuqsemiu potuuqseumi potuuqseuim potuuqseium potuuqseimu potuuqmsiue potuuqmsieu
potuuqmsuie potuuqmsuei potuuqmseui potuuqmseiu potuuqmisue potuuqmiseu potuuqmiuse potuuqmiues potuuqmieus potuuqmiesu
potuuqmuise potuuqmuies potuuqmusie potuuqmusei potuuqmuesi potuuqmueis potuuqmeius potuuqmeisu potuuqmeuis potuuqmeusi
potuuqmesui potuuqmesiu potuuqusmie potuuqusmei potuuqusime potuuqusiem potuuquseim potuuqusemi potuuqumsie potuuqumsei
potuuqumise potuuqumies potuuqumeis potuuqumesi potuuquimse potuuquimes potuuquisme potuuquisem potuuquiesm potuuquiems
potuuquemis potuuquemsi potuuqueims potuuqueism potuuquesim potuuquesmi potuuqesmui potuuqesmiu potuuqesumi potuuqesuim
potuuqesium potuuqesimu potuuqemsui potuuqemsiu potuuqemusi potuuqemuis potuuqemius potuuqemisu potuuqeumsi potuuqeumis
potuuqeusmi potuuqeusim potuuqeuism potuuqeuims potuuqeimus potuuqeimsu potuuqeiums potuuqeiusm potuuqeisum potuuqeismu
potuuuisqme potuuuisqem potuuuismqe potuuuismeq potuuuisemq potuuuiseqm potuuuiqsme potuuuiqsem potuuuiqmse potuuuiqmes
potuuuiqems potuuuiqesm potuuuimqse potuuuimqes potuuuimsqe potuuuimseq potuuuimesq potuuuimeqs potuuuieqms potuuuieqsm
potuuuiemqs potuuuiemsq potuuuiesmq potuuuiesqm potuuusiqme potuuusiqem potuuusimqe potuuusimeq potuuusiemq potuuusieqm
potuuusqime potuuusqiem potuuusqmie potuuusqmei potuuusqemi potuuusqeim potuuusmqie potuuusmqei potuuusmiqe potuuusmieq
potuuusmeiq potuuusmeqi potuuuseqmi potuuuseqim potuuusemqi potuuusemiq potuuuseimq potuuuseiqm potuuuqsime potuuuqsiem
potuuuqsmie potuuuqsmei potuuuqsemi potuuuqseim potuuuqisme potuuuqisem potuuuqimse potuuuqimes potuuuqiems potuuuqiesm
potuuuqmise potuuuqmies potuuuqmsie potuuuqmsei potuuuqmesi potuuuqmeis potuuuqeims potuuuqeism potuuuqemis potuuuqemsi
potuuuqesmi potuuuqesim potuuumsqie potuuumsqei potuuumsiqe potuuumsieq potuuumseiq potuuumseqi potuuumqsie potuuumqsei
potuuumqise potuuumqies potuuumqeis potuuumqesi potuuumiqse potuuumiqes potuuumisqe potuuumiseq potuuumiesq potuuumieqs
potuuumeqis potuuumeqsi potuuumeiqs potuuumeisq potuuumesiq potuuumesqi potuuuesqmi potuuuesqim potuuuesmqi potuuuesmiq
potuuuesimq potuuuesiqm potuuueqsmi potuuueqsim potuuueqmsi potuuueqmis potuuueqims potuuueqism potuuuemqsi potuuuemqis
potuuuemsqi potuuuemsiq potuuuemisq potuuuemiqs potuuueiqms potuuueiqsm potuuueimqs potuuueimsq potuuueismq potuuueisqm
potuueisqum potuueisqmu potuueisuqm potuueisumq potuueismuq potuueismqu potuueiqsum potuueiqsmu potuueiqusm potuueiqums
potuueiqmus potuueiqmsu potuueiuqsm potuueiuqms potuueiusqm potuueiusmq potuueiumsq potuueiumqs potuueimqus potuueimqsu
potuueimuqs potuueimusq potuueimsuq potuueimsqu potuuesiqum potuuesiqmu potuuesiuqm potuuesiumq potuuesimuq potuuesimqu
potuuesqium potuuesqimu potuuesquim potuuesqumi potuuesqmui potuuesqmiu potuuesuqim potuuesuqmi potuuesuiqm potuuesuimq
potuuesumiq potuuesumqi potuuesmqui potuuesmqiu potuuesmuqi potuuesmuiq potuuesmiuq potuuesmiqu potuueqsium potuueqsimu
potuueqsuim potuueqsumi potuueqsmui potuueqsmiu potuueqisum potuueqismu potuueqiusm potuueqiums potuueqimus potuueqimsu
potuuequism potuuequims potuuequsim potuuequsmi potuuequmsi potuuequmis potuueqmius potuueqmisu potuueqmuis potuueqmusi
potuueqmsui potuueqmsiu potuueusqim potuueusqmi potuueusiqm potuueusimq potuueusmiq potuueusmqi potuueuqsim potuueuqsmi
potuueuqism potuueuqims potuueuqmis potuueuqmsi potuueuiqsm potuueuiqms potuueuisqm potuueuismq potuueuimsq potuueuimqs
potuueumqis potuueumqsi potuueumiqs potuueumisq potuueumsiq potuueumsqi potuuemsqui potuuemsqiu potuuemsuqi potuuemsuiq
potuuemsiuq potuuemsiqu potuuemqsui potuuemqsiu potuuemqusi potuuemquis potuuemqius potuuemqisu potuuemuqsi potuuemuqis
potuuemusqi potuuemusiq potuuemuisq potuuemuiqs potuuemiqus potuuemiqsu potuuemiuqs potuuemiusq potuuemisuq potuuemisqu
potusmuique potusmuiqeu potusmuiuqe potusmuiueq potusmuieuq potusmuiequ potusmuqiue potusmuqieu potusmuquie potusmuquei
potusmuqeui potusmuqeiu potusmuuqie potusmuuqei potusmuuiqe potusmuuieq potusmuueiq potusmuueqi potusmuequi potusmueqiu
potusmueuqi potusmueuiq potusmueiuq potusmueiqu potusmiuque potusmiuqeu potusmiuuqe potusmiuueq potusmiueuq potusmiuequ
potusmiquue potusmiqueu potusmiquue potusmiqueu potusmiqeuu potusmiqeuu potusmiuque potusmiuqeu potusmiuuqe potusmiuueq
potusmiueuq potusmiuequ potusmiequu potusmiequu potusmieuqu potusmieuuq potusmieuuq potusmieuqu potusmqiuue potusmqiueu
potusmqiuue potusmqiueu potusmqieuu potusmqieuu potusmquiue potusmquieu potusmquuie potusmquuei potusmqueui potusmqueiu
potusmquuie potusmquuei potusmquiue potusmquieu potusmqueiu potusmqueui potusmqeuui potusmqeuiu potusmqeuui potusmqeuiu
potusmqeiuu potusmqeiuu potusmuique potusmuiqeu potusmuiuqe potusmuiueq potusmuieuq potusmuiequ potusmuqiue potusmuqieu
