easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

barrages

munivisseque

motormen

textumque

musculoligamentous

uplights

crispiness

irasema

quaestoremque

greeno

svehla

thrashel

shakespearolatry

semideistical

unsatedness

intellectible

ehrler

geoffry


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: plagaque
cipher variations:
qmbhbrvf rncicswg sodjdtxh tpekeuyi uqflfvzj
vrgmgwak wshnhxbl xtioiycm yujpjzdn zvkqkaeo
awlrlbfp bxmsmcgq cyntndhr dzouoeis eapvpfjt
fbqwqgku gcrxrhlv hdsysimw ietztjnx jfuaukoy
kgvbvlpz lhwcwmqa mixdxnrb njyeyosc okzfzptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: plagaque
Cipher: koztzjfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: plagaque
Cipher: ABBBA ABABA AAAAA AABBA AAAAA ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: plagaque
cipher variations:
qmbhbrvfuibtbxjnyebfbdxvcabrbjldgwbdbpzlksbpbvntskbnbhpjwgbzbndr
acblbtrzeybxbzfhiubjbftpmqbvblhxrncicswgvjcucykozfcgceywdbcsckme
hxcecqamltcqcwoutlcociqkxhcacoesbdcmcusafzcycagijvckcguqnrcwcmiy
sodjdtxhwkdvdzlpagdhdfzxecdtdlnfiydfdrbnmudrdxpvumdpdjrlyidbdpft
cedndvtbgadzdbhjkwdldhvrosdxdnjztpekeuyixleweamqbheiegayfdeuemog
jzegesconveseyqwvneqeksmzjeceqgudfeoewuchbeaeciklxemeiwspteyeoka
uqflfvzjymfxfbnrcifjfhbzgefvfnphkafhftdpowftfzrxwofrfltnakfdfrhv
egfpfxvdicfbfdjlmyfnfjxtqufzfplbvrgmgwakzngygcosdjgkgicahfgwgoqi
lbgigueqpxgugasyxpgsgmuoblgegsiwfhgqgywejdgcgekmnzgogkyurvgagqmc
wshnhxblaohzhdptekhlhjdbighxhprjmchjhvfrqyhvhbtzyqhthnvpcmhfhtjx
gihrhzxfkehdhflnoahphlzvswhbhrndxtioiycmbpiaiequflimikecjhiyiqsk
ndikiwgsrziwicuazriuiowqdnigiukyhjisiayglfieigmopbiqimawtxicisoe
yujpjzdncqjbjfrvgmjnjlfdkijzjrtloejljxhtsajxjdvbasjvjpxreojhjvlz
ikjtjbzhmgjfjhnpqcjrjnbxuyjdjtpfzvkqkaeodrkckgswhnkokmgeljkaksum
pfkmkyiutbkykewcbtkwkqysfpkikwmajlkukcainhkgkioqrdkskocyvzkekuqg
awlrlbfpesldlhtxiolplnhfmklbltvnqglnlzjvuclzlfxdculxlrztgqljlxnb
kmlvldbjoilhljprseltlpdzwalflvrhbxmsmcgqftmemiuyjpmqmoignlmcmuwo
rhmomakwvdmamgyedvmymsauhrmkmyoclnmwmeckpjmimkqstfmumqeaxbmgmwsi
cyntndhrgunfnjvzkqnrnpjhomndnvxpsinpnblxwenbnhzfewnzntbvisnlnzpd
monxnfdlqknjnlrtugnvnrfbycnhnxtjdzouoeishvogokwalrosoqkipnoeowyq
tjoqocmyxfocoiagfxoaoucwjtomoaqenpoyogemrlokomsuvhowosgczdoioyuk
eapvpfjtiwphplxbmsptprljqopfpxzrukprpdnzygpdpjbhgypbpvdxkupnpbrf
oqpzphfnsmplpntvwipxpthdaepjpzvlfbqwqgkujxqiqmycntquqsmkrpqgqyas
vlqsqeoazhqeqkcihzqcqweylvqoqcsgprqaqigotnqmqouwxjqyquiebfqkqawm
gcrxrhlvkyrjrnzdourvrtnlsqrhrzbtwmrtrfpbairfrldjiardrxfzmwrprdth
qsrbrjhpuornrpvxykrzrvjfcgrlrbxnhdsysimwlzsksoaepvswsuomtrsisacu
xnsusgqcbjsgsmekjbsesyganxsqseuirtscskiqvpsosqwyzlsaswkgdhsmscyo
ietztjnxmatltpbfqwtxtvpnustjtbdvyotvthrdckthtnflkctftzhboytrtfvj
sutdtljrwqtptrxzamtbtxlheitntdzpjfuaukoynbumuqcgrxuyuwqovtukucew
zpuwuisedluiuogmlduguaicpzusugwktvueumksxruqusyabnucuymifjuoueaq
kgvbvlpzocvnvrdhsyvzvxrpwuvlvdfxaqvxvjtfemvjvphnmevhvbjdqavtvhxl
uwvfvnltysvrvtzbcovdvznjgkvpvfbrlhwcwmqapdwowseitzwawysqxvwmwegy
brwywkugfnwkwqionfwiwckerbwuwiymvxwgwomuztwswuacdpwewaokhlwqwgcs
mixdxnrbqexpxtfjuaxbxztrywxnxfhzcsxzxlvhgoxlxrjpogxjxdlfscxvxjzn
wyxhxpnvauxtxvbdeqxfxbplimxrxhdtnjyeyoscrfyqyugkvbycyauszxyoygia
dtyaymwihpymyskqphykyemgtdywykaoxzyiyqowbvyuywcefrygycqmjnysyieu
okzfzptdsgzrzvhlwczdzbvtayzpzhjbeuzbznxjiqznztlrqizlzfnhuezxzlbp
yazjzrpxcwzvzxdfgszhzdrnkoztzjfvplagaquethasawimxdaeacwubzaqaikc
fvacaoykjraoaumsrjamagoivfayamcqzbakasqydxawayeghtaiaesolpauakgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: plagaque
Cipher: cyntndhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: plagaque
Cipher: 5313112211145451

