easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

dissyllabify

hatchminder

testiculated

kolker

draytonplains

daalder

madey

contraregularity

steny

mbuba

viharo

accusatively

stare

tudisco

talebook

swisse

ghione

branko


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: portendereque
cipher variations:
qpsufoefsfrvf rqtvgpfgtgswg sruwhqghuhtxh tsvxirhiviuyi utwyjsijwjvzj
vuxzktjkxkwak wvyaluklylxbl xwzbmvlmzmycm yxacnwmnanzdn zybdoxnoboaeo
azcepyopcpbfp badfqzpqdqcgq cbegraqrerdhr dcfhsbrsfseis edgitcstgtfjt
fehjudtuhugku gfikveuvivhlv hgjlwfvwjwimw ihkmxgwxkxjnx jilnyhxylykoy
kjmoziyzmzlpz lknpajzanamqa mloqbkabobnrb nmprclbcpcosc onqsdmcdqdptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: portendereque
Cipher: kligvmwvivjfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: portendereque
Cipher: ABBBA ABBAB BAAAA BAABA AABAA ABBAA AAABB AABAA BAAAA AABAA ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: portendereque
cipher variations:
qpsufoefsfrvfuragnoknanxjnytisvoqvivdxvcvqedowdqdjldgxyqloclylpzlkzgctoitgtvntsdwajoujwjhpjwfemroarerndr
ahmyzogzmztrzejukhomhuhzfhilcwpospcpftpmnkixoyxkxlhxrqtvgpfgtgswgvsbhoploboykozujtwprwjweywdwrfepxerekme
hyzrmpdmzmqamlahdupjuhuwoutexbkpvkxkiqkxgfnspbsfsoesbinzaphanausafkvlipniviagijmdxqptqdqguqnoljypzylymiy
sruwhqghuhtxhwtcipqmpcpzlpavkuxqsxkxfzxexsgfqyfsflnfizasnqenanrbnmbievqkvivxpvufyclqwlyljrlyhgotqctgtpft
cjoabqibobvtbglwmjqojwjbhjkneyrqurerhvropmkzqazmznjztsvxirhiviuyixudjqrnqdqamqbwlvyrtylygayfythgrzgtgmog
jabtorfobosconcjfwrlwjwyqwvgzdmrxmzmksmzihpurduhuqgudkpbcrjcpcwuchmxnkrpkxkciklofzsrvsfsiwspqnlarbanaoka
utwyjsijwjvzjyvekrsorerbnrcxmwzsuzmzhbzgzuihsahuhnphkbcupsgpcptdpodkgxsmxkxzrxwhaensynanltnajiqvsevivrhv
elqcdskdqdxvdinyolsqlyldjlmpgatswtgtjxtqrombscbobplbvuxzktjkxkwakzwflstpsfscosdynxatvanaicahavjitbivioqi
lcdvqthqdqueqpelhytnylyasyxibfotzobomuobkjrwtfwjwsiwfmrdetlereywejozpmtrmzmekmnqhbutxuhukyurspnctdcpcqmc
wvyaluklylxblaxgmtuqtgtdptezoybuwbobjdbibwkjucjwjprjmdewruirervfrqfmizuozmzbtzyjcgpuapcpnvpclksxugxkxtjx
gnsefumfsfzxfkpaqnusnanflnoricvuyvivlzvstqoduedqdrndxwzbmvlmzmycmbyhnuvruhuequfapzcvxcpckecjcxlkvdkxkqsk
nefxsvjsfswgsrgnjavpanacuazkdhqvbqdqowqdmltyvhylyukyhotfgvngtgayglqbrovtobogmopsjdwvzwjwmawturpevferesoe
yxacnwmnanzdncziovwsvivfrvgbqadwydqdlfdkdymlwelylrtlofgytwktgtxhtshokbwqbobdvbaleirwcrerpxrenmuzwizmzvlz
ipughwohuhbzhmrcspwupcphnpqtkexwaxkxnbxuvsqfwgfsftpfzybdoxnoboaeodajpwxtwjwgswhcrbexzeremgeleznmxfmzmsum
pghzuxluhuyiutiplcxrcpcewcbmfjsxdsfsqysfonvaxjanawmajqvhixpivicainsdtqxvqdqioqrulfyxbylyocyvwtrgxhgtguqg
azcepyopcpbfpebkqxyuxkxhtxidscfyafsfnhfmfaonygnantvnqhiavymvivzjvujqmdysdqdfxdcngktyetgtrztgpowbykbobxnb
krwijyqjwjdbjoteurywrerjprsvmgzyczmzpdzwxushyihuhvrhbadfqzpqdqcgqfclryzvylyiuyjetdgzbgtgoigngbpozhobouwo
rijbwznwjwakwvkrnezteregyedohluzfuhusauhqpxczlcpcyoclsxjkzrkxkeckpufvszxsfskqstwnhazdanaqeaxyvtizjiviwsi
cbegraqrerdhrgdmszawzmzjvzkfuehachuhpjhohcqpaipcpvxpsjkcxaoxkxblxwlsofaufsfhzfepimvagvivtbvirqydamdqdzpd
mtyklaslylfdlqvgwtaytgtlrtuxoibaebobrfbyzwujakjwjxtjdcfhsbrsfseishentabxanakwalgvfibdiviqkipidrqbjqdqwyq
tkldybpylycmyxmtpgbvgtgiagfqjnwbhwjwucwjsrzebnereaqenuzlmbtmzmgemrwhxubzuhumsuvypjcbfcpcsgczaxvkblkxkyuk
edgitcstgtfjtifoubcyboblxbmhwgjcejwjrljqjesrckrerxzrulmezcqzmzdnzynuqhcwhuhjbhgrkoxcixkxvdxktsafcofsfbrf
ovamncunanhfnsxiyvcavivntvwzqkdcgdqdthdabywlcmlylzvlfehjudtuhugkujgpvcdzcpcmycnixhkdfkxksmkrkftsdlsfsyas
vmnfadranaeoazovridxivikcihslpydjylyweylutbgdpgtgcsgpwbnodvoboigotyjzwdbwjwouwxarledhereuiebczxmdnmzmawm
gfikveuvivhlvkhqwdeadqdnzdojyileglyltnlslgutemtgtzbtwnogbesbobfpbapwsjeyjwjldjitmqzekzmzxfzmvucheqhuhdth
qxcopewpcpjhpuzkaxecxkxpvxybsmfeifsfvjfcdayneonanbxnhgjlwfvwjwimwlirxefbereoaepkzjmfhmzmuomtmhvufnuhuacu
xophcftcpcgqcbqxtkfzkxkmekjunraflanayganwvdifrivieuirydpqfxqdqkiqvalbyfdylyqwyzctngfjgtgwkgdebzofpobocyo
ihkmxgwxkxjnxmjsyfgcfsfpbfqlaknginanvpnuniwvgovivbdvypqidgudqdhrdcryulgalylnflkvosbgmbobzhboxwejgsjwjfvj
szeqrgyrerljrwbmczgezmzrxzaduohgkhuhxlhefcapgqpcpdzpjilnyhxylykoynktzghdgtgqcgrmblohjobowqovojxwhpwjwcew
zqrjehvereisedszvmhbmzmogmlwptchncpcaicpyxfkhtkxkgwktafrshzsfsmksxcndahfanasyabevpihliviymifgdbqhrqdqeaq
kjmoziyzmzlpzoluahiehuhrdhsncmpikpcpxrpwpkyxiqxkxdfxarskfiwfsfjtfetawnicnanphnmxqudiodqdbjdqzygliulylhxl
ubgstiatgtnltydoebigbobtzbcfwqjimjwjznjghecrisrerfbrlknpajzanamqapmvbijfiviseitodnqjlqdqysqxqlzyjrylyegy
bstlgjxgtgkugfubxojdoboqionyrvejpereckerazhmjvmzmiymvchtujbuhuomuzepfcjhcpcuacdgxrkjnkxkaokhifdsjtsfsgcs
mloqbkabobnrbqnwcjkgjwjtfjupeorkmrerztryrmazkszmzfhzctumhkyhuhlvhgvcypkepcprjpozswfkqfsfdlfsbainkwnanjzn
wdiuvkcvivpnvafqgdkidqdvbdehyslkolylbplijgetkutgthdtnmprclbcpcoscroxdklhkxkugkvqfpslnsfsauszsnbaltanagia
duvnilzivimwihwdzqlfqdqskqpatxglrgtgemgtcbjolxobokaoxejvwldwjwqowbgrheljerewcefiztmlpmzmcqmjkhfulvuhuieu
onqsdmcdqdptdspyelmilylvhlwrgqtmotgtbvtatocbmubobhjbevwojmajwjnxjixearmgrertlrqbuyhmshuhfnhudckpmypcplbp
yfkwxmexkxrpxchsifmkfsfxdfgjaunmqnandrnkligvmwvivjfvportenderequetqzfmnjmzmwimxshrunpuhucwubupdcnvcpcikc
fwxpknbkxkoykjyfbsnhsfsumsrcvzintivigoivedlqnzqdqmcqzglxynfylysqyditjgnlgtgyeghkbvonroboesolmjhwnxwjwkgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: portendereque
Cipher: cbegraqrerdhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: portendereque
Cipher: 53432444513341512451145451

Extended Methods:
Method #1

Plaintext: portendereque
method variations:
utwyksikwkvzkzybdpxopbpaepedgiuctugufkukimozhyzmzlpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
p o r t e n d e r e q u e 
5 4 2 4 5 3 4 5 2 5 1 5 5 
3 3 4 4 1 3 1 1 4 1 4 4 1 
They are then read out in rows:
54245345251553344131141441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: portendereque
Cipher: urpywvpsdcqqd

Read more ...
Method #3

Plaintext: portendereque
method variations:
shtylsvfyayyv htylsvfyayyvs tylsvfyayyvsh
ylsvfyayyvsht lsvfyayyvshty svfyayyvshtyl
vfyayyvshtyls fyayyvshtylsv yayyvshtylsvf
ayyvshtylsvfy yyvshtylsvfya yvshtylsvfyay
vshtylsvfyayy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: portendereque