potusmuquie potusmuquei potusmuqeui potusmuqeiu potusmuuqie potusmuuqei potusmuuiqe potusmuuieq potusmuueiq potusmuueqi
potusmuequi potusmueqiu potusmueuqi potusmueuiq potusmueiuq potusmueiqu potusmeiquu potusmeiquu potusmeiuqu potusmeiuuq
potusmeiuuq potusmeiuqu potusmeqiuu potusmeqiuu potusmequiu potusmequui potusmequui potusmequiu potusmeuqiu potusmeuqui
potusmeuiqu potusmeuiuq potusmeuuiq potusmeuuqi potusmeuqui potusmeuqiu potusmeuuqi potusmeuuiq potusmeuiuq potusmeuiqu
potusumique potusumiqeu potusumiuqe potusumiueq potusumieuq potusumiequ potusumqiue potusumqieu potusumquie potusumquei
potusumqeui potusumqeiu potusumuqie potusumuqei potusumuiqe potusumuieq potusumueiq potusumueqi potusumequi potusumeqiu
potusumeuqi potusumeuiq potusumeiuq potusumeiqu potusuimque potusuimqeu potusuimuqe potusuimueq potusuimeuq potusuimequ
potusuiqmue potusuiqmeu potusuiqume potusuiquem potusuiqeum potusuiqemu potusuiuqme potusuiuqem potusuiumqe potusuiumeq
potusuiuemq potusuiueqm potusuiequm potusuieqmu potusuieuqm potusuieumq potusuiemuq potusuiemqu potusuqimue potusuqimeu
potusuqiume potusuqiuem potusuqieum potusuqiemu potusuqmiue potusuqmieu potusuqmuie potusuqmuei potusuqmeui potusuqmeiu
potusuqumie potusuqumei potusuquime potusuquiem potusuqueim potusuquemi potusuqemui potusuqemiu potusuqeumi potusuqeuim
potusuqeium potusuqeimu potusuuiqme potusuuiqem potusuuimqe potusuuimeq potusuuiemq potusuuieqm potusuuqime potusuuqiem
potusuuqmie potusuuqmei potusuuqemi potusuuqeim potusuumqie potusuumqei potusuumiqe potusuumieq potusuumeiq potusuumeqi
potusuueqmi potusuueqim potusuuemqi potusuuemiq potusuueimq potusuueiqm potusueiqum potusueiqmu potusueiuqm potusueiumq
potusueimuq potusueimqu potusueqium potusueqimu potusuequim potusuequmi potusueqmui potusueqmiu potusueuqim potusueuqmi
potusueuiqm potusueuimq potusueumiq potusueumqi potusuemqui potusuemqiu potusuemuqi potusuemuiq potusuemiuq potusuemiqu
potusiumque potusiumqeu potusiumuqe potusiumueq potusiumeuq potusiumequ potusiuqmue potusiuqmeu potusiuqume potusiuquem
potusiuqeum potusiuqemu potusiuuqme potusiuuqem potusiuumqe potusiuumeq potusiuuemq potusiuueqm potusiuequm potusiueqmu
potusiueuqm potusiueumq potusiuemuq potusiuemqu potusimuque potusimuqeu potusimuuqe potusimuueq potusimueuq potusimuequ
potusimquue potusimqueu potusimquue potusimqueu potusimqeuu potusimqeuu potusimuque potusimuqeu potusimuuqe potusimuueq
potusimueuq potusimuequ potusimequu potusimequu potusimeuqu potusimeuuq potusimeuuq potusimeuqu potusiqmuue potusiqmueu
potusiqmuue potusiqmueu potusiqmeuu potusiqmeuu potusiqumue potusiqumeu potusiquume potusiquuem potusiqueum potusiquemu
potusiquume potusiquuem potusiqumue potusiqumeu potusiquemu potusiqueum potusiqeuum potusiqeumu potusiqeuum potusiqeumu
potusiqemuu potusiqemuu potusiumque potusiumqeu potusiumuqe potusiumueq potusiumeuq potusiumequ potusiuqmue potusiuqmeu
potusiuqume potusiuquem potusiuqeum potusiuqemu potusiuuqme potusiuuqem potusiuumqe potusiuumeq potusiuuemq potusiuueqm
potusiuequm potusiueqmu potusiueuqm potusiueumq potusiuemuq potusiuemqu potusiemquu potusiemquu potusiemuqu potusiemuuq
potusiemuuq potusiemuqu potusieqmuu potusieqmuu potusiequmu potusiequum potusiequum potusiequmu potusieuqmu potusieuqum
potusieumqu potusieumuq potusieuumq potusieuuqm potusieuqum potusieuqmu potusieuuqm potusieuumq potusieumuq potusieumqu
potusquimue potusquimeu potusquiume potusquiuem potusquieum potusquiemu potusqumiue potusqumieu potusqumuie potusqumuei
potusqumeui potusqumeiu potusquumie potusquumei potusquuime potusquuiem potusquueim potusquuemi potusquemui potusquemiu
potusqueumi potusqueuim potusqueium potusqueimu potusqiumue potusqiumeu potusqiuume potusqiuuem potusqiueum potusqiuemu
potusqimuue potusqimueu potusqimuue potusqimueu potusqimeuu potusqimeuu potusqiumue potusqiumeu potusqiuume potusqiuuem
potusqiueum potusqiuemu potusqiemuu potusqiemuu potusqieumu potusqieuum potusqieuum potusqieumu potusqmiuue potusqmiueu
potusqmiuue potusqmiueu potusqmieuu potusqmieuu potusqmuiue potusqmuieu potusqmuuie potusqmuuei potusqmueui potusqmueiu
potusqmuuie potusqmuuei potusqmuiue potusqmuieu potusqmueiu potusqmueui potusqmeuui potusqmeuiu potusqmeuui potusqmeuiu
potusqmeiuu potusqmeiuu potusquimue potusquimeu potusquiume potusquiuem potusquieum potusquiemu potusqumiue potusqumieu
potusqumuie potusqumuei potusqumeui potusqumeiu potusquumie potusquumei potusquuime potusquuiem potusquueim potusquuemi
potusquemui potusquemiu potusqueumi potusqueuim potusqueium potusqueimu potusqeimuu potusqeimuu potusqeiumu potusqeiuum
potusqeiuum potusqeiumu potusqemiuu potusqemiuu potusqemuiu potusqemuui potusqemuui potusqemuiu potusqeumiu potusqeumui
potusqeuimu potusqeuium potusqeuuim potusqeuumi potusqeumui potusqeumiu potusqeuumi potusqeuuim potusqeuium potusqeuimu