Extended Methods:
Method #1

Plaintext: plagaque
method variations:
uqfmfvzkzvlrlaepeaqwqfkukfvbvlpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
p l a g a q u e 
5 1 1 2 1 1 5 5 
3 3 1 2 1 4 4 1 
They are then read out in rows:
5112115533121441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: plagaque
Cipher: efaznfqd

Read more ...
Method #3

Plaintext: plagaque
method variations:
ccfbayyv cfbayyvc fbayyvcc
bayyvccf ayyvccfb yyvccfba
yvccfbay vccfbayy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: plagaque

first 5040 cipher variations(40320 total)
plagaque plagaqeu plagauqe plagaueq plagaeuq plagaequ plagqaue plagqaeu plagquae plagquea plagqeua
plagqeau plaguqae plaguqea plaguaqe plaguaeq plagueaq plagueqa plagequa plageqau plageuqa plageuaq
plageauq plageaqu plaagque plaagqeu plaaguqe plaagueq plaageuq plaagequ plaaqgue plaaqgeu plaaquge
plaaqueg plaaqeug plaaqegu plaauqge plaauqeg plaaugqe plaaugeq plaauegq plaaueqg plaaequg plaaeqgu
plaaeuqg plaaeugq plaaeguq plaaegqu plaqague plaqageu plaqauge plaqaueg plaqaeug plaqaegu plaqgaue
plaqgaeu plaqguae plaqguea plaqgeua plaqgeau plaqugae plaqugea plaquage plaquaeg plaqueag plaquega
plaqegua plaqegau plaqeuga plaqeuag plaqeaug plaqeagu plauaqge plauaqeg plauagqe plauageq plauaegq
plauaeqg plauqage plauqaeg plauqgae plauqgea plauqega plauqeag plaugqae plaugqea plaugaqe plaugaeq
plaugeaq plaugeqa plaueqga plaueqag plauegqa plauegaq plaueagq plaueaqg plaeaqug plaeaqgu plaeauqg
plaeaugq plaeaguq plaeagqu plaeqaug plaeqagu plaequag plaequga plaeqgua plaeqgau plaeuqag plaeuqga
plaeuaqg plaeuagq plaeugaq plaeugqa plaegqua plaegqau plaeguqa plaeguaq plaegauq plaegaqu plgaaque
plgaaqeu plgaauqe plgaaueq plgaaeuq plgaaequ plgaqaue plgaqaeu plgaquae plgaquea plgaqeua plgaqeau
plgauqae plgauqea plgauaqe plgauaeq plgaueaq plgaueqa plgaequa plgaeqau plgaeuqa plgaeuaq plgaeauq
plgaeaqu plgaaque plgaaqeu plgaauqe plgaaueq plgaaeuq plgaaequ plgaqaue plgaqaeu plgaquae plgaquea
plgaqeua plgaqeau plgauqae plgauqea plgauaqe plgauaeq plgaueaq plgaueqa plgaequa plgaeqau plgaeuqa
plgaeuaq plgaeauq plgaeaqu plgqaaue plgqaaeu plgqauae plgqauea plgqaeua plgqaeau plgqaaue plgqaaeu