first 5040 cipher variations(6187239489 total)
portendereque portendereqeu portendereuqe portendereueq portendereeuq portendereequ portenderqeue portenderqeeu portenderquee
portenderquee portenderqeue portenderqeeu portenderuqee portenderuqee portenderueqe portenderueeq portenderueeq portenderueqe
portendereque portendereqeu portendereuqe portendereueq portendereeuq portendereequ portendeerque portendeerqeu portendeeruqe
portendeerueq portendeereuq portendeerequ portendeeqrue portendeeqreu portendeequre portendeequer portendeeqeur portendeeqeru
portendeeuqre portendeeuqer portendeeurqe portendeeureq portendeeuerq portendeeueqr portendeeequr portendeeeqru portendeeeuqr
portendeeeurq portendeeeruq portendeeerqu portendeqerue portendeqereu portendeqeure portendeqeuer portendeqeeur portendeqeeru
portendeqreue portendeqreeu portendeqruee portendeqruee portendeqreue portendeqreeu portendequree portendequree portendequere
portendequeer portendequeer portendequere portendeqerue portendeqereu portendeqeure portendeqeuer portendeqeeur portendeqeeru
portendeueqre portendeueqer portendeuerqe portendeuereq portendeueerq portendeueeqr portendeuqere portendeuqeer portendeuqree
portendeuqree portendeuqere portendeuqeer portendeurqee portendeurqee portendeureqe portendeureeq portendeureeq portendeureqe
portendeueqre portendeueqer portendeuerqe portendeuereq portendeueerq portendeueeqr portendeeequr portendeeeqru portendeeeuqr
portendeeeurq portendeeeruq portendeeerqu portendeeqeur portendeeqeru portendeequer portendeequre portendeeqrue portendeeqreu
portendeeuqer portendeeuqre portendeeueqr portendeeuerq portendeeureq portendeeurqe portendeerque portendeerqeu portendeeruqe
portendeerueq portendeereuq portendeerequ portendreeque portendreeqeu portendreeuqe portendreeueq portendreeeuq portendreeequ
portendreqeue portendreqeeu portendrequee portendrequee portendreqeue portendreqeeu portendreuqee portendreuqee portendreueqe
portendreueeq portendreueeq portendreueqe portendreeque portendreeqeu portendreeuqe portendreeueq portendreeeuq portendreeequ
portendreeque portendreeqeu portendreeuqe portendreeueq portendreeeuq portendreeequ portendreqeue portendreqeeu portendrequee
portendrequee portendreqeue portendreqeeu portendreuqee portendreuqee portendreueqe portendreueeq portendreueeq portendreueqe
portendreeque portendreeqeu portendreeuqe portendreeueq portendreeeuq portendreeequ portendrqeeue portendrqeeeu portendrqeuee
portendrqeuee portendrqeeue portendrqeeeu portendrqeeue portendrqeeeu portendrqeuee portendrqeuee portendrqeeue portendrqeeeu
portendrqueee portendrqueee portendrqueee portendrqueee portendrqueee portendrqueee portendrqeeue portendrqeeeu portendrqeuee
portendrqeuee portendrqeeue portendrqeeeu portendrueqee portendrueqee portendrueeqe portendrueeeq portendrueeeq portendrueeqe
portendruqeee portendruqeee portendruqeee portendruqeee portendruqeee portendruqeee portendrueqee portendrueqee portendrueeqe
portendrueeeq portendrueeeq portendrueeqe portendrueqee portendrueqee portendrueeqe portendrueeeq portendrueeeq portendrueeqe
portendreeque portendreeqeu portendreeuqe portendreeueq portendreeeuq portendreeequ portendreqeue portendreqeeu portendrequee
portendrequee portendreqeue portendreqeeu portendreuqee portendreuqee portendreueqe portendreueeq portendreueeq portendreueqe
portendreeque portendreeqeu portendreeuqe portendreeueq portendreeeuq portendreeequ portendereque portendereqeu portendereuqe
portendereueq portendereeuq portendereequ portenderqeue portenderqeeu portenderquee portenderquee portenderqeue portenderqeeu
portenderuqee portenderuqee portenderueqe portenderueeq portenderueeq portenderueqe portendereque portendereqeu portendereuqe
portendereueq portendereeuq portendereequ portendeerque portendeerqeu portendeeruqe portendeerueq portendeereuq portendeerequ
portendeeqrue portendeeqreu portendeequre portendeequer portendeeqeur portendeeqeru portendeeuqre portendeeuqer portendeeurqe
portendeeureq portendeeuerq portendeeueqr portendeeequr portendeeeqru portendeeeuqr portendeeeurq portendeeeruq portendeeerqu
portendeqerue portendeqereu portendeqeure portendeqeuer portendeqeeur portendeqeeru portendeqreue portendeqreeu portendeqruee
portendeqruee portendeqreue portendeqreeu portendequree portendequree portendequere portendequeer portendequeer portendequere
portendeqerue portendeqereu portendeqeure portendeqeuer portendeqeeur portendeqeeru portendeueqre portendeueqer portendeuerqe
portendeuereq portendeueerq portendeueeqr portendeuqere portendeuqeer portendeuqree portendeuqree portendeuqere portendeuqeer
portendeurqee portendeurqee portendeureqe portendeureeq portendeureeq portendeureqe portendeueqre portendeueqer portendeuerqe
portendeuereq portendeueerq portendeueeqr portendeeequr portendeeeqru portendeeeuqr portendeeeurq portendeeeruq portendeeerqu
portendeeqeur portendeeqeru portendeequer portendeequre portendeeqrue portendeeqreu portendeeuqer portendeeuqre portendeeueqr
portendeeuerq portendeeureq portendeeurqe portendeerque portendeerqeu portendeeruqe portendeerueq portendeereuq portendeerequ
portendqreeue portendqreeeu portendqreuee portendqreuee portendqreeue portendqreeeu portendqreeue portendqreeeu portendqreuee
portendqreuee portendqreeue portendqreeeu portendqrueee portendqrueee portendqrueee portendqrueee portendqrueee portendqrueee
portendqreeue portendqreeeu portendqreuee portendqreuee portendqreeue portendqreeeu portendqereue portendqereeu portendqeruee
portendqeruee portendqereue portendqereeu portendqeerue portendqeereu portendqeeure portendqeeuer portendqeeeur portendqeeeru
portendqeuere portendqeueer portendqeuree portendqeuree portendqeuere portendqeueer portendqeeeur portendqeeeru portendqeeuer
portendqeeure portendqeerue portendqeereu portendqeerue portendqeereu portendqeeure portendqeeuer portendqeeeur portendqeeeru
portendqereue portendqereeu portendqeruee portendqeruee portendqereue portendqereeu portendqeuree portendqeuree portendqeuere
portendqeueer portendqeueer portendqeuere portendqeerue portendqeereu portendqeeure portendqeeuer portendqeeeur portendqeeeru
portendqueere portendqueeer portendqueree portendqueree portendqueere portendqueeer portendqueere portendqueeer portendqueree
portendqueree portendqueere portendqueeer portendqureee portendqureee portendqureee portendqureee portendqureee portendqureee
portendqueere portendqueeer portendqueree portendqueree portendqueere portendqueeer portendqeeeur portendqeeeru portendqeeuer
portendqeeure portendqeerue portendqeereu portendqeeeur portendqeeeru portendqeeuer portendqeeure portendqeerue portendqeereu
portendqeueer portendqeuere portendqeueer portendqeuere portendqeuree portendqeuree portendqereue portendqereeu portendqeruee
portendqeruee portendqereue portendqereeu portendureqee portendureqee portendureeqe portendureeeq portendureeeq portendureeqe
portendurqeee portendurqeee portendurqeee portendurqeee portendurqeee portendurqeee portendureqee portendureqee portendureeqe
portendureeeq portendureeeq portendureeqe portendureqee portendureqee portendureeqe portendureeeq portendureeeq portendureeqe
portenduerqee portenduerqee portenduereqe portenduereeq portenduereeq portenduereqe portendueqree portendueqree portendueqere
portendueqeer portendueqeer portendueqere portendueeqre portendueeqer portendueerqe portendueereq portendueeerq portendueeeqr
portendueeqer portendueeqre portendueeeqr portendueeerq portendueereq portendueerqe portenduqeree portenduqeree portenduqeere
portenduqeeer portenduqeeer portenduqeere portenduqreee portenduqreee portenduqreee portenduqreee portenduqreee portenduqreee
portenduqeree portenduqeree portenduqeere portenduqeeer portenduqeeer portenduqeere portenduqeree portenduqeree portenduqeere
portenduqeeer portenduqeeer portenduqeere portendueeqre portendueeqer portendueerqe portendueereq portendueeerq portendueeeqr
portendueqere portendueqeer portendueqree portendueqree portendueqere portendueqeer portenduerqee portenduerqee portenduereqe
portenduereeq portenduereeq portenduereqe portendueeqre portendueeqer portendueerqe portendueereq portendueeerq portendueeeqr
portendueeqer portendueeqre portendueeeqr portendueeerq portendueereq portendueerqe portendueqeer portendueqere portendueqeer
portendueqere portendueqree portendueqree portendueeqer portendueeqre portendueeeqr portendueeerq portendueereq portendueerqe
portenduerqee portenduerqee portenduereqe portenduereeq portenduereeq portenduereqe portendereque portendereqeu portendereuqe
portendereueq portendereeuq portendereequ portenderqeue portenderqeeu portenderquee portenderquee portenderqeue portenderqeeu
portenderuqee portenderuqee portenderueqe portenderueeq portenderueeq portenderueqe portendereque portendereqeu portendereuqe
portendereueq portendereeuq portendereequ portendeerque portendeerqeu portendeeruqe portendeerueq portendeereuq portendeerequ
portendeeqrue portendeeqreu portendeequre portendeequer portendeeqeur portendeeqeru portendeeuqre portendeeuqer portendeeurqe
portendeeureq portendeeuerq portendeeueqr portendeeequr portendeeeqru portendeeeuqr portendeeeurq portendeeeruq portendeeerqu
portendeqerue portendeqereu portendeqeure portendeqeuer portendeqeeur portendeqeeru portendeqreue portendeqreeu portendeqruee
portendeqruee portendeqreue portendeqreeu portendequree portendequree portendequere portendequeer portendequeer portendequere
portendeqerue portendeqereu portendeqeure portendeqeuer portendeqeeur portendeqeeru portendeueqre portendeueqer portendeuerqe
portendeuereq portendeueerq portendeueeqr portendeuqere portendeuqeer portendeuqree portendeuqree portendeuqere portendeuqeer
portendeurqee portendeurqee portendeureqe portendeureeq portendeureeq portendeureqe portendeueqre portendeueqer portendeuerqe
portendeuereq portendeueerq portendeueeqr portendeeequr portendeeeqru portendeeeuqr portendeeeurq portendeeeruq portendeeerqu
portendeeqeur portendeeqeru portendeequer portendeequre portendeeqrue portendeeqreu portendeeuqer portendeeuqre portendeeueqr
portendeeuerq portendeeureq portendeeurqe portendeerque portendeerqeu portendeeruqe portendeerueq portendeereuq portendeerequ