potusuuiqme potusuuiqem potusuuimqe potusuuimeq potusuuiemq potusuuieqm potusuuqime potusuuqiem potusuuqmie potusuuqmei
potusuuqemi potusuuqeim potusuumqie potusuumqei potusuumiqe potusuumieq potusuumeiq potusuumeqi potusuueqmi potusuueqim
potusuuemqi potusuuemiq potusuueimq potusuueiqm potusuiuqme potusuiuqem potusuiumqe potusuiumeq potusuiuemq potusuiueqm
potusuiqume potusuiquem potusuiqmue potusuiqmeu potusuiqemu potusuiqeum potusuimque potusuimqeu potusuimuqe potusuimueq
potusuimeuq potusuimequ potusuieqmu potusuiequm potusuiemqu potusuiemuq potusuieumq potusuieuqm potusuqiume potusuqiuem
potusuqimue potusuqimeu potusuqiemu potusuqieum potusuquime potusuquiem potusuqumie potusuqumei potusuquemi potusuqueim
potusuqmuie potusuqmuei potusuqmiue potusuqmieu potusuqmeiu potusuqmeui potusuqeumi potusuqeuim potusuqemui potusuqemiu
potusuqeimu potusuqeium potusumique potusumiqeu potusumiuqe potusumiueq potusumieuq potusumiequ potusumqiue potusumqieu
potusumquie potusumquei potusumqeui potusumqeiu potusumuqie potusumuqei potusumuiqe potusumuieq potusumueiq potusumueqi
potusumequi potusumeqiu potusumeuqi potusumeuiq potusumeiuq potusumeiqu potusueiqmu potusueiqum potusueimqu potusueimuq
potusueiumq potusueiuqm potusueqimu potusueqium potusueqmiu potusueqmui potusuequmi potusuequim potusuemqiu potusuemqui
potusuemiqu potusuemiuq potusuemuiq potusuemuqi potusueuqmi potusueuqim potusueumqi potusueumiq potusueuimq potusueuiqm
potuseuiqum potuseuiqmu potuseuiuqm potuseuiumq potuseuimuq potuseuimqu potuseuqium potuseuqimu potuseuquim potuseuqumi
potuseuqmui potuseuqmiu potuseuuqim potuseuuqmi potuseuuiqm potuseuuimq potuseuumiq potuseuumqi potuseumqui potuseumqiu
potuseumuqi potuseumuiq potuseumiuq potuseumiqu potuseiuqum potuseiuqmu potuseiuuqm potuseiuumq potuseiumuq potuseiumqu
potuseiquum potuseiqumu potuseiquum potuseiqumu potuseiqmuu potuseiqmuu potuseiuqum potuseiuqmu potuseiuuqm potuseiuumq
potuseiumuq potuseiumqu potuseimquu potuseimquu potuseimuqu potuseimuuq potuseimuuq potuseimuqu potuseqiuum potuseqiumu
potuseqiuum potuseqiumu potuseqimuu potuseqimuu potusequium potusequimu potusequuim potusequumi potusequmui potusequmiu
potusequuim potusequumi potusequium potusequimu potusequmiu potusequmui potuseqmuui potuseqmuiu potuseqmuui potuseqmuiu
potuseqmiuu potuseqmiuu potuseuiqum potuseuiqmu potuseuiuqm potuseuiumq potuseuimuq potuseuimqu potuseuqium potuseuqimu
potuseuquim potuseuqumi potuseuqmui potuseuqmiu potuseuuqim potuseuuqmi potuseuuiqm potuseuuimq potuseuumiq potuseuumqi
potuseumqui potuseumqiu potuseumuqi potuseumuiq potuseumiuq potuseumiqu potusemiquu potusemiquu potusemiuqu potusemiuuq
potusemiuuq potusemiuqu potusemqiuu potusemqiuu potusemquiu potusemquui potusemquui potusemquiu potusemuqiu potusemuqui
potusemuiqu potusemuiuq potusemuuiq potusemuuqi potusemuqui potusemuqiu potusemuuqi potusemuuiq potusemuiuq potusemuiqu
potuqmusiue potuqmusieu potuqmusuie potuqmusuei potuqmuseui potuqmuseiu potuqmuisue potuqmuiseu potuqmuiuse potuqmuiues
potuqmuieus potuqmuiesu potuqmuuise potuqmuuies potuqmuusie potuqmuusei potuqmuuesi potuqmuueis potuqmueius potuqmueisu
potuqmueuis potuqmueusi potuqmuesui potuqmuesiu potuqmsuiue potuqmsuieu potuqmsuuie potuqmsuuei potuqmsueui potuqmsueiu
potuqmsiuue potuqmsiueu potuqmsiuue potuqmsiueu potuqmsieuu potuqmsieuu potuqmsuiue potuqmsuieu potuqmsuuie potuqmsuuei
potuqmsueui potuqmsueiu potuqmseiuu potuqmseiuu potuqmseuiu potuqmseuui potuqmseuui potuqmseuiu potuqmisuue potuqmisueu
potuqmisuue potuqmisueu potuqmiseuu potuqmiseuu potuqmiusue potuqmiuseu potuqmiuuse potuqmiuues potuqmiueus potuqmiuesu
potuqmiuuse potuqmiuues potuqmiusue potuqmiuseu potuqmiuesu potuqmiueus potuqmieuus potuqmieusu potuqmieuus potuqmieusu
potuqmiesuu potuqmiesuu potuqmusiue potuqmusieu potuqmusuie potuqmusuei potuqmuseui potuqmuseiu potuqmuisue potuqmuiseu
potuqmuiuse potuqmuiues potuqmuieus potuqmuiesu potuqmuuise potuqmuuies potuqmuusie potuqmuusei potuqmuuesi potuqmuueis
potuqmueius potuqmueisu potuqmueuis potuqmueusi potuqmuesui potuqmuesiu potuqmesiuu potuqmesiuu potuqmesuiu potuqmesuui
potuqmesuui potuqmesuiu potuqmeisuu potuqmeisuu potuqmeiusu potuqmeiuus potuqmeiuus potuqmeiusu potuqmeuisu potuqmeuius
potuqmeusiu potuqmeusui potuqmeuusi potuqmeuuis potuqmeuius potuqmeuisu potuqmeuuis potuqmeuusi potuqmeusui potuqmeusiu
potuqumsiue potuqumsieu potuqumsuie potuqumsuei potuqumseui potuqumseiu potuqumisue potuqumiseu potuqumiuse potuqumiues
potuqumieus potuqumiesu potuqumuise potuqumuies potuqumusie potuqumusei potuqumuesi potuqumueis potuqumeius potuqumeisu
potuqumeuis potuqumeusi potuqumesui potuqumesiu potuqusmiue potuqusmieu potuqusmuie potuqusmuei potuqusmeui potuqusmeiu
potuqusimue potuqusimeu potuqusiume potuqusiuem potuqusieum potuqusiemu potuqusuime potuqusuiem potuqusumie potuqusumei