plgqauae plgqauea plgqaeua plgqaeau plgquaae plgquaea plgquaae plgquaea plgqueaa plgqueaa plgqeaua
plgqeaau plgqeuaa plgqeuaa plgqeaua plgqeaau plguaqae plguaqea plguaaqe plguaaeq plguaeaq plguaeqa
plguqaae plguqaea plguqaae plguqaea plguqeaa plguqeaa plguaqae plguaqea plguaaqe plguaaeq plguaeaq
plguaeqa plgueqaa plgueqaa plgueaqa plgueaaq plgueaaq plgueaqa plgeaqua plgeaqau plgeauqa plgeauaq
plgeaauq plgeaaqu plgeqaua plgeqaau plgequaa plgequaa plgeqaua plgeqaau plgeuqaa plgeuqaa plgeuaqa
plgeuaaq plgeuaaq plgeuaqa plgeaqua plgeaqau plgeauqa plgeauaq plgeaauq plgeaaqu plagaque plagaqeu
plagauqe plagaueq plagaeuq plagaequ plagqaue plagqaeu plagquae plagquea plagqeua plagqeau plaguqae
plaguqea plaguaqe plaguaeq plagueaq plagueqa plagequa plageqau plageuqa plageuaq plageauq plageaqu
plaagque plaagqeu plaaguqe plaagueq plaageuq plaagequ plaaqgue plaaqgeu plaaquge plaaqueg plaaqeug
plaaqegu plaauqge plaauqeg plaaugqe plaaugeq plaauegq plaaueqg plaaequg plaaeqgu plaaeuqg plaaeugq
plaaeguq plaaegqu plaqague plaqageu plaqauge plaqaueg plaqaeug plaqaegu plaqgaue plaqgaeu plaqguae
plaqguea plaqgeua plaqgeau plaqugae plaqugea plaquage plaquaeg plaqueag plaquega plaqegua plaqegau
plaqeuga plaqeuag plaqeaug plaqeagu plauaqge plauaqeg plauagqe plauageq plauaegq plauaeqg plauqage
plauqaeg plauqgae plauqgea plauqega plauqeag plaugqae plaugqea plaugaqe plaugaeq plaugeaq plaugeqa
plaueqga plaueqag plauegqa plauegaq plaueagq plaueaqg plaeaqug plaeaqgu plaeauqg plaeaugq plaeaguq
plaeagqu plaeqaug plaeqagu plaequag plaequga plaeqgua plaeqgau plaeuqag plaeuqga plaeuaqg plaeuagq
plaeugaq plaeugqa plaegqua plaegqau plaeguqa plaeguaq plaegauq plaegaqu plqgaaue plqgaaeu plqgauae
plqgauea plqgaeua plqgaeau plqgaaue plqgaaeu plqgauae plqgauea plqgaeua plqgaeau plqguaae plqguaea
plqguaae plqguaea plqgueaa plqgueaa plqgeaua plqgeaau plqgeuaa plqgeuaa plqgeaua plqgeaau plqagaue
plqagaeu plqaguae plqaguea plqageua plqageau plqaague plqaageu plqaauge plqaaueg plqaaeug plqaaegu
plqauage plqauaeg plqaugae plqaugea plqauega plqaueag plqaeaug plqaeagu plqaeuag plqaeuga plqaegua
plqaegau plqaague plqaageu plqaauge plqaaueg plqaaeug plqaaegu plqagaue plqagaeu plqaguae