portenedreque portenedreqeu portenedreuqe portenedreueq portenedreeuq portenedreequ portenedrqeue portenedrqeeu portenedrquee
portenedrquee portenedrqeue portenedrqeeu portenedruqee portenedruqee portenedrueqe portenedrueeq portenedrueeq portenedrueqe
portenedreque portenedreqeu portenedreuqe portenedreueq portenedreeuq portenedreequ portenederque portenederqeu portenederuqe
portenederueq portenedereuq portenederequ portenedeqrue portenedeqreu portenedequre portenedequer portenedeqeur portenedeqeru
portenedeuqre portenedeuqer portenedeurqe portenedeureq portenedeuerq portenedeueqr portenedeequr portenedeeqru portenedeeuqr
portenedeeurq portenedeeruq portenedeerqu portenedqerue portenedqereu portenedqeure portenedqeuer portenedqeeur portenedqeeru
portenedqreue portenedqreeu portenedqruee portenedqruee portenedqreue portenedqreeu portenedquree portenedquree portenedquere
portenedqueer portenedqueer portenedquere portenedqerue portenedqereu portenedqeure portenedqeuer portenedqeeur portenedqeeru
portenedueqre portenedueqer porteneduerqe porteneduereq portenedueerq portenedueeqr porteneduqere porteneduqeer porteneduqree
porteneduqree porteneduqere porteneduqeer portenedurqee portenedurqee portenedureqe portenedureeq portenedureeq portenedureqe
portenedueqre portenedueqer porteneduerqe porteneduereq portenedueerq portenedueeqr portenedeequr portenedeeqru portenedeeuqr
portenedeeurq portenedeeruq portenedeerqu portenedeqeur portenedeqeru portenedequer portenedequre portenedeqrue portenedeqreu
portenedeuqer portenedeuqre portenedeueqr portenedeuerq portenedeureq portenedeurqe portenederque portenederqeu portenederuqe
portenederueq portenedereuq portenederequ portenerdeque portenerdeqeu portenerdeuqe portenerdeueq portenerdeeuq portenerdeequ
portenerdqeue portenerdqeeu portenerdquee portenerdquee portenerdqeue portenerdqeeu portenerduqee portenerduqee portenerdueqe
portenerdueeq portenerdueeq portenerdueqe portenerdeque portenerdeqeu portenerdeuqe portenerdeueq portenerdeeuq portenerdeequ
porteneredque porteneredqeu portenereduqe porteneredueq porteneredeuq porteneredequ portenereqdue portenereqdeu portenerequde
portenerequed portenereqeud portenereqedu portenereuqde portenereuqed portenereudqe portenereudeq portenereuedq portenereueqd
portenereequd portenereeqdu portenereeuqd portenereeudq portenereeduq portenereedqu portenerqedue portenerqedeu portenerqeude
portenerqeued portenerqeeud portenerqeedu portenerqdeue portenerqdeeu portenerqduee portenerqduee portenerqdeue portenerqdeeu
portenerqudee portenerqudee portenerquede portenerqueed portenerqueed portenerquede portenerqedue portenerqedeu portenerqeude
portenerqeued portenerqeeud portenerqeedu portenerueqde portenerueqed porteneruedqe porteneruedeq portenerueedq portenerueeqd
porteneruqede porteneruqeed porteneruqdee porteneruqdee porteneruqede porteneruqeed portenerudqee portenerudqee portenerudeqe
portenerudeeq portenerudeeq portenerudeqe portenerueqde portenerueqed porteneruedqe porteneruedeq portenerueedq portenerueeqd
portenereequd portenereeqdu portenereeuqd portenereeudq portenereeduq portenereedqu portenereqeud portenereqedu portenerequed
portenerequde portenereqdue portenereqdeu portenereuqed portenereuqde portenereueqd portenereuedq portenereudeq portenereudqe
porteneredque porteneredqeu portenereduqe porteneredueq porteneredeuq porteneredequ porteneerdque porteneerdqeu porteneerduqe
porteneerdueq porteneerdeuq porteneerdequ porteneerqdue porteneerqdeu porteneerqude porteneerqued porteneerqeud porteneerqedu
porteneeruqde porteneeruqed porteneerudqe porteneerudeq porteneeruedq porteneerueqd porteneerequd porteneereqdu porteneereuqd
porteneereudq porteneereduq porteneeredqu porteneedrque porteneedrqeu porteneedruqe porteneedrueq porteneedreuq porteneedrequ
porteneedqrue porteneedqreu porteneedqure porteneedquer porteneedqeur porteneedqeru porteneeduqre porteneeduqer porteneedurqe
porteneedureq porteneeduerq porteneedueqr porteneedequr porteneedeqru porteneedeuqr porteneedeurq porteneederuq porteneederqu
porteneeqdrue porteneeqdreu porteneeqdure porteneeqduer porteneeqdeur porteneeqderu porteneeqrdue porteneeqrdeu porteneeqrude
porteneeqrued porteneeqreud porteneeqredu porteneequrde porteneequred porteneequdre porteneequder porteneequedr porteneequerd
porteneeqerud porteneeqerdu porteneeqeurd porteneeqeudr porteneeqedur porteneeqedru porteneeudqre porteneeudqer porteneeudrqe
porteneeudreq porteneeuderq porteneeudeqr porteneeuqdre porteneeuqder porteneeuqrde porteneeuqred porteneeuqerd porteneeuqedr
porteneeurqde porteneeurqed porteneeurdqe porteneeurdeq porteneeuredq porteneeureqd porteneeueqrd porteneeueqdr porteneeuerqd
porteneeuerdq porteneeuedrq porteneeuedqr porteneeedqur porteneeedqru porteneeeduqr porteneeedurq porteneeedruq porteneeedrqu
porteneeeqdur porteneeeqdru porteneeequdr porteneeequrd porteneeeqrud porteneeeqrdu porteneeeuqdr porteneeeuqrd porteneeeudqr
porteneeeudrq porteneeeurdq porteneeeurqd porteneeerqud porteneeerqdu porteneeeruqd porteneeerudq porteneeerduq porteneeerdqu
porteneqredue porteneqredeu porteneqreude porteneqreued porteneqreeud porteneqreedu porteneqrdeue porteneqrdeeu porteneqrduee
porteneqrduee porteneqrdeue porteneqrdeeu porteneqrudee porteneqrudee porteneqruede porteneqrueed porteneqrueed porteneqruede
porteneqredue porteneqredeu porteneqreude porteneqreued porteneqreeud porteneqreedu porteneqerdue porteneqerdeu porteneqerude
porteneqerued porteneqereud porteneqeredu porteneqedrue porteneqedreu porteneqedure porteneqeduer porteneqedeur porteneqederu
porteneqeudre porteneqeuder porteneqeurde porteneqeured porteneqeuerd porteneqeuedr porteneqeedur porteneqeedru porteneqeeudr
porteneqeeurd porteneqeerud porteneqeerdu porteneqderue porteneqdereu porteneqdeure porteneqdeuer porteneqdeeur porteneqdeeru
porteneqdreue porteneqdreeu porteneqdruee porteneqdruee porteneqdreue porteneqdreeu porteneqduree porteneqduree porteneqduere
porteneqdueer porteneqdueer porteneqduere porteneqderue porteneqdereu porteneqdeure porteneqdeuer porteneqdeeur porteneqdeeru
portenequedre portenequeder portenequerde portenequered portenequeerd portenequeedr portenequdere portenequdeer portenequdree
portenequdree portenequdere portenequdeer portenequrdee portenequrdee portenequrede portenequreed portenequreed portenequrede
portenequedre portenequeder portenequerde portenequered portenequeerd portenequeedr porteneqeedur porteneqeedru porteneqeeudr
porteneqeeurd porteneqeerud porteneqeerdu porteneqedeur porteneqederu porteneqeduer porteneqedure porteneqedrue porteneqedreu
porteneqeuder porteneqeudre porteneqeuedr porteneqeuerd porteneqeured porteneqeurde porteneqerdue porteneqerdeu porteneqerude
porteneqerued porteneqereud porteneqeredu porteneureqde porteneureqed porteneuredqe porteneuredeq porteneureedq porteneureeqd
porteneurqede porteneurqeed porteneurqdee porteneurqdee porteneurqede porteneurqeed porteneurdqee porteneurdqee porteneurdeqe
porteneurdeeq porteneurdeeq porteneurdeqe porteneureqde porteneureqed porteneuredqe porteneuredeq porteneureedq porteneureeqd
porteneuerqde porteneuerqed porteneuerdqe porteneuerdeq porteneueredq porteneuereqd porteneueqrde porteneueqred porteneueqdre
porteneueqder porteneueqedr porteneueqerd porteneuedqre porteneuedqer porteneuedrqe porteneuedreq porteneuederq porteneuedeqr
porteneueeqdr porteneueeqrd porteneueedqr porteneueedrq porteneueerdq porteneueerqd porteneuqerde porteneuqered porteneuqedre
porteneuqeder porteneuqeedr porteneuqeerd porteneuqrede porteneuqreed porteneuqrdee porteneuqrdee porteneuqrede porteneuqreed
porteneuqdree porteneuqdree porteneuqdere porteneuqdeer porteneuqdeer porteneuqdere porteneuqerde porteneuqered porteneuqedre
porteneuqeder porteneuqeedr porteneuqeerd porteneudeqre porteneudeqer porteneuderqe porteneudereq porteneudeerq porteneudeeqr
porteneudqere porteneudqeer porteneudqree porteneudqree porteneudqere porteneudqeer porteneudrqee porteneudrqee porteneudreqe
porteneudreeq porteneudreeq porteneudreqe porteneudeqre porteneudeqer porteneuderqe porteneudereq porteneudeerq porteneudeeqr
porteneueeqdr porteneueeqrd porteneueedqr porteneueedrq porteneueerdq porteneueerqd porteneueqedr porteneueqerd porteneueqder
porteneueqdre porteneueqrde porteneueqred porteneuedqer porteneuedqre porteneuedeqr porteneuederq porteneuedreq porteneuedrqe
porteneuerqde porteneuerqed porteneuerdqe porteneuerdeq porteneueredq porteneuereqd porteneerequd porteneereqdu porteneereuqd
porteneereudq porteneereduq porteneeredqu porteneerqeud porteneerqedu porteneerqued porteneerqude porteneerqdue porteneerqdeu
porteneeruqed porteneeruqde porteneerueqd porteneeruedq porteneerudeq porteneerudqe porteneerdque porteneerdqeu porteneerduqe
porteneerdueq porteneerdeuq porteneerdequ porteneeerqud porteneeerqdu porteneeeruqd porteneeerudq porteneeerduq porteneeerdqu
porteneeeqrud porteneeeqrdu porteneeequrd porteneeequdr porteneeeqdur porteneeeqdru porteneeeuqrd porteneeeuqdr porteneeeurqd
porteneeeurdq porteneeeudrq porteneeeudqr porteneeedqur porteneeedqru porteneeeduqr porteneeedurq porteneeedruq porteneeedrqu
porteneeqerud porteneeqerdu porteneeqeurd porteneeqeudr porteneeqedur porteneeqedru porteneeqreud porteneeqredu porteneeqrued
porteneeqrude porteneeqrdue porteneeqrdeu porteneequred porteneequrde porteneequerd porteneequedr porteneequder porteneequdre
porteneeqdrue porteneeqdreu porteneeqdure porteneeqduer porteneeqdeur porteneeqderu porteneeueqrd porteneeueqdr porteneeuerqd
porteneeuerdq porteneeuedrq porteneeuedqr porteneeuqerd porteneeuqedr porteneeuqred porteneeuqrde porteneeuqdre porteneeuqder
porteneeurqed porteneeurqde porteneeureqd porteneeuredq porteneeurdeq porteneeurdqe porteneeudqre porteneeudqer porteneeudrqe
porteneeudreq porteneeuderq porteneeudeqr porteneedequr porteneedeqru porteneedeuqr porteneedeurq porteneederuq porteneederqu
porteneedqeur porteneedqeru porteneedquer porteneedqure porteneedqrue porteneedqreu porteneeduqer porteneeduqre porteneedueqr
porteneeduerq porteneedureq porteneedurqe porteneedrque porteneedrqeu porteneedruqe porteneedrueq porteneedreuq porteneedrequ