potuqusuemi potuqusueim potuquseium potuquseimu potuquseuim potuquseumi potuqusemui potuqusemiu potuquismue potuquismeu
potuquisume potuquisuem potuquiseum potuquisemu potuquimsue potuquimseu potuquimuse potuquimues potuquimeus potuquimesu
potuquiumse potuquiumes potuquiusme potuquiusem potuquiuesm potuquiuems potuquiemus potuquiemsu potuquieums potuquieusm
potuquiesum potuquiesmu potuquusime potuquusiem potuquusmie potuquusmei potuquusemi potuquuseim potuquuisme potuquuisem
potuquuimse potuquuimes potuquuiems potuquuiesm potuquumise potuquumies potuquumsie potuquumsei potuquumesi potuquumeis
potuquueims potuquueism potuquuemis potuquuemsi potuquuesmi potuquuesim potuquesium potuquesimu potuquesuim potuquesumi
potuquesmui potuquesmiu potuqueisum potuqueismu potuqueiusm potuqueiums potuqueimus potuqueimsu potuqueuism potuqueuims
potuqueusim potuqueusmi potuqueumsi potuqueumis potuquemius potuquemisu potuquemuis potuquemusi potuquemsui potuquemsiu
potuqsumiue potuqsumieu potuqsumuie potuqsumuei potuqsumeui potuqsumeiu potuqsuimue potuqsuimeu potuqsuiume potuqsuiuem
potuqsuieum potuqsuiemu potuqsuuime potuqsuuiem potuqsuumie potuqsuumei potuqsuuemi potuqsuueim potuqsueium potuqsueimu
potuqsueuim potuqsueumi potuqsuemui potuqsuemiu potuqsmuiue potuqsmuieu potuqsmuuie potuqsmuuei potuqsmueui potuqsmueiu
potuqsmiuue potuqsmiueu potuqsmiuue potuqsmiueu potuqsmieuu potuqsmieuu potuqsmuiue potuqsmuieu potuqsmuuie potuqsmuuei
potuqsmueui potuqsmueiu potuqsmeiuu potuqsmeiuu potuqsmeuiu potuqsmeuui potuqsmeuui potuqsmeuiu potuqsimuue potuqsimueu
potuqsimuue potuqsimueu potuqsimeuu potuqsimeuu potuqsiumue potuqsiumeu potuqsiuume potuqsiuuem potuqsiueum potuqsiuemu
potuqsiuume potuqsiuuem potuqsiumue potuqsiumeu potuqsiuemu potuqsiueum potuqsieuum potuqsieumu potuqsieuum potuqsieumu
potuqsiemuu potuqsiemuu potuqsumiue potuqsumieu potuqsumuie potuqsumuei potuqsumeui potuqsumeiu potuqsuimue potuqsuimeu
potuqsuiume potuqsuiuem potuqsuieum potuqsuiemu potuqsuuime potuqsuuiem potuqsuumie potuqsuumei potuqsuuemi potuqsuueim
potuqsueium potuqsueimu potuqsueuim potuqsueumi potuqsuemui potuqsuemiu potuqsemiuu potuqsemiuu potuqsemuiu potuqsemuui
potuqsemuui potuqsemuiu potuqseimuu potuqseimuu potuqseiumu potuqseiuum potuqseiuum potuqseiumu potuqseuimu potuqseuium
potuqseumiu potuqseumui potuqseuumi potuqseuuim potuqseuium potuqseuimu potuqseuuim potuqseuumi potuqseumui potuqseumiu
potuqiusmue potuqiusmeu potuqiusume potuqiusuem potuqiuseum potuqiusemu potuqiumsue potuqiumseu potuqiumuse potuqiumues
potuqiumeus potuqiumesu potuqiuumse potuqiuumes potuqiuusme potuqiuusem potuqiuuesm potuqiuuems potuqiuemus potuqiuemsu
potuqiueums potuqiueusm potuqiuesum potuqiuesmu potuqisumue potuqisumeu potuqisuume potuqisuuem potuqisueum potuqisuemu
potuqismuue potuqismueu potuqismuue potuqismueu potuqismeuu potuqismeuu potuqisumue potuqisumeu potuqisuume potuqisuuem
potuqisueum potuqisuemu potuqisemuu potuqisemuu potuqiseumu potuqiseuum potuqiseuum potuqiseumu potuqimsuue potuqimsueu
potuqimsuue potuqimsueu potuqimseuu potuqimseuu potuqimusue potuqimuseu potuqimuuse potuqimuues potuqimueus potuqimuesu
potuqimuuse potuqimuues potuqimusue potuqimuseu potuqimuesu potuqimueus potuqimeuus potuqimeusu potuqimeuus potuqimeusu
potuqimesuu potuqimesuu potuqiusmue potuqiusmeu potuqiusume potuqiusuem potuqiuseum potuqiusemu potuqiumsue potuqiumseu
potuqiumuse potuqiumues potuqiumeus potuqiumesu potuqiuumse potuqiuumes potuqiuusme potuqiuusem potuqiuuesm potuqiuuems
potuqiuemus potuqiuemsu potuqiueums potuqiueusm potuqiuesum potuqiuesmu potuqiesmuu potuqiesmuu potuqiesumu potuqiesuum
potuqiesuum potuqiesumu potuqiemsuu potuqiemsuu potuqiemusu potuqiemuus potuqiemuus potuqiemusu potuqieumsu potuqieumus
potuqieusmu potuqieusum potuqieuusm potuqieuums potuqieumus potuqieumsu potuqieuums potuqieuusm potuqieusum potuqieusmu
potuquusime potuquusiem potuquusmie potuquusmei potuquusemi potuquuseim potuquuisme potuquuisem potuquuimse potuquuimes
potuquuiems potuquuiesm potuquumise potuquumies potuquumsie potuquumsei potuquumesi potuquumeis potuquueims potuquueism
potuquuemis potuquuemsi potuquuesmi potuquuesim potuqusuime potuqusuiem potuqusumie potuqusumei potuqusuemi potuqusueim
potuqusiume potuqusiuem potuqusimue potuqusimeu potuqusiemu potuqusieum potuqusmiue potuqusmieu potuqusmuie potuqusmuei
potuqusmeui potuqusmeiu potuquseimu potuquseium potuqusemiu potuqusemui potuquseumi potuquseuim potuquisume potuquisuem
potuquismue potuquismeu potuquisemu potuquiseum potuquiusme potuquiusem potuquiumse potuquiumes potuquiuems potuquiuesm
potuquimuse potuquimues potuquimsue potuquimseu potuquimesu potuquimeus potuquieums potuquieusm potuquiemus potuquiemsu
potuquiesmu potuquiesum potuqumsiue potuqumsieu potuqumsuie potuqumsuei potuqumseui potuqumseiu potuqumisue potuqumiseu