portenredeque portenredeqeu portenredeuqe portenredeueq portenredeeuq portenredeequ portenredqeue portenredqeeu portenredquee
portenredquee portenredqeue portenredqeeu portenreduqee portenreduqee portenredueqe portenredueeq portenredueeq portenredueqe
portenredeque portenredeqeu portenredeuqe portenredeueq portenredeeuq portenredeequ portenreedque portenreedqeu portenreeduqe
portenreedueq portenreedeuq portenreedequ portenreeqdue portenreeqdeu portenreequde portenreequed portenreeqeud portenreeqedu
portenreeuqde portenreeuqed portenreeudqe portenreeudeq portenreeuedq portenreeueqd portenreeequd portenreeeqdu portenreeeuqd
portenreeeudq portenreeeduq portenreeedqu portenreqedue portenreqedeu portenreqeude portenreqeued portenreqeeud portenreqeedu
portenreqdeue portenreqdeeu portenreqduee portenreqduee portenreqdeue portenreqdeeu portenrequdee portenrequdee portenrequede
portenrequeed portenrequeed portenrequede portenreqedue portenreqedeu portenreqeude portenreqeued portenreqeeud portenreqeedu
portenreueqde portenreueqed portenreuedqe portenreuedeq portenreueedq portenreueeqd portenreuqede portenreuqeed portenreuqdee
portenreuqdee portenreuqede portenreuqeed portenreudqee portenreudqee portenreudeqe portenreudeeq portenreudeeq portenreudeqe
portenreueqde portenreueqed portenreuedqe portenreuedeq portenreueedq portenreueeqd portenreeequd portenreeeqdu portenreeeuqd
portenreeeudq portenreeeduq portenreeedqu portenreeqeud portenreeqedu portenreequed portenreequde portenreeqdue portenreeqdeu
portenreeuqed portenreeuqde portenreeueqd portenreeuedq portenreeudeq portenreeudqe portenreedque portenreedqeu portenreeduqe
portenreedueq portenreedeuq portenreedequ portenrdeeque portenrdeeqeu portenrdeeuqe portenrdeeueq portenrdeeeuq portenrdeeequ
portenrdeqeue portenrdeqeeu portenrdequee portenrdequee portenrdeqeue portenrdeqeeu portenrdeuqee portenrdeuqee portenrdeueqe
portenrdeueeq portenrdeueeq portenrdeueqe portenrdeeque portenrdeeqeu portenrdeeuqe portenrdeeueq portenrdeeeuq portenrdeeequ
portenrdeeque portenrdeeqeu portenrdeeuqe portenrdeeueq portenrdeeeuq portenrdeeequ portenrdeqeue portenrdeqeeu portenrdequee
portenrdequee portenrdeqeue portenrdeqeeu portenrdeuqee portenrdeuqee portenrdeueqe portenrdeueeq portenrdeueeq portenrdeueqe
portenrdeeque portenrdeeqeu portenrdeeuqe portenrdeeueq portenrdeeeuq portenrdeeequ portenrdqeeue portenrdqeeeu portenrdqeuee
portenrdqeuee portenrdqeeue portenrdqeeeu portenrdqeeue portenrdqeeeu portenrdqeuee portenrdqeuee portenrdqeeue portenrdqeeeu
portenrdqueee portenrdqueee portenrdqueee portenrdqueee portenrdqueee portenrdqueee portenrdqeeue portenrdqeeeu portenrdqeuee
portenrdqeuee portenrdqeeue portenrdqeeeu portenrdueqee portenrdueqee portenrdueeqe portenrdueeeq portenrdueeeq portenrdueeqe
portenrduqeee portenrduqeee portenrduqeee portenrduqeee portenrduqeee portenrduqeee portenrdueqee portenrdueqee portenrdueeqe
portenrdueeeq portenrdueeeq portenrdueeqe portenrdueqee portenrdueqee portenrdueeqe portenrdueeeq portenrdueeeq portenrdueeqe
portenrdeeque portenrdeeqeu portenrdeeuqe portenrdeeueq portenrdeeeuq portenrdeeequ portenrdeqeue portenrdeqeeu portenrdequee
portenrdequee portenrdeqeue portenrdeqeeu portenrdeuqee portenrdeuqee portenrdeueqe portenrdeueeq portenrdeueeq portenrdeueqe
portenrdeeque portenrdeeqeu portenrdeeuqe portenrdeeueq portenrdeeeuq portenrdeeequ portenredeque portenredeqeu portenredeuqe
portenredeueq portenredeeuq portenredeequ portenredqeue portenredqeeu portenredquee portenredquee portenredqeue portenredqeeu
portenreduqee portenreduqee portenredueqe portenredueeq portenredueeq portenredueqe portenredeque portenredeqeu portenredeuqe
portenredeueq portenredeeuq portenredeequ portenreedque portenreedqeu portenreeduqe portenreedueq portenreedeuq portenreedequ
portenreeqdue portenreeqdeu portenreequde portenreequed portenreeqeud portenreeqedu portenreeuqde portenreeuqed portenreeudqe
portenreeudeq portenreeuedq portenreeueqd portenreeequd portenreeeqdu portenreeeuqd portenreeeudq portenreeeduq portenreeedqu
portenreqedue portenreqedeu portenreqeude portenreqeued portenreqeeud portenreqeedu portenreqdeue portenreqdeeu portenreqduee
portenreqduee portenreqdeue portenreqdeeu portenrequdee portenrequdee portenrequede portenrequeed portenrequeed portenrequede
portenreqedue portenreqedeu portenreqeude portenreqeued portenreqeeud portenreqeedu portenreueqde portenreueqed portenreuedqe
portenreuedeq portenreueedq portenreueeqd portenreuqede portenreuqeed portenreuqdee portenreuqdee portenreuqede portenreuqeed
portenreudqee portenreudqee portenreudeqe portenreudeeq portenreudeeq portenreudeqe portenreueqde portenreueqed portenreuedqe
portenreuedeq portenreueedq portenreueeqd portenreeequd portenreeeqdu portenreeeuqd portenreeeudq portenreeeduq portenreeedqu
portenreeqeud portenreeqedu portenreequed portenreequde portenreeqdue portenreeqdeu portenreeuqed portenreeuqde portenreeueqd
portenreeuedq portenreeudeq portenreeudqe portenreedque portenreedqeu portenreeduqe portenreedueq portenreedeuq portenreedequ
portenrqdeeue portenrqdeeeu portenrqdeuee portenrqdeuee portenrqdeeue portenrqdeeeu portenrqdeeue portenrqdeeeu portenrqdeuee
portenrqdeuee portenrqdeeue portenrqdeeeu portenrqdueee portenrqdueee portenrqdueee portenrqdueee portenrqdueee portenrqdueee
portenrqdeeue portenrqdeeeu portenrqdeuee portenrqdeuee portenrqdeeue portenrqdeeeu portenrqedeue portenrqedeeu portenrqeduee
portenrqeduee portenrqedeue portenrqedeeu portenrqeedue portenrqeedeu portenrqeeude portenrqeeued portenrqeeeud portenrqeeedu
portenrqeuede portenrqeueed portenrqeudee portenrqeudee portenrqeuede portenrqeueed portenrqeeeud portenrqeeedu portenrqeeued
portenrqeeude portenrqeedue portenrqeedeu portenrqeedue portenrqeedeu portenrqeeude portenrqeeued portenrqeeeud portenrqeeedu
portenrqedeue portenrqedeeu portenrqeduee portenrqeduee portenrqedeue portenrqedeeu portenrqeudee portenrqeudee portenrqeuede
portenrqeueed portenrqeueed portenrqeuede portenrqeedue portenrqeedeu portenrqeeude portenrqeeued portenrqeeeud portenrqeeedu
portenrqueede portenrqueeed portenrquedee portenrquedee portenrqueede portenrqueeed portenrqueede portenrqueeed portenrquedee
portenrquedee portenrqueede portenrqueeed portenrqudeee portenrqudeee portenrqudeee portenrqudeee portenrqudeee portenrqudeee
portenrqueede portenrqueeed portenrquedee portenrquedee portenrqueede portenrqueeed portenrqeeeud portenrqeeedu portenrqeeued
portenrqeeude portenrqeedue portenrqeedeu portenrqeeeud portenrqeeedu portenrqeeued portenrqeeude portenrqeedue portenrqeedeu
portenrqeueed portenrqeuede portenrqeueed portenrqeuede portenrqeudee portenrqeudee portenrqedeue portenrqedeeu portenrqeduee
portenrqeduee portenrqedeue portenrqedeeu portenrudeqee portenrudeqee portenrudeeqe portenrudeeeq portenrudeeeq portenrudeeqe
portenrudqeee portenrudqeee portenrudqeee portenrudqeee portenrudqeee portenrudqeee portenrudeqee portenrudeqee portenrudeeqe
portenrudeeeq portenrudeeeq portenrudeeqe portenrudeqee portenrudeqee portenrudeeqe portenrudeeeq portenrudeeeq portenrudeeqe
portenruedqee portenruedqee portenruedeqe portenruedeeq portenruedeeq portenruedeqe portenrueqdee portenrueqdee portenrueqede
portenrueqeed portenrueqeed portenrueqede portenrueeqde portenrueeqed portenrueedqe portenrueedeq portenrueeedq portenrueeeqd
portenrueeqed portenrueeqde portenrueeeqd portenrueeedq portenrueedeq portenrueedqe portenruqedee portenruqedee portenruqeede
portenruqeeed portenruqeeed portenruqeede portenruqdeee portenruqdeee portenruqdeee portenruqdeee portenruqdeee portenruqdeee
portenruqedee portenruqedee portenruqeede portenruqeeed portenruqeeed portenruqeede portenruqedee portenruqedee portenruqeede
portenruqeeed portenruqeeed portenruqeede portenrueeqde portenrueeqed portenrueedqe portenrueedeq portenrueeedq portenrueeeqd
portenrueqede portenrueqeed portenrueqdee portenrueqdee portenrueqede portenrueqeed portenruedqee portenruedqee portenruedeqe
portenruedeeq portenruedeeq portenruedeqe portenrueeqde portenrueeqed portenrueedqe portenrueedeq portenrueeedq portenrueeeqd
portenrueeqed portenrueeqde portenrueeeqd portenrueeedq portenrueedeq portenrueedqe portenrueqeed portenrueqede portenrueqeed
portenrueqede portenrueqdee portenrueqdee portenrueeqed portenrueeqde portenrueeeqd portenrueeedq portenrueedeq portenrueedqe
portenruedqee portenruedqee portenruedeqe portenruedeeq portenruedeeq portenruedeqe portenredeque portenredeqeu portenredeuqe
portenredeueq portenredeeuq portenredeequ portenredqeue portenredqeeu portenredquee portenredquee portenredqeue portenredqeeu
portenreduqee portenreduqee portenredueqe portenredueeq portenredueeq portenredueqe portenredeque portenredeqeu portenredeuqe
portenredeueq portenredeeuq portenredeequ portenreedque portenreedqeu portenreeduqe portenreedueq portenreedeuq portenreedequ
portenreeqdue portenreeqdeu portenreequde portenreequed portenreeqeud portenreeqedu portenreeuqde portenreeuqed portenreeudqe
portenreeudeq portenreeuedq portenreeueqd portenreeequd portenreeeqdu portenreeeuqd portenreeeudq portenreeeduq portenreeedqu
portenreqedue portenreqedeu portenreqeude portenreqeued portenreqeeud portenreqeedu portenreqdeue portenreqdeeu portenreqduee
portenreqduee portenreqdeue portenreqdeeu portenrequdee portenrequdee portenrequede portenrequeed portenrequeed portenrequede
portenreqedue portenreqedeu portenreqeude portenreqeued portenreqeeud portenreqeedu portenreueqde portenreueqed portenreuedqe
portenreuedeq portenreueedq portenreueeqd portenreuqede portenreuqeed portenreuqdee portenreuqdee portenreuqede portenreuqeed
portenreudqee portenreudqee portenreudeqe portenreudeeq portenreudeeq portenreudeqe portenreueqde portenreueqed portenreuedqe
portenreuedeq portenreueedq portenreueeqd portenreeequd portenreeeqdu portenreeeuqd portenreeeudq portenreeeduq portenreeedqu
portenreeqeud portenreeqedu portenreequed portenreequde portenreeqdue portenreeqdeu portenreeuqed portenreeuqde portenreeueqd
portenreeuedq portenreeudeq portenreeudqe portenreedque portenreedqeu portenreeduqe portenreedueq portenreedeuq portenreedequ
porteneerdque porteneerdqeu porteneerduqe porteneerdueq porteneerdeuq porteneerdequ porteneerqdue porteneerqdeu porteneerqude
porteneerqued porteneerqeud porteneerqedu porteneeruqde porteneeruqed porteneerudqe porteneerudeq porteneeruedq porteneerueqd
porteneerequd porteneereqdu porteneereuqd porteneereudq porteneereduq porteneeredqu porteneedrque porteneedrqeu porteneedruqe
porteneedrueq porteneedreuq porteneedrequ porteneedqrue porteneedqreu porteneedqure porteneedquer porteneedqeur porteneedqeru
porteneeduqre porteneeduqer porteneedurqe porteneedureq porteneeduerq porteneedueqr porteneedequr porteneedeqru porteneedeuqr
porteneedeurq porteneederuq porteneederqu porteneeqdrue porteneeqdreu porteneeqdure porteneeqduer porteneeqdeur porteneeqderu
porteneeqrdue porteneeqrdeu porteneeqrude porteneeqrued porteneeqreud porteneeqredu porteneequrde porteneequred porteneequdre
porteneequder porteneequedr porteneequerd porteneeqerud porteneeqerdu porteneeqeurd porteneeqeudr porteneeqedur porteneeqedru
porteneeudqre porteneeudqer porteneeudrqe porteneeudreq porteneeuderq porteneeudeqr porteneeuqdre porteneeuqder porteneeuqrde
porteneeuqred porteneeuqerd porteneeuqedr porteneeurqde porteneeurqed porteneeurdqe porteneeurdeq porteneeuredq porteneeureqd
porteneeueqrd porteneeueqdr porteneeuerqd porteneeuerdq porteneeuedrq porteneeuedqr porteneeedqur porteneeedqru porteneeeduqr
porteneeedurq porteneeedruq porteneeedrqu porteneeeqdur porteneeeqdru porteneeequdr porteneeequrd porteneeeqrud porteneeeqrdu
porteneeeuqdr porteneeeuqrd porteneeeudqr porteneeeudrq porteneeeurdq porteneeeurqd porteneeerqud porteneeerqdu porteneeeruqd
porteneeerudq porteneeerduq porteneeerdqu porteneredque porteneredqeu portenereduqe porteneredueq porteneredeuq porteneredequ
portenereqdue portenereqdeu portenerequde portenerequed portenereqeud portenereqedu portenereuqde portenereuqed portenereudqe
portenereudeq portenereuedq portenereueqd portenereequd portenereeqdu portenereeuqd portenereeudq portenereeduq portenereedqu
portenerdeque portenerdeqeu portenerdeuqe portenerdeueq portenerdeeuq portenerdeequ portenerdqeue portenerdqeeu portenerdquee
portenerdquee portenerdqeue portenerdqeeu portenerduqee portenerduqee portenerdueqe portenerdueeq portenerdueeq portenerdueqe
portenerdeque portenerdeqeu portenerdeuqe portenerdeueq portenerdeeuq portenerdeequ portenerqdeue portenerqdeeu portenerqduee
portenerqduee portenerqdeue portenerqdeeu portenerqedue portenerqedeu portenerqeude portenerqeued portenerqeeud portenerqeedu
portenerquede portenerqueed portenerqudee portenerqudee portenerquede portenerqueed portenerqeeud portenerqeedu portenerqeued
portenerqeude portenerqedue portenerqedeu portenerudqee portenerudqee portenerudeqe portenerudeeq portenerudeeq portenerudeqe
porteneruqdee porteneruqdee porteneruqede porteneruqeed porteneruqeed porteneruqede portenerueqde portenerueqed porteneruedqe
porteneruedeq portenerueedq portenerueeqd portenerueqed portenerueqde portenerueeqd portenerueedq porteneruedeq porteneruedqe
porteneredque porteneredqeu portenereduqe porteneredueq porteneredeuq porteneredequ portenereqdue portenereqdeu portenerequde
portenerequed portenereqeud portenereqedu portenereuqde portenereuqed portenereudqe portenereudeq portenereuedq portenereueqd
portenereequd portenereeqdu portenereeuqd portenereeudq portenereeduq portenereedqu portenedreque portenedreqeu portenedreuqe
portenedreueq portenedreeuq portenedreequ portenedrqeue portenedrqeeu portenedrquee portenedrquee portenedrqeue portenedrqeeu
portenedruqee portenedruqee portenedrueqe portenedrueeq portenedrueeq portenedrueqe portenedreque portenedreqeu portenedreuqe
portenedreueq portenedreeuq portenedreequ portenederque portenederqeu portenederuqe portenederueq portenedereuq portenederequ
portenedeqrue portenedeqreu portenedequre portenedequer portenedeqeur portenedeqeru portenedeuqre portenedeuqer portenedeurqe
portenedeureq portenedeuerq portenedeueqr portenedeequr portenedeeqru portenedeeuqr portenedeeurq portenedeeruq portenedeerqu
portenedqerue portenedqereu portenedqeure portenedqeuer portenedqeeur portenedqeeru portenedqreue portenedqreeu portenedqruee
portenedqruee portenedqreue portenedqreeu portenedquree portenedquree portenedquere portenedqueer portenedqueer portenedquere
portenedqerue portenedqereu portenedqeure portenedqeuer portenedqeeur portenedqeeru portenedueqre portenedueqer porteneduerqe
porteneduereq portenedueerq portenedueeqr porteneduqere porteneduqeer porteneduqree porteneduqree porteneduqere porteneduqeer
portenedurqee portenedurqee portenedureqe portenedureeq portenedureeq portenedureqe portenedueqre portenedueqer porteneduerqe
porteneduereq portenedueerq portenedueeqr portenedeequr portenedeeqru portenedeeuqr portenedeeurq portenedeeruq portenedeerqu
portenedeqeur portenedeqeru portenedequer portenedequre portenedeqrue portenedeqreu portenedeuqer portenedeuqre portenedeueqr
portenedeuerq portenedeureq portenedeurqe portenederque portenederqeu portenederuqe portenederueq portenedereuq portenederequ
porteneqrdeue porteneqrdeeu porteneqrduee porteneqrduee porteneqrdeue porteneqrdeeu porteneqredue porteneqredeu porteneqreude
porteneqreued porteneqreeud porteneqreedu porteneqruede porteneqrueed porteneqrudee porteneqrudee porteneqruede porteneqrueed
porteneqreeud porteneqreedu porteneqreued porteneqreude porteneqredue porteneqredeu porteneqdreue porteneqdreeu porteneqdruee
porteneqdruee porteneqdreue porteneqdreeu porteneqderue porteneqdereu porteneqdeure porteneqdeuer porteneqdeeur porteneqdeeru
porteneqduere porteneqdueer porteneqduree porteneqduree porteneqduere porteneqdueer porteneqdeeur porteneqdeeru porteneqdeuer
porteneqdeure porteneqderue porteneqdereu porteneqedrue porteneqedreu porteneqedure porteneqeduer porteneqedeur porteneqederu
porteneqerdue porteneqerdeu porteneqerude porteneqerued porteneqereud porteneqeredu porteneqeurde porteneqeured porteneqeudre
porteneqeuder porteneqeuedr porteneqeuerd porteneqeerud porteneqeerdu porteneqeeurd porteneqeeudr porteneqeedur porteneqeedru
portenequdere portenequdeer portenequdree portenequdree portenequdere portenequdeer portenequedre portenequeder portenequerde
portenequered portenequeerd portenequeedr portenequrede portenequreed portenequrdee portenequrdee portenequrede portenequreed
portenequeerd portenequeedr portenequered portenequerde portenequedre portenequeder porteneqedeur porteneqederu porteneqeduer
porteneqedure porteneqedrue porteneqedreu porteneqeedur porteneqeedru porteneqeeudr porteneqeeurd porteneqeerud porteneqeerdu
porteneqeuedr porteneqeuerd porteneqeuder porteneqeudre porteneqeurde porteneqeured porteneqereud porteneqeredu porteneqerued
porteneqerude porteneqerdue porteneqerdeu porteneurdqee porteneurdqee porteneurdeqe porteneurdeeq porteneurdeeq porteneurdeqe
porteneurqdee porteneurqdee porteneurqede porteneurqeed porteneurqeed porteneurqede porteneureqde porteneureqed porteneuredqe
porteneuredeq porteneureedq porteneureeqd porteneureqed porteneureqde porteneureeqd porteneureedq porteneuredeq porteneuredqe
porteneudrqee porteneudrqee porteneudreqe porteneudreeq porteneudreeq porteneudreqe porteneudqree porteneudqree porteneudqere
porteneudqeer porteneudqeer porteneudqere porteneudeqre porteneudeqer porteneuderqe porteneudereq porteneudeerq porteneudeeqr
porteneudeqer porteneudeqre porteneudeeqr porteneudeerq porteneudereq porteneuderqe porteneuqdree porteneuqdree porteneuqdere
porteneuqdeer porteneuqdeer porteneuqdere porteneuqrdee porteneuqrdee porteneuqrede porteneuqreed porteneuqreed porteneuqrede
porteneuqerde porteneuqered porteneuqedre porteneuqeder porteneuqeedr porteneuqeerd porteneuqered porteneuqerde porteneuqeerd
porteneuqeedr porteneuqeder porteneuqedre porteneuedqre porteneuedqer porteneuedrqe porteneuedreq porteneuederq porteneuedeqr
porteneueqdre porteneueqder porteneueqrde porteneueqred porteneueqerd porteneueqedr porteneuerqde porteneuerqed porteneuerdqe
porteneuerdeq porteneueredq porteneuereqd porteneueeqrd porteneueeqdr porteneueerqd porteneueerdq porteneueedrq porteneueedqr
porteneuedqer porteneuedqre porteneuedeqr porteneuederq porteneuedreq porteneuedrqe porteneueqder porteneueqdre porteneueqedr
porteneueqerd porteneueqred porteneueqrde porteneueeqdr porteneueeqrd porteneueedqr porteneueedrq porteneueerdq porteneueerqd
porteneuerqed porteneuerqde porteneuereqd porteneueredq porteneuerdeq porteneuerdqe porteneerdque porteneerdqeu porteneerduqe
porteneerdueq porteneerdeuq porteneerdequ porteneerqdue porteneerqdeu porteneerqude porteneerqued porteneerqeud porteneerqedu
porteneeruqde porteneeruqed porteneerudqe porteneerudeq porteneeruedq porteneerueqd porteneerequd porteneereqdu porteneereuqd
porteneereudq porteneereduq porteneeredqu porteneedrque porteneedrqeu porteneedruqe porteneedrueq porteneedreuq porteneedrequ
porteneedqrue porteneedqreu porteneedqure porteneedquer porteneedqeur porteneedqeru porteneeduqre porteneeduqer porteneedurqe
porteneedureq porteneeduerq porteneedueqr porteneedequr porteneedeqru porteneedeuqr porteneedeurq porteneederuq porteneederqu
porteneeqdrue porteneeqdreu porteneeqdure porteneeqduer porteneeqdeur porteneeqderu porteneeqrdue porteneeqrdeu porteneeqrude
porteneeqrued porteneeqreud porteneeqredu porteneequrde porteneequred porteneequdre porteneequder porteneequedr porteneequerd
porteneeqerud porteneeqerdu porteneeqeurd porteneeqeudr porteneeqedur porteneeqedru porteneeudqre porteneeudqer porteneeudrqe
porteneeudreq porteneeuderq porteneeudeqr porteneeuqdre porteneeuqder porteneeuqrde porteneeuqred porteneeuqerd porteneeuqedr
porteneeurqde porteneeurqed porteneeurdqe porteneeurdeq porteneeuredq porteneeureqd porteneeueqrd porteneeueqdr porteneeuerqd
porteneeuerdq porteneeuedrq porteneeuedqr porteneeedqur porteneeedqru porteneeeduqr porteneeedurq porteneeedruq porteneeedrqu
porteneeeqdur porteneeeqdru porteneeequdr porteneeequrd porteneeeqrud porteneeeqrdu porteneeeuqdr porteneeeuqrd porteneeeudqr
porteneeeudrq porteneeeurdq porteneeeurqd porteneeerqud porteneeerqdu porteneeeruqd porteneeerudq porteneeerduq porteneeerdqu