potuqumiuse potuqumiues potuqumieus potuqumiesu potuqumuise potuqumuies potuqumusie potuqumusei potuqumuesi potuqumueis
potuqumeius potuqumeisu potuqumeuis potuqumeusi potuqumesui potuqumesiu potuquesimu potuquesium potuquesmiu potuquesmui
potuquesumi potuquesuim potuqueismu potuqueisum potuqueimsu potuqueimus potuqueiums potuqueiusm potuquemisu potuquemius
potuquemsiu potuquemsui potuquemusi potuquemuis potuqueuims potuqueuism potuqueumis potuqueumsi potuqueusmi potuqueusim
potuqeusium potuqeusimu potuqeusuim potuqeusumi potuqeusmui potuqeusmiu potuqeuisum potuqeuismu potuqeuiusm potuqeuiums
potuqeuimus potuqeuimsu potuqeuuism potuqeuuims potuqeuusim potuqeuusmi potuqeuumsi potuqeuumis potuqeumius potuqeumisu
potuqeumuis potuqeumusi potuqeumsui potuqeumsiu potuqesuium potuqesuimu potuqesuuim potuqesuumi potuqesumui potuqesumiu
potuqesiuum potuqesiumu potuqesiuum potuqesiumu potuqesimuu potuqesimuu potuqesuium potuqesuimu potuqesuuim potuqesuumi
potuqesumui potuqesumiu potuqesmiuu potuqesmiuu potuqesmuiu potuqesmuui potuqesmuui potuqesmuiu potuqeisuum potuqeisumu
potuqeisuum potuqeisumu potuqeismuu potuqeismuu potuqeiusum potuqeiusmu potuqeiuusm potuqeiuums potuqeiumus potuqeiumsu
potuqeiuusm potuqeiuums potuqeiusum potuqeiusmu potuqeiumsu potuqeiumus potuqeimuus potuqeimusu potuqeimuus potuqeimusu
potuqeimsuu potuqeimsuu potuqeusium potuqeusimu potuqeusuim potuqeusumi potuqeusmui potuqeusmiu potuqeuisum potuqeuismu
potuqeuiusm potuqeuiums potuqeuimus potuqeuimsu potuqeuuism potuqeuuims potuqeuusim potuqeuusmi potuqeuumsi potuqeuumis
potuqeumius potuqeumisu potuqeumuis potuqeumusi potuqeumsui potuqeumsiu potuqemsiuu potuqemsiuu potuqemsuiu potuqemsuui
potuqemsuui potuqemsuiu potuqemisuu potuqemisuu potuqemiusu potuqemiuus potuqemiuus potuqemiusu potuqemuisu potuqemuius
potuqemusiu potuqemusui potuqemuusi potuqemuuis potuqemuius potuqemuisu potuqemuuis potuqemuusi potuqemusui potuqemusiu
potuumusqie potuumusqei potuumusiqe potuumusieq potuumuseiq potuumuseqi potuumuqsie potuumuqsei potuumuqise potuumuqies
potuumuqeis potuumuqesi potuumuiqse potuumuiqes potuumuisqe potuumuiseq potuumuiesq potuumuieqs potuumueqis potuumueqsi
potuumueiqs potuumueisq potuumuesiq potuumuesqi potuumsuqie potuumsuqei potuumsuiqe potuumsuieq potuumsueiq potuumsueqi
potuumsquie potuumsquei potuumsqiue potuumsqieu potuumsqeiu potuumsqeui potuumsique potuumsiqeu potuumsiuqe potuumsiueq
potuumsieuq potuumsiequ potuumseqiu potuumsequi potuumseiqu potuumseiuq potuumseuiq potuumseuqi potuumqsuie potuumqsuei
potuumqsiue potuumqsieu potuumqseiu potuumqseui potuumqusie potuumqusei potuumquise potuumquies potuumqueis potuumquesi
potuumqiuse potuumqiues potuumqisue potuumqiseu potuumqiesu potuumqieus potuumqeuis potuumqeusi potuumqeius potuumqeisu
potuumqesiu potuumqesui potuumisque potuumisqeu potuumisuqe potuumisueq potuumiseuq potuumisequ potuumiqsue potuumiqseu
potuumiquse potuumiques potuumiqeus potuumiqesu potuumiuqse potuumiuqes potuumiusqe potuumiuseq potuumiuesq potuumiueqs
potuumiequs potuumieqsu potuumieuqs potuumieusq potuumiesuq potuumiesqu potuumesqiu potuumesqui potuumesiqu potuumesiuq
potuumesuiq potuumesuqi potuumeqsiu potuumeqsui potuumeqisu potuumeqius potuumequis potuumequsi potuumeiqsu potuumeiqus
potuumeisqu potuumeisuq potuumeiusq potuumeiuqs potuumeuqis potuumeuqsi potuumeuiqs potuumeuisq potuumeusiq potuumeusqi
potuuumsqie potuuumsqei potuuumsiqe potuuumsieq potuuumseiq potuuumseqi potuuumqsie potuuumqsei potuuumqise potuuumqies
potuuumqeis potuuumqesi potuuumiqse potuuumiqes potuuumisqe potuuumiseq potuuumiesq potuuumieqs potuuumeqis potuuumeqsi
potuuumeiqs potuuumeisq potuuumesiq potuuumesqi potuuusmqie potuuusmqei potuuusmiqe potuuusmieq potuuusmeiq potuuusmeqi
potuuusqmie potuuusqmei potuuusqime potuuusqiem potuuusqeim potuuusqemi potuuusiqme potuuusiqem potuuusimqe potuuusimeq
potuuusiemq potuuusieqm potuuuseqim potuuuseqmi potuuuseiqm potuuuseimq potuuusemiq potuuusemqi potuuuqsmie potuuuqsmei
potuuuqsime potuuuqsiem potuuuqseim potuuuqsemi potuuuqmsie potuuuqmsei potuuuqmise potuuuqmies potuuuqmeis potuuuqmesi
potuuuqimse potuuuqimes potuuuqisme potuuuqisem potuuuqiesm potuuuqiems potuuuqemis potuuuqemsi potuuuqeims potuuuqeism
potuuuqesim potuuuqesmi potuuuisqme potuuuisqem potuuuismqe potuuuismeq potuuuisemq potuuuiseqm potuuuiqsme potuuuiqsem
potuuuiqmse potuuuiqmes potuuuiqems potuuuiqesm potuuuimqse potuuuimqes potuuuimsqe potuuuimseq potuuuimesq potuuuimeqs
potuuuieqms potuuuieqsm potuuuiemqs potuuuiemsq potuuuiesmq potuuuiesqm potuuuesqim potuuuesqmi potuuuesiqm potuuuesimq
potuuuesmiq potuuuesmqi potuuueqsim potuuueqsmi potuuueqism potuuueqims potuuueqmis potuuueqmsi potuuueiqsm potuuueiqms
potuuueisqm potuuueismq potuuueimsq potuuueimqs potuuuemqis potuuuemqsi potuuuemiqs potuuuemisq potuuuemsiq potuuuemsqi
potuusumqie potuusumqei potuusumiqe potuusumieq potuusumeiq potuusumeqi potuusuqmie potuusuqmei potuusuqime potuusuqiem
potuusuqeim potuusuqemi potuusuiqme potuusuiqem potuusuimqe potuusuimeq potuusuiemq potuusuieqm potuusueqim potuusueqmi
potuusueiqm potuusueimq potuusuemiq potuusuemqi potuusmuqie potuusmuqei potuusmuiqe potuusmuieq potuusmueiq potuusmueqi
potuusmquie potuusmquei potuusmqiue potuusmqieu potuusmqeiu potuusmqeui potuusmique potuusmiqeu potuusmiuqe potuusmiueq
potuusmieuq potuusmiequ potuusmeqiu potuusmequi potuusmeiqu potuusmeiuq potuusmeuiq potuusmeuqi potuusqmuie potuusqmuei
potuusqmiue potuusqmieu potuusqmeiu potuusqmeui potuusqumie potuusqumei potuusquime potuusquiem potuusqueim potuusquemi
potuusqiume potuusqiuem potuusqimue potuusqimeu potuusqiemu potuusqieum potuusqeuim potuusqeumi potuusqeium potuusqeimu
potuusqemiu potuusqemui potuusimque potuusimqeu potuusimuqe potuusimueq potuusimeuq potuusimequ potuusiqmue potuusiqmeu
potuusiqume potuusiquem potuusiqeum potuusiqemu potuusiuqme potuusiuqem potuusiumqe potuusiumeq potuusiuemq potuusiueqm
potuusiequm potuusieqmu potuusieuqm potuusieumq potuusiemuq potuusiemqu potuusemqiu potuusemqui potuusemiqu potuusemiuq
potuusemuiq potuusemuqi potuuseqmiu potuuseqmui potuuseqimu potuuseqium potuusequim potuusequmi potuuseiqmu potuuseiqum
potuuseimqu potuuseimuq potuuseiumq potuuseiuqm potuuseuqim potuuseuqmi potuuseuiqm potuuseuimq potuuseumiq potuuseumqi
potuuqusmie potuuqusmei potuuqusime potuuqusiem potuuquseim potuuqusemi potuuqumsie potuuqumsei potuuqumise potuuqumies
potuuqumeis potuuqumesi potuuquimse potuuquimes potuuquisme potuuquisem potuuquiesm potuuquiems potuuquemis potuuquemsi
potuuqueims potuuqueism potuuquesim potuuquesmi potuuqsumie potuuqsumei potuuqsuime potuuqsuiem potuuqsueim potuuqsuemi
potuuqsmuie potuuqsmuei potuuqsmiue potuuqsmieu potuuqsmeiu potuuqsmeui potuuqsimue potuuqsimeu potuuqsiume potuuqsiuem
potuuqsieum potuuqsiemu potuuqsemiu potuuqsemui potuuqseimu potuuqseium potuuqseuim potuuqseumi potuuqmsuie potuuqmsuei
potuuqmsiue potuuqmsieu potuuqmseiu potuuqmseui potuuqmusie potuuqmusei potuuqmuise potuuqmuies potuuqmueis potuuqmuesi
potuuqmiuse potuuqmiues potuuqmisue potuuqmiseu potuuqmiesu potuuqmieus potuuqmeuis potuuqmeusi potuuqmeius potuuqmeisu
potuuqmesiu potuuqmesui potuuqismue potuuqismeu potuuqisume potuuqisuem potuuqiseum potuuqisemu potuuqimsue potuuqimseu
potuuqimuse potuuqimues potuuqimeus potuuqimesu potuuqiumse potuuqiumes potuuqiusme potuuqiusem potuuqiuesm potuuqiuems
potuuqiemus potuuqiemsu potuuqieums potuuqieusm potuuqiesum potuuqiesmu potuuqesmiu potuuqesmui potuuqesimu potuuqesium
potuuqesuim potuuqesumi potuuqemsiu potuuqemsui potuuqemisu potuuqemius potuuqemuis potuuqemusi potuuqeimsu potuuqeimus
potuuqeismu potuuqeisum potuuqeiusm potuuqeiums potuuqeumis potuuqeumsi potuuqeuims potuuqeuism potuuqeusim potuuqeusmi
potuuiusqme potuuiusqem potuuiusmqe potuuiusmeq potuuiusemq potuuiuseqm potuuiuqsme potuuiuqsem potuuiuqmse potuuiuqmes
potuuiuqems potuuiuqesm potuuiumqse potuuiumqes potuuiumsqe potuuiumseq potuuiumesq potuuiumeqs potuuiueqms potuuiueqsm
potuuiuemqs potuuiuemsq potuuiuesmq potuuiuesqm potuuisuqme potuuisuqem potuuisumqe potuuisumeq potuuisuemq potuuisueqm
potuuisqume potuuisquem potuuisqmue potuuisqmeu potuuisqemu potuuisqeum potuuismque potuuismqeu potuuismuqe potuuismueq
potuuismeuq potuuismequ potuuiseqmu potuuisequm potuuisemqu potuuisemuq potuuiseumq potuuiseuqm potuuiqsume potuuiqsuem
potuuiqsmue potuuiqsmeu potuuiqsemu potuuiqseum potuuiqusme potuuiqusem potuuiqumse potuuiqumes potuuiquems potuuiquesm
potuuiqmuse potuuiqmues potuuiqmsue potuuiqmseu potuuiqmesu potuuiqmeus potuuiqeums potuuiqeusm potuuiqemus potuuiqemsu
potuuiqesmu potuuiqesum potuuimsque potuuimsqeu potuuimsuqe potuuimsueq potuuimseuq potuuimsequ potuuimqsue potuuimqseu
potuuimquse potuuimques potuuimqeus potuuimqesu potuuimuqse potuuimuqes potuuimusqe potuuimuseq potuuimuesq potuuimueqs
potuuimequs potuuimeqsu potuuimeuqs potuuimeusq potuuimesuq potuuimesqu potuuiesqmu potuuiesqum potuuiesmqu potuuiesmuq
potuuiesumq potuuiesuqm potuuieqsmu potuuieqsum potuuieqmsu potuuieqmus potuuiequms potuuiequsm potuuiemqsu potuuiemqus
potuuiemsqu potuuiemsuq potuuiemusq potuuiemuqs potuuieuqms potuuieuqsm potuuieumqs potuuieumsq potuuieusmq potuuieusqm
potuueusqim potuueusqmi potuueusiqm potuueusimq potuueusmiq potuueusmqi potuueuqsim potuueuqsmi potuueuqism potuueuqims
potuueuqmis potuueuqmsi potuueuiqsm potuueuiqms potuueuisqm potuueuismq potuueuimsq potuueuimqs potuueumqis potuueumqsi
potuueumiqs potuueumisq potuueumsiq potuueumsqi potuuesuqim potuuesuqmi potuuesuiqm potuuesuimq potuuesumiq potuuesumqi
potuuesquim potuuesqumi potuuesqium potuuesqimu potuuesqmiu potuuesqmui potuuesiqum potuuesiqmu potuuesiuqm potuuesiumq