portenqeredue portenqeredeu portenqereude portenqereued portenqereeud portenqereedu portenqerdeue portenqerdeeu portenqerduee
portenqerduee portenqerdeue portenqerdeeu portenqerudee portenqerudee portenqeruede portenqerueed portenqerueed portenqeruede
portenqeredue portenqeredeu portenqereude portenqereued portenqereeud portenqereedu portenqeerdue portenqeerdeu portenqeerude
portenqeerued portenqeereud portenqeeredu portenqeedrue portenqeedreu portenqeedure portenqeeduer portenqeedeur portenqeederu
portenqeeudre portenqeeuder portenqeeurde portenqeeured portenqeeuerd portenqeeuedr portenqeeedur portenqeeedru portenqeeeudr
portenqeeeurd portenqeeerud portenqeeerdu portenqederue portenqedereu portenqedeure portenqedeuer portenqedeeur portenqedeeru
portenqedreue portenqedreeu portenqedruee portenqedruee portenqedreue portenqedreeu portenqeduree portenqeduree portenqeduere
portenqedueer portenqedueer portenqeduere portenqederue portenqedereu portenqedeure portenqedeuer portenqedeeur portenqedeeru
portenqeuedre portenqeueder portenqeuerde portenqeuered portenqeueerd portenqeueedr portenqeudere portenqeudeer portenqeudree
portenqeudree portenqeudere portenqeudeer portenqeurdee portenqeurdee portenqeurede portenqeureed portenqeureed portenqeurede
portenqeuedre portenqeueder portenqeuerde portenqeuered portenqeueerd portenqeueedr portenqeeedur portenqeeedru portenqeeeudr
portenqeeeurd portenqeeerud portenqeeerdu portenqeedeur portenqeederu portenqeeduer portenqeedure portenqeedrue portenqeedreu
portenqeeuder portenqeeudre portenqeeuedr portenqeeuerd portenqeeured portenqeeurde portenqeerdue portenqeerdeu portenqeerude
portenqeerued portenqeereud portenqeeredu portenqreedue portenqreedeu portenqreeude portenqreeued portenqreeeud portenqreeedu
portenqredeue portenqredeeu portenqreduee portenqreduee portenqredeue portenqredeeu portenqreudee portenqreudee portenqreuede
portenqreueed portenqreueed portenqreuede portenqreedue portenqreedeu portenqreeude portenqreeued portenqreeeud portenqreeedu
portenqreedue portenqreedeu portenqreeude portenqreeued portenqreeeud portenqreeedu portenqredeue portenqredeeu portenqreduee
portenqreduee portenqredeue portenqredeeu portenqreudee portenqreudee portenqreuede portenqreueed portenqreueed portenqreuede
portenqreedue portenqreedeu portenqreeude portenqreeued portenqreeeud portenqreeedu portenqrdeeue portenqrdeeeu portenqrdeuee
portenqrdeuee portenqrdeeue portenqrdeeeu portenqrdeeue portenqrdeeeu portenqrdeuee portenqrdeuee portenqrdeeue portenqrdeeeu
portenqrdueee portenqrdueee portenqrdueee portenqrdueee portenqrdueee portenqrdueee portenqrdeeue portenqrdeeeu portenqrdeuee
portenqrdeuee portenqrdeeue portenqrdeeeu portenqruedee portenqruedee portenqrueede portenqrueeed portenqrueeed portenqrueede
portenqrudeee portenqrudeee portenqrudeee portenqrudeee portenqrudeee portenqrudeee portenqruedee portenqruedee portenqrueede
portenqrueeed portenqrueeed portenqrueede portenqruedee portenqruedee portenqrueede portenqrueeed portenqrueeed portenqrueede
portenqreedue portenqreedeu portenqreeude portenqreeued portenqreeeud portenqreeedu portenqredeue portenqredeeu portenqreduee
portenqreduee portenqredeue portenqredeeu portenqreudee portenqreudee portenqreuede portenqreueed portenqreueed portenqreuede
portenqreedue portenqreedeu portenqreeude portenqreeued portenqreeeud portenqreeedu portenqeredue portenqeredeu portenqereude
portenqereued portenqereeud portenqereedu portenqerdeue portenqerdeeu portenqerduee portenqerduee portenqerdeue portenqerdeeu
portenqerudee portenqerudee portenqeruede portenqerueed portenqerueed portenqeruede portenqeredue portenqeredeu portenqereude
portenqereued portenqereeud portenqereedu portenqeerdue portenqeerdeu portenqeerude portenqeerued portenqeereud portenqeeredu
portenqeedrue portenqeedreu portenqeedure portenqeeduer portenqeedeur portenqeederu portenqeeudre portenqeeuder portenqeeurde
portenqeeured portenqeeuerd portenqeeuedr portenqeeedur portenqeeedru portenqeeeudr portenqeeeurd portenqeeerud portenqeeerdu
portenqederue portenqedereu portenqedeure portenqedeuer portenqedeeur portenqedeeru portenqedreue portenqedreeu portenqedruee
portenqedruee portenqedreue portenqedreeu portenqeduree portenqeduree portenqeduere portenqedueer portenqedueer portenqeduere
portenqederue portenqedereu portenqedeure portenqedeuer portenqedeeur portenqedeeru portenqeuedre portenqeueder portenqeuerde
portenqeuered portenqeueerd portenqeueedr portenqeudere portenqeudeer portenqeudree portenqeudree portenqeudere portenqeudeer
portenqeurdee portenqeurdee portenqeurede portenqeureed portenqeureed portenqeurede portenqeuedre portenqeueder portenqeuerde
portenqeuered portenqeueerd portenqeueedr portenqeeedur portenqeeedru portenqeeeudr portenqeeeurd portenqeeerud portenqeeerdu
portenqeedeur portenqeederu portenqeeduer portenqeedure portenqeedrue portenqeedreu portenqeeuder portenqeeudre portenqeeuedr
portenqeeuerd portenqeeured portenqeeurde portenqeerdue portenqeerdeu portenqeerude portenqeerued portenqeereud portenqeeredu
portenqdreeue portenqdreeeu portenqdreuee portenqdreuee portenqdreeue portenqdreeeu portenqdreeue portenqdreeeu portenqdreuee
portenqdreuee portenqdreeue portenqdreeeu portenqdrueee portenqdrueee portenqdrueee portenqdrueee portenqdrueee portenqdrueee
portenqdreeue portenqdreeeu portenqdreuee portenqdreuee portenqdreeue portenqdreeeu portenqdereue portenqdereeu portenqderuee
portenqderuee portenqdereue portenqdereeu portenqdeerue portenqdeereu portenqdeeure portenqdeeuer portenqdeeeur portenqdeeeru
portenqdeuere portenqdeueer portenqdeuree portenqdeuree portenqdeuere portenqdeueer portenqdeeeur portenqdeeeru portenqdeeuer
portenqdeeure portenqdeerue portenqdeereu portenqdeerue portenqdeereu portenqdeeure portenqdeeuer portenqdeeeur portenqdeeeru
portenqdereue portenqdereeu portenqderuee portenqderuee portenqdereue portenqdereeu portenqdeuree portenqdeuree portenqdeuere
portenqdeueer portenqdeueer portenqdeuere portenqdeerue portenqdeereu portenqdeeure portenqdeeuer portenqdeeeur portenqdeeeru
portenqdueere portenqdueeer portenqdueree portenqdueree portenqdueere portenqdueeer portenqdueere portenqdueeer portenqdueree
portenqdueree portenqdueere portenqdueeer portenqdureee portenqdureee portenqdureee portenqdureee portenqdureee portenqdureee
portenqdueere portenqdueeer portenqdueree portenqdueree portenqdueere portenqdueeer portenqdeeeur portenqdeeeru portenqdeeuer
portenqdeeure portenqdeerue portenqdeereu portenqdeeeur portenqdeeeru portenqdeeuer portenqdeeure portenqdeerue portenqdeereu
portenqdeueer portenqdeuere portenqdeueer portenqdeuere portenqdeuree portenqdeuree portenqdereue portenqdereeu portenqderuee
portenqderuee portenqdereue portenqdereeu portenquredee portenquredee portenqureede portenqureeed portenqureeed portenqureede
portenqurdeee portenqurdeee portenqurdeee portenqurdeee portenqurdeee portenqurdeee portenquredee portenquredee portenqureede
portenqureeed portenqureeed portenqureede portenquredee portenquredee portenqureede portenqureeed portenqureeed portenqureede
portenquerdee portenquerdee portenquerede portenquereed portenquereed portenquerede portenquedree portenquedree portenquedere
portenquedeer portenquedeer portenquedere portenqueedre portenqueeder portenqueerde portenqueered portenqueeerd portenqueeedr
portenqueeder portenqueedre portenqueeedr portenqueeerd portenqueered portenqueerde portenquderee portenquderee portenqudeere
portenqudeeer portenqudeeer portenqudeere portenqudreee portenqudreee portenqudreee portenqudreee portenqudreee portenqudreee
portenquderee portenquderee portenqudeere portenqudeeer portenqudeeer portenqudeere portenquderee portenquderee portenqudeere
portenqudeeer portenqudeeer portenqudeere portenqueedre portenqueeder portenqueerde portenqueered portenqueeerd portenqueeedr
portenquedere portenquedeer portenquedree portenquedree portenquedere portenquedeer portenquerdee portenquerdee portenquerede
portenquereed portenquereed portenquerede portenqueedre portenqueeder portenqueerde portenqueered portenqueeerd portenqueeedr
portenqueeder portenqueedre portenqueeedr portenqueeerd portenqueered portenqueerde portenquedeer portenquedere portenquedeer
portenquedere portenquedree portenquedree portenqueeder portenqueedre portenqueeedr portenqueeerd portenqueered portenqueerde
portenquerdee portenquerdee portenquerede portenquereed portenquereed portenquerede portenqeredue portenqeredeu portenqereude
portenqereued portenqereeud portenqereedu portenqerdeue portenqerdeeu portenqerduee portenqerduee portenqerdeue portenqerdeeu
portenqerudee portenqerudee portenqeruede portenqerueed portenqerueed portenqeruede portenqeredue portenqeredeu portenqereude
portenqereued portenqereeud portenqereedu portenqeerdue portenqeerdeu portenqeerude portenqeerued portenqeereud portenqeeredu
portenqeedrue portenqeedreu portenqeedure portenqeeduer portenqeedeur portenqeederu portenqeeudre portenqeeuder portenqeeurde
portenqeeured portenqeeuerd portenqeeuedr portenqeeedur portenqeeedru portenqeeeudr portenqeeeurd portenqeeerud portenqeeerdu
portenqederue portenqedereu portenqedeure portenqedeuer portenqedeeur portenqedeeru portenqedreue portenqedreeu portenqedruee
portenqedruee portenqedreue portenqedreeu portenqeduree portenqeduree portenqeduere portenqedueer portenqedueer portenqeduere
portenqederue portenqedereu portenqedeure portenqedeuer portenqedeeur portenqedeeru portenqeuedre portenqeueder portenqeuerde
portenqeuered portenqeueerd portenqeueedr portenqeudere portenqeudeer portenqeudree portenqeudree portenqeudere portenqeudeer
portenqeurdee portenqeurdee portenqeurede portenqeureed portenqeureed portenqeurede portenqeuedre portenqeueder portenqeuerde
portenqeuered portenqeueerd portenqeueedr portenqeeedur portenqeeedru portenqeeeudr portenqeeeurd portenqeeerud portenqeeerdu
portenqeedeur portenqeederu portenqeeduer portenqeedure portenqeedrue portenqeedreu portenqeeuder portenqeeudre portenqeeuedr
portenqeeuerd portenqeeured portenqeeurde portenqeerdue portenqeerdeu portenqeerude portenqeerued portenqeereud portenqeeredu