potuuesimuq potuuesimqu potuuesmqiu potuuesmqui potuuesmiqu potuuesmiuq potuuesmuiq potuuesmuqi potuueqsuim potuueqsumi
potuueqsium potuueqsimu potuueqsmiu potuueqsmui potuuequsim potuuequsmi potuuequism potuuequims potuuequmis potuuequmsi
potuueqiusm potuueqiums potuueqisum potuueqismu potuueqimsu potuueqimus potuueqmuis potuueqmusi potuueqmius potuueqmisu
potuueqmsiu potuueqmsui potuueisqum potuueisqmu potuueisuqm potuueisumq potuueismuq potuueismqu potuueiqsum potuueiqsmu
potuueiqusm potuueiqums potuueiqmus potuueiqmsu potuueiuqsm potuueiuqms potuueiusqm potuueiusmq potuueiumsq potuueiumqs
potuueimqus potuueimqsu potuueimuqs potuueimusq potuueimsuq potuueimsqu potuuemsqiu potuuemsqui potuuemsiqu potuuemsiuq
potuuemsuiq potuuemsuqi potuuemqsiu potuuemqsui potuuemqisu potuuemqius potuuemquis potuuemqusi potuuemiqsu potuuemiqus
potuuemisqu potuuemisuq potuuemiusq potuuemiuqs potuuemuqis potuuemuqsi potuuemuiqs potuuemuisq potuuemusiq potuuemusqi
potuemusqui potuemusqiu potuemusuqi potuemusuiq potuemusiuq potuemusiqu potuemuqsui potuemuqsiu potuemuqusi potuemuquis
potuemuqius potuemuqisu potuemuuqsi potuemuuqis potuemuusqi potuemuusiq potuemuuisq potuemuuiqs potuemuiqus potuemuiqsu
potuemuiuqs potuemuiusq potuemuisuq potuemuisqu potuemsuqui potuemsuqiu potuemsuuqi potuemsuuiq potuemsuiuq potuemsuiqu
potuemsquui potuemsquiu potuemsquui potuemsquiu potuemsqiuu potuemsqiuu potuemsuqui potuemsuqiu potuemsuuqi potuemsuuiq
potuemsuiuq potuemsuiqu potuemsiquu potuemsiquu potuemsiuqu potuemsiuuq potuemsiuuq potuemsiuqu potuemqsuui potuemqsuiu
potuemqsuui potuemqsuiu potuemqsiuu potuemqsiuu potuemqusui potuemqusiu potuemquusi potuemquuis potuemquius potuemquisu
potuemquusi potuemquuis potuemqusui potuemqusiu potuemquisu potuemquius potuemqiuus potuemqiusu potuemqiuus potuemqiusu
potuemqisuu potuemqisuu potuemusqui potuemusqiu potuemusuqi potuemusuiq potuemusiuq potuemusiqu potuemuqsui potuemuqsiu
potuemuqusi potuemuquis potuemuqius potuemuqisu potuemuuqsi potuemuuqis potuemuusqi potuemuusiq potuemuuisq potuemuuiqs
potuemuiqus potuemuiqsu potuemuiuqs potuemuiusq potuemuisuq potuemuisqu potuemisquu potuemisquu potuemisuqu potuemisuuq
potuemisuuq potuemisuqu potuemiqsuu potuemiqsuu potuemiqusu potuemiquus potuemiquus potuemiqusu potuemiuqsu potuemiuqus
potuemiusqu potuemiusuq potuemiuusq potuemiuuqs potuemiuqus potuemiuqsu potuemiuuqs potuemiuusq potuemiusuq potuemiusqu
potueumsqui potueumsqiu potueumsuqi potueumsuiq potueumsiuq potueumsiqu potueumqsui potueumqsiu potueumqusi potueumquis
potueumqius potueumqisu potueumuqsi potueumuqis potueumusqi potueumusiq potueumuisq potueumuiqs potueumiqus potueumiqsu
potueumiuqs potueumiusq potueumisuq potueumisqu potueusmqui potueusmqiu potueusmuqi potueusmuiq potueusmiuq potueusmiqu
potueusqmui potueusqmiu potueusqumi potueusquim potueusqium potueusqimu potueusuqmi potueusuqim potueusumqi potueusumiq
potueusuimq potueusuiqm potueusiqum potueusiqmu potueusiuqm potueusiumq potueusimuq potueusimqu potueuqsmui potueuqsmiu
potueuqsumi potueuqsuim potueuqsium potueuqsimu potueuqmsui potueuqmsiu potueuqmusi potueuqmuis potueuqmius potueuqmisu
potueuqumsi potueuqumis potueuqusmi potueuqusim potueuquism potueuquims potueuqimus potueuqimsu potueuqiums potueuqiusm
potueuqisum potueuqismu potueuusqmi potueuusqim potueuusmqi potueuusmiq potueuusimq potueuusiqm potueuuqsmi potueuuqsim
potueuuqmsi potueuuqmis potueuuqims potueuuqism potueuumqsi potueuumqis potueuumsqi potueuumsiq potueuumisq potueuumiqs
potueuuiqms potueuuiqsm potueuuimqs potueuuimsq potueuuismq potueuuisqm potueuisqum potueuisqmu potueuisuqm potueuisumq
potueuismuq potueuismqu potueuiqsum potueuiqsmu potueuiqusm potueuiqums potueuiqmus potueuiqmsu potueuiuqsm potueuiuqms
potueuiusqm potueuiusmq potueuiumsq potueuiumqs potueuimqus potueuimqsu potueuimuqs potueuimusq potueuimsuq potueuimsqu
potuesumqui potuesumqiu potuesumuqi potuesumuiq potuesumiuq potuesumiqu potuesuqmui potuesuqmiu potuesuqumi potuesuquim
potuesuqium potuesuqimu potuesuuqmi potuesuuqim potuesuumqi potuesuumiq potuesuuimq potuesuuiqm potuesuiqum potuesuiqmu
potuesuiuqm potuesuiumq potuesuimuq potuesuimqu potuesmuqui potuesmuqiu potuesmuuqi potuesmuuiq potuesmuiuq potuesmuiqu
potuesmquui potuesmquiu potuesmquui potuesmquiu potuesmqiuu potuesmqiuu potuesmuqui potuesmuqiu potuesmuuqi potuesmuuiq
potuesmuiuq potuesmuiqu potuesmiquu potuesmiquu potuesmiuqu potuesmiuuq potuesmiuuq potuesmiuqu potuesqmuui potuesqmuiu
potuesqmuui potuesqmuiu potuesqmiuu potuesqmiuu potuesqumui potuesqumiu potuesquumi potuesquuim potuesquium potuesquimu
potuesquumi potuesquuim potuesqumui potuesqumiu potuesquimu potuesquium potuesqiuum potuesqiumu potuesqiuum potuesqiumu
potuesqimuu potuesqimuu potuesumqui potuesumqiu potuesumuqi potuesumuiq potuesumiuq potuesumiqu potuesuqmui potuesuqmiu
potuesuqumi potuesuquim potuesuqium potuesuqimu potuesuuqmi potuesuuqim potuesuumqi potuesuumiq potuesuuimq potuesuuiqm
potuesuiqum potuesuiqmu potuesuiuqm potuesuiumq potuesuimuq potuesuimqu potuesimquu potuesimquu potuesimuqu potuesimuuq
potuesimuuq potuesimuqu potuesiqmuu potuesiqmuu potuesiqumu potuesiquum potuesiquum potuesiqumu potuesiuqmu potuesiuqum
potuesiumqu potuesiumuq potuesiuumq potuesiuuqm potuesiuqum potuesiuqmu potuesiuuqm potuesiuumq potuesiumuq potuesiumqu
potuequsmui potuequsmiu potuequsumi potuequsuim potuequsium potuequsimu potuequmsui potuequmsiu potuequmusi potuequmuis
potuequmius potuequmisu potuequumsi potuequumis potuequusmi potuequusim potuequuism potuequuims potuequimus potuequimsu
potuequiums potuequiusm potuequisum potuequismu potueqsumui potueqsumiu potueqsuumi potueqsuuim potueqsuium potueqsuimu
potueqsmuui potueqsmuiu potueqsmuui potueqsmuiu potueqsmiuu potueqsmiuu potueqsumui potueqsumiu potueqsuumi potueqsuuim
potueqsuium potueqsuimu potueqsimuu potueqsimuu potueqsiumu potueqsiuum potueqsiuum potueqsiumu potueqmsuui potueqmsuiu
potueqmsuui potueqmsuiu potueqmsiuu potueqmsiuu potueqmusui potueqmusiu potueqmuusi potueqmuuis potueqmuius potueqmuisu
potueqmuusi potueqmuuis potueqmusui potueqmusiu potueqmuisu potueqmuius potueqmiuus potueqmiusu potueqmiuus potueqmiusu
potueqmisuu potueqmisuu potuequsmui potuequsmiu potuequsumi potuequsuim potuequsium potuequsimu potuequmsui potuequmsiu
potuequmusi potuequmuis potuequmius potuequmisu potuequumsi potuequumis potuequusmi potuequusim potuequuism potuequuims
potuequimus potuequimsu potuequiums potuequiusm potuequisum potuequismu potueqismuu potueqismuu potueqisumu potueqisuum
potueqisuum potueqisumu potueqimsuu potueqimsuu potueqimusu potueqimuus potueqimuus potueqimusu potueqiumsu potueqiumus
potueqiusmu potueqiusum potueqiuusm potueqiuums potueqiumus potueqiumsu potueqiuums potueqiuusm potueqiusum potueqiusmu
potueuusqmi potueuusqim potueuusmqi potueuusmiq potueuusimq potueuusiqm potueuuqsmi potueuuqsim potueuuqmsi potueuuqmis
potueuuqims potueuuqism potueuumqsi potueuumqis potueuumsqi potueuumsiq potueuumisq potueuumiqs potueuuiqms potueuuiqsm
potueuuimqs potueuuimsq potueuuismq potueuuisqm potueusuqmi potueusuqim potueusumqi potueusumiq potueusuimq potueusuiqm
potueusqumi potueusquim potueusqmui potueusqmiu potueusqimu potueusqium potueusmqui potueusmqiu potueusmuqi potueusmuiq
potueusmiuq potueusmiqu potueusiqmu potueusiqum potueusimqu potueusimuq potueusiumq potueusiuqm potueuqsumi potueuqsuim
potueuqsmui potueuqsmiu potueuqsimu potueuqsium potueuqusmi potueuqusim potueuqumsi potueuqumis potueuquims potueuquism
potueuqmusi potueuqmuis potueuqmsui potueuqmsiu potueuqmisu potueuqmius potueuqiums potueuqiusm potueuqimus potueuqimsu
potueuqismu potueuqisum potueumsqui potueumsqiu potueumsuqi potueumsuiq potueumsiuq potueumsiqu potueumqsui potueumqsiu
potueumqusi potueumquis potueumqius potueumqisu potueumuqsi potueumuqis potueumusqi potueumusiq potueumuisq potueumuiqs
potueumiqus potueumiqsu potueumiuqs potueumiusq potueumisuq potueumisqu potueuisqmu potueuisqum potueuismqu potueuismuq
potueuisumq potueuisuqm potueuiqsmu potueuiqsum potueuiqmsu potueuiqmus potueuiqums potueuiqusm potueuimqsu potueuimqus
potueuimsqu potueuimsuq potueuimusq potueuimuqs potueuiuqms potueuiuqsm potueuiumqs potueuiumsq potueuiusmq potueuiusqm
potueiusqum potueiusqmu potueiusuqm potueiusumq potueiusmuq potueiusmqu potueiuqsum potueiuqsmu potueiuqusm potueiuqums
potueiuqmus potueiuqmsu potueiuuqsm potueiuuqms potueiuusqm potueiuusmq potueiuumsq potueiuumqs potueiumqus potueiumqsu
potueiumuqs potueiumusq potueiumsuq potueiumsqu potueisuqum potueisuqmu potueisuuqm potueisuumq potueisumuq potueisumqu
potueisquum potueisqumu potueisquum potueisqumu potueisqmuu potueisqmuu potueisuqum potueisuqmu potueisuuqm potueisuumq
potueisumuq potueisumqu potueismquu potueismquu potueismuqu potueismuuq potueismuuq potueismuqu potueiqsuum potueiqsumu
potueiqsuum potueiqsumu potueiqsmuu potueiqsmuu potueiqusum potueiqusmu potueiquusm potueiquums potueiqumus potueiqumsu
potueiquusm potueiquums potueiqusum potueiqusmu potueiqumsu potueiqumus potueiqmuus potueiqmusu potueiqmuus potueiqmusu
potueiqmsuu potueiqmsuu potueiusqum potueiusqmu potueiusuqm potueiusumq potueiusmuq potueiusmqu potueiuqsum potueiuqsmu
potueiuqusm potueiuqums potueiuqmus potueiuqmsu potueiuuqsm potueiuuqms potueiuusqm potueiuusmq potueiuumsq potueiuumqs
potueiumqus potueiumqsu potueiumuqs potueiumusq potueiumsuq potueiumsqu potueimsquu potueimsquu potueimsuqu potueimsuuq
potueimsuuq potueimsuqu potueimqsuu potueimqsuu potueimqusu potueimquus potueimquus potueimqusu potueimuqsu potueimuqus
potueimusqu potueimusuq potueimuusq potueimuuqs potueimuqus potueimuqsu potueimuuqs potueimuusq potueimusuq potueimusqu

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us