portenuereqde portenuereqed portenueredqe portenueredeq portenuereedq portenuereeqd portenuerqede portenuerqeed portenuerqdee
portenuerqdee portenuerqede portenuerqeed portenuerdqee portenuerdqee portenuerdeqe portenuerdeeq portenuerdeeq portenuerdeqe
portenuereqde portenuereqed portenueredqe portenueredeq portenuereedq portenuereeqd portenueerqde portenueerqed portenueerdqe
portenueerdeq portenueeredq portenueereqd portenueeqrde portenueeqred portenueeqdre portenueeqder portenueeqedr portenueeqerd
portenueedqre portenueedqer portenueedrqe portenueedreq portenueederq portenueedeqr portenueeeqdr portenueeeqrd portenueeedqr
portenueeedrq portenueeerdq portenueeerqd portenueqerde portenueqered portenueqedre portenueqeder portenueqeedr portenueqeerd
portenueqrede portenueqreed portenueqrdee portenueqrdee portenueqrede portenueqreed portenueqdree portenueqdree portenueqdere
portenueqdeer portenueqdeer portenueqdere portenueqerde portenueqered portenueqedre portenueqeder portenueqeedr portenueqeerd
portenuedeqre portenuedeqer portenuederqe portenuedereq portenuedeerq portenuedeeqr portenuedqere portenuedqeer portenuedqree
portenuedqree portenuedqere portenuedqeer portenuedrqee portenuedrqee portenuedreqe portenuedreeq portenuedreeq portenuedreqe
portenuedeqre portenuedeqer portenuederqe portenuedereq portenuedeerq portenuedeeqr portenueeeqdr portenueeeqrd portenueeedqr
portenueeedrq portenueeerdq portenueeerqd portenueeqedr portenueeqerd portenueeqder portenueeqdre portenueeqrde portenueeqred
portenueedqer portenueedqre portenueedeqr portenueederq portenueedreq portenueedrqe portenueerqde portenueerqed portenueerdqe
portenueerdeq portenueeredq portenueereqd portenureeqde portenureeqed portenureedqe portenureedeq portenureeedq portenureeeqd
portenureqede portenureqeed portenureqdee portenureqdee portenureqede portenureqeed portenuredqee portenuredqee portenuredeqe
portenuredeeq portenuredeeq portenuredeqe portenureeqde portenureeqed portenureedqe portenureedeq portenureeedq portenureeeqd
portenureeqde portenureeqed portenureedqe portenureedeq portenureeedq portenureeeqd portenureqede portenureqeed portenureqdee
portenureqdee portenureqede portenureqeed portenuredqee portenuredqee portenuredeqe portenuredeeq portenuredeeq portenuredeqe
portenureeqde portenureeqed portenureedqe portenureedeq portenureeedq portenureeeqd portenurqeede portenurqeeed portenurqedee
portenurqedee portenurqeede portenurqeeed portenurqeede portenurqeeed portenurqedee portenurqedee portenurqeede portenurqeeed
portenurqdeee portenurqdeee portenurqdeee portenurqdeee portenurqdeee portenurqdeee portenurqeede portenurqeeed portenurqedee
portenurqedee portenurqeede portenurqeeed portenurdeqee portenurdeqee portenurdeeqe portenurdeeeq portenurdeeeq portenurdeeqe
portenurdqeee portenurdqeee portenurdqeee portenurdqeee portenurdqeee portenurdqeee portenurdeqee portenurdeqee portenurdeeqe
portenurdeeeq portenurdeeeq portenurdeeqe portenurdeqee portenurdeqee portenurdeeqe portenurdeeeq portenurdeeeq portenurdeeqe
portenureeqde portenureeqed portenureedqe portenureedeq portenureeedq portenureeeqd portenureqede portenureqeed portenureqdee
portenureqdee portenureqede portenureqeed portenuredqee portenuredqee portenuredeqe portenuredeeq portenuredeeq portenuredeqe
portenureeqde portenureeqed portenureedqe portenureedeq portenureeedq portenureeeqd portenuereqde portenuereqed portenueredqe
portenueredeq portenuereedq portenuereeqd portenuerqede portenuerqeed portenuerqdee portenuerqdee portenuerqede portenuerqeed
portenuerdqee portenuerdqee portenuerdeqe portenuerdeeq portenuerdeeq portenuerdeqe portenuereqde portenuereqed portenueredqe
portenueredeq portenuereedq portenuereeqd portenueerqde portenueerqed portenueerdqe portenueerdeq portenueeredq portenueereqd
portenueeqrde portenueeqred portenueeqdre portenueeqder portenueeqedr portenueeqerd portenueedqre portenueedqer portenueedrqe
portenueedreq portenueederq portenueedeqr portenueeeqdr portenueeeqrd portenueeedqr portenueeedrq portenueeerdq portenueeerqd
portenueqerde portenueqered portenueqedre portenueqeder portenueqeedr portenueqeerd portenueqrede portenueqreed portenueqrdee
portenueqrdee portenueqrede portenueqreed portenueqdree portenueqdree portenueqdere portenueqdeer portenueqdeer portenueqdere
portenueqerde portenueqered portenueqedre portenueqeder portenueqeedr portenueqeerd portenuedeqre portenuedeqer portenuederqe
portenuedereq portenuedeerq portenuedeeqr portenuedqere portenuedqeer portenuedqree portenuedqree portenuedqere portenuedqeer
portenuedrqee portenuedrqee portenuedreqe portenuedreeq portenuedreeq portenuedreqe portenuedeqre portenuedeqer portenuederqe
portenuedereq portenuedeerq portenuedeeqr portenueeeqdr portenueeeqrd portenueeedqr portenueeedrq portenueeerdq portenueeerqd
portenueeqedr portenueeqerd portenueeqder portenueeqdre portenueeqrde portenueeqred portenueedqer portenueedqre portenueedeqr
portenueederq portenueedreq portenueedrqe portenueerqde portenueerqed portenueerdqe portenueerdeq portenueeredq portenueereqd
portenuqreede portenuqreeed portenuqredee portenuqredee portenuqreede portenuqreeed portenuqreede portenuqreeed portenuqredee
portenuqredee portenuqreede portenuqreeed portenuqrdeee portenuqrdeee portenuqrdeee portenuqrdeee portenuqrdeee portenuqrdeee
portenuqreede portenuqreeed portenuqredee portenuqredee portenuqreede portenuqreeed portenuqerede portenuqereed portenuqerdee
portenuqerdee portenuqerede portenuqereed portenuqeerde portenuqeered portenuqeedre portenuqeeder portenuqeeedr portenuqeeerd
portenuqedere portenuqedeer portenuqedree portenuqedree portenuqedere portenuqedeer portenuqeeedr portenuqeeerd portenuqeeder
portenuqeedre portenuqeerde portenuqeered portenuqeerde portenuqeered portenuqeedre portenuqeeder portenuqeeedr portenuqeeerd
portenuqerede portenuqereed portenuqerdee portenuqerdee portenuqerede portenuqereed portenuqedree portenuqedree portenuqedere
portenuqedeer portenuqedeer portenuqedere portenuqeerde portenuqeered portenuqeedre portenuqeeder portenuqeeedr portenuqeeerd
portenuqdeere portenuqdeeer portenuqderee portenuqderee portenuqdeere portenuqdeeer portenuqdeere portenuqdeeer portenuqderee
portenuqderee portenuqdeere portenuqdeeer portenuqdreee portenuqdreee portenuqdreee portenuqdreee portenuqdreee portenuqdreee
portenuqdeere portenuqdeeer portenuqderee portenuqderee portenuqdeere portenuqdeeer portenuqeeedr portenuqeeerd portenuqeeder
portenuqeedre portenuqeerde portenuqeered portenuqeeedr portenuqeeerd portenuqeeder portenuqeedre portenuqeerde portenuqeered
portenuqedeer portenuqedere portenuqedeer portenuqedere portenuqedree portenuqedree portenuqerede portenuqereed portenuqerdee
portenuqerdee portenuqerede portenuqereed portenudreqee portenudreqee portenudreeqe portenudreeeq portenudreeeq portenudreeqe
portenudrqeee portenudrqeee portenudrqeee portenudrqeee portenudrqeee portenudrqeee portenudreqee portenudreqee portenudreeqe
portenudreeeq portenudreeeq portenudreeqe portenudreqee portenudreqee portenudreeqe portenudreeeq portenudreeeq portenudreeqe
portenuderqee portenuderqee portenudereqe portenudereeq portenudereeq portenudereqe portenudeqree portenudeqree portenudeqere
portenudeqeer portenudeqeer portenudeqere portenudeeqre portenudeeqer portenudeerqe portenudeereq portenudeeerq portenudeeeqr
portenudeeqer portenudeeqre portenudeeeqr portenudeeerq portenudeereq portenudeerqe portenudqeree portenudqeree portenudqeere
portenudqeeer portenudqeeer portenudqeere portenudqreee portenudqreee portenudqreee portenudqreee portenudqreee portenudqreee
portenudqeree portenudqeree portenudqeere portenudqeeer portenudqeeer portenudqeere portenudqeree portenudqeree portenudqeere
portenudqeeer portenudqeeer portenudqeere portenudeeqre portenudeeqer portenudeerqe portenudeereq portenudeeerq portenudeeeqr
portenudeqere portenudeqeer portenudeqree portenudeqree portenudeqere portenudeqeer portenuderqee portenuderqee portenudereqe
portenudereeq portenudereeq portenudereqe portenudeeqre portenudeeqer portenudeerqe portenudeereq portenudeeerq portenudeeeqr
portenudeeqer portenudeeqre portenudeeeqr portenudeeerq portenudeereq portenudeerqe portenudeqeer portenudeqere portenudeqeer
portenudeqere portenudeqree portenudeqree portenudeeqer portenudeeqre portenudeeeqr portenudeeerq portenudeereq portenudeerqe
portenuderqee portenuderqee portenudereqe portenudereeq portenudereeq portenudereqe portenuereqde portenuereqed portenueredqe
portenueredeq portenuereedq portenuereeqd portenuerqede portenuerqeed portenuerqdee portenuerqdee portenuerqede portenuerqeed
portenuerdqee portenuerdqee portenuerdeqe portenuerdeeq portenuerdeeq portenuerdeqe portenuereqde portenuereqed portenueredqe
portenueredeq portenuereedq portenuereeqd portenueerqde portenueerqed portenueerdqe portenueerdeq portenueeredq portenueereqd
portenueeqrde portenueeqred portenueeqdre portenueeqder portenueeqedr portenueeqerd portenueedqre portenueedqer portenueedrqe
portenueedreq portenueederq portenueedeqr portenueeeqdr portenueeeqrd portenueeedqr portenueeedrq portenueeerdq portenueeerqd
portenueqerde portenueqered portenueqedre portenueqeder portenueqeedr portenueqeerd portenueqrede portenueqreed portenueqrdee
portenueqrdee portenueqrede portenueqreed portenueqdree portenueqdree portenueqdere portenueqdeer portenueqdeer portenueqdere
portenueqerde portenueqered portenueqedre portenueqeder portenueqeedr portenueqeerd portenuedeqre portenuedeqer portenuederqe
portenuedereq portenuedeerq portenuedeeqr portenuedqere portenuedqeer portenuedqree portenuedqree portenuedqere portenuedqeer
portenuedrqee portenuedrqee portenuedreqe portenuedreeq portenuedreeq portenuedreqe portenuedeqre portenuedeqer portenuederqe
portenuedereq portenuedeerq portenuedeeqr portenueeeqdr portenueeeqrd portenueeedqr portenueeedrq portenueeerdq portenueeerqd
portenueeqedr portenueeqerd portenueeqder portenueeqdre portenueeqrde portenueeqred portenueedqer portenueedqre portenueedeqr
portenueederq portenueedreq portenueedrqe portenueerqde portenueerqed portenueerdqe portenueerdeq portenueeredq portenueereqd
porteneerequd porteneereqdu porteneereuqd porteneereudq porteneereduq porteneeredqu porteneerqeud porteneerqedu porteneerqued
porteneerqude porteneerqdue porteneerqdeu porteneeruqed porteneeruqde porteneerueqd porteneeruedq porteneerudeq porteneerudqe
porteneerdque porteneerdqeu porteneerduqe porteneerdueq porteneerdeuq porteneerdequ porteneeerqud porteneeerqdu porteneeeruqd
porteneeerudq porteneeerduq porteneeerdqu porteneeeqrud porteneeeqrdu porteneeequrd porteneeequdr porteneeeqdur porteneeeqdru
porteneeeuqrd porteneeeuqdr porteneeeurqd porteneeeurdq porteneeeudrq porteneeeudqr porteneeedqur porteneeedqru porteneeeduqr
porteneeedurq porteneeedruq porteneeedrqu porteneeqerud porteneeqerdu porteneeqeurd porteneeqeudr porteneeqedur porteneeqedru
porteneeqreud porteneeqredu porteneeqrued porteneeqrude porteneeqrdue porteneeqrdeu porteneequred porteneequrde porteneequerd
porteneequedr porteneequder porteneequdre porteneeqdrue porteneeqdreu porteneeqdure porteneeqduer porteneeqdeur porteneeqderu
porteneeueqrd porteneeueqdr porteneeuerqd porteneeuerdq porteneeuedrq porteneeuedqr porteneeuqerd porteneeuqedr porteneeuqred
porteneeuqrde porteneeuqdre porteneeuqder porteneeurqed porteneeurqde porteneeureqd porteneeuredq porteneeurdeq porteneeurdqe
porteneeudqre porteneeudqer porteneeudrqe porteneeudreq porteneeuderq porteneeudeqr porteneedequr porteneedeqru porteneedeuqr
porteneedeurq porteneederuq porteneederqu porteneedqeur porteneedqeru porteneedquer porteneedqure porteneedqrue porteneedqreu
porteneeduqer porteneeduqre porteneedueqr porteneeduerq porteneedureq porteneedurqe porteneedrque porteneedrqeu porteneedruqe
porteneedrueq porteneedreuq porteneedrequ portenereequd portenereeqdu portenereeuqd portenereeudq portenereeduq portenereedqu
portenereqeud portenereqedu portenerequed portenerequde portenereqdue portenereqdeu portenereuqed portenereuqde portenereueqd
portenereuedq portenereudeq portenereudqe porteneredque porteneredqeu portenereduqe porteneredueq porteneredeuq porteneredequ
portenereequd portenereeqdu portenereeuqd portenereeudq portenereeduq portenereedqu portenereqeud portenereqedu portenerequed
portenerequde portenereqdue portenereqdeu portenereuqed portenereuqde portenereueqd portenereuedq portenereudeq portenereudqe
porteneredque porteneredqeu portenereduqe porteneredueq porteneredeuq porteneredequ portenerqeeud portenerqeedu portenerqeued
portenerqeude portenerqedue portenerqedeu portenerqeeud portenerqeedu portenerqeued portenerqeude portenerqedue portenerqedeu
portenerqueed portenerquede portenerqueed portenerquede portenerqudee portenerqudee portenerqdeue portenerqdeeu portenerqduee
portenerqduee portenerqdeue portenerqdeeu portenerueqed portenerueqde portenerueeqd portenerueedq porteneruedeq porteneruedqe
porteneruqeed porteneruqede porteneruqeed porteneruqede porteneruqdee porteneruqdee portenerueqed portenerueqde portenerueeqd
portenerueedq porteneruedeq porteneruedqe portenerudqee portenerudqee portenerudeqe portenerudeeq portenerudeeq portenerudeqe
portenerdeque portenerdeqeu portenerdeuqe portenerdeueq portenerdeeuq portenerdeequ portenerdqeue portenerdqeeu portenerdquee
portenerdquee portenerdqeue portenerdqeeu portenerduqee portenerduqee portenerdueqe portenerdueeq portenerdueeq portenerdueqe
portenerdeque portenerdeqeu portenerdeuqe portenerdeueq portenerdeeuq portenerdeequ porteneerequd porteneereqdu porteneereuqd
porteneereudq porteneereduq porteneeredqu porteneerqeud porteneerqedu porteneerqued porteneerqude porteneerqdue porteneerqdeu
porteneeruqed porteneeruqde porteneerueqd porteneeruedq porteneerudeq porteneerudqe porteneerdque porteneerdqeu porteneerduqe
porteneerdueq porteneerdeuq porteneerdequ porteneeerqud porteneeerqdu porteneeeruqd porteneeerudq porteneeerduq porteneeerdqu
porteneeeqrud porteneeeqrdu porteneeequrd porteneeequdr porteneeeqdur porteneeeqdru porteneeeuqrd porteneeeuqdr porteneeeurqd
porteneeeurdq porteneeeudrq porteneeeudqr porteneeedqur porteneeedqru porteneeeduqr porteneeedurq porteneeedruq porteneeedrqu
porteneeqerud porteneeqerdu porteneeqeurd porteneeqeudr porteneeqedur porteneeqedru porteneeqreud porteneeqredu porteneeqrued
porteneeqrude porteneeqrdue porteneeqrdeu porteneequred porteneequrde porteneequerd porteneequedr porteneequder porteneequdre
porteneeqdrue porteneeqdreu porteneeqdure porteneeqduer porteneeqdeur porteneeqderu porteneeueqrd porteneeueqdr porteneeuerqd
porteneeuerdq porteneeuedrq porteneeuedqr porteneeuqerd porteneeuqedr porteneeuqred porteneeuqrde porteneeuqdre porteneeuqder
porteneeurqed porteneeurqde porteneeureqd porteneeuredq porteneeurdeq porteneeurdqe porteneeudqre porteneeudqer porteneeudrqe
porteneeudreq porteneeuderq porteneeudeqr porteneedequr porteneedeqru porteneedeuqr porteneedeurq porteneederuq porteneederqu
porteneedqeur porteneedqeru porteneedquer porteneedqure porteneedqrue porteneedqreu porteneeduqer porteneeduqre porteneedueqr
porteneeduerq porteneedureq porteneedurqe porteneedrque porteneedrqeu porteneedruqe porteneedrueq porteneedreuq porteneedrequ
porteneqreeud porteneqreedu porteneqreued porteneqreude porteneqredue porteneqredeu porteneqreeud porteneqreedu porteneqreued
porteneqreude porteneqredue porteneqredeu porteneqrueed porteneqruede porteneqrueed porteneqruede porteneqrudee porteneqrudee
porteneqrdeue porteneqrdeeu porteneqrduee porteneqrduee porteneqrdeue porteneqrdeeu porteneqereud porteneqeredu porteneqerued
porteneqerude porteneqerdue porteneqerdeu porteneqeerud porteneqeerdu porteneqeeurd porteneqeeudr porteneqeedur porteneqeedru
porteneqeuerd porteneqeuedr porteneqeured porteneqeurde porteneqeudre porteneqeuder porteneqedeur porteneqederu porteneqeduer
porteneqedure porteneqedrue porteneqedreu porteneqeerud porteneqeerdu porteneqeeurd porteneqeeudr porteneqeedur porteneqeedru
porteneqereud porteneqeredu porteneqerued porteneqerude porteneqerdue porteneqerdeu porteneqeured porteneqeurde porteneqeuerd
porteneqeuedr porteneqeuder porteneqeudre porteneqedrue porteneqedreu porteneqedure porteneqeduer porteneqedeur porteneqederu
portenequeerd portenequeedr portenequered portenequerde portenequedre portenequeder portenequeerd portenequeedr portenequered
portenequerde portenequedre portenequeder portenequreed portenequrede portenequreed portenequrede portenequrdee portenequrdee
portenequdere portenequdeer portenequdree portenequdree portenequdere portenequdeer porteneqdeeur porteneqdeeru porteneqdeuer
porteneqdeure porteneqderue porteneqdereu porteneqdeeur porteneqdeeru porteneqdeuer porteneqdeure porteneqderue porteneqdereu
porteneqdueer porteneqduere porteneqdueer porteneqduere porteneqduree porteneqduree porteneqdreue porteneqdreeu porteneqdruee
porteneqdruee porteneqdreue porteneqdreeu porteneureqed porteneureqde porteneureeqd porteneureedq porteneuredeq porteneuredqe
porteneurqeed porteneurqede porteneurqeed porteneurqede porteneurqdee porteneurqdee porteneureqed porteneureqde porteneureeqd
porteneureedq porteneuredeq porteneuredqe porteneurdqee porteneurdqee porteneurdeqe porteneurdeeq porteneurdeeq porteneurdeqe
porteneuerqed porteneuerqde porteneuereqd porteneueredq porteneuerdeq porteneuerdqe porteneueqred porteneueqrde porteneueqerd
porteneueqedr porteneueqder porteneueqdre porteneueeqrd porteneueeqdr porteneueerqd porteneueerdq porteneueedrq porteneueedqr
porteneuedqer porteneuedqre porteneuedeqr porteneuederq porteneuedreq porteneuedrqe porteneuqered porteneuqerde porteneuqeerd
porteneuqeedr porteneuqeder porteneuqedre porteneuqreed porteneuqrede porteneuqreed porteneuqrede porteneuqrdee porteneuqrdee
porteneuqered porteneuqerde porteneuqeerd porteneuqeedr porteneuqeder porteneuqedre porteneuqdree porteneuqdree porteneuqdere
porteneuqdeer porteneuqdeer porteneuqdere porteneueeqrd porteneueeqdr porteneueerqd porteneueerdq porteneueedrq porteneueedqr
porteneueqerd porteneueqedr porteneueqred porteneueqrde porteneueqdre porteneueqder porteneuerqed porteneuerqde porteneuereqd
porteneueredq porteneuerdeq porteneuerdqe porteneuedqre porteneuedqer porteneuedrqe porteneuedreq porteneuederq porteneuedeqr
porteneudeqer porteneudeqre porteneudeeqr porteneudeerq porteneudereq porteneuderqe porteneudqeer porteneudqere porteneudqeer
porteneudqere porteneudqree porteneudqree porteneudeqer porteneudeqre porteneudeeqr porteneudeerq porteneudereq porteneuderqe
porteneudrqee porteneudrqee porteneudreqe porteneudreeq porteneudreeq porteneudreqe portenedreque portenedreqeu portenedreuqe
portenedreueq portenedreeuq portenedreequ portenedrqeue portenedrqeeu portenedrquee portenedrquee portenedrqeue portenedrqeeu
portenedruqee portenedruqee portenedrueqe portenedrueeq portenedrueeq portenedrueqe portenedreque portenedreqeu portenedreuqe
portenedreueq portenedreeuq portenedreequ portenederque portenederqeu portenederuqe portenederueq portenedereuq portenederequ
portenedeqrue portenedeqreu portenedequre portenedequer portenedeqeur portenedeqeru portenedeuqre portenedeuqer portenedeurqe
portenedeureq portenedeuerq portenedeueqr portenedeequr portenedeeqru portenedeeuqr portenedeeurq portenedeeruq portenedeerqu
portenedqerue portenedqereu portenedqeure portenedqeuer portenedqeeur portenedqeeru portenedqreue portenedqreeu portenedqruee
portenedqruee portenedqreue portenedqreeu portenedquree portenedquree portenedquere portenedqueer portenedqueer portenedquere
portenedqerue portenedqereu portenedqeure portenedqeuer portenedqeeur portenedqeeru portenedueqre portenedueqer porteneduerqe
porteneduereq portenedueerq portenedueeqr porteneduqere porteneduqeer porteneduqree porteneduqree porteneduqere porteneduqeer
portenedurqee portenedurqee portenedureqe portenedureeq portenedureeq portenedureqe portenedueqre portenedueqer porteneduerqe
porteneduereq portenedueerq portenedueeqr portenedeequr portenedeeqru portenedeeuqr portenedeeurq portenedeeruq portenedeerqu
portenedeqeur portenedeqeru portenedequer portenedequre portenedeqrue portenedeqreu portenedeuqer portenedeuqre portenedeueqr
portenedeuerq portenedeureq portenedeurqe portenederque portenederqeu portenederuqe portenederueq portenedereuq portenederequ

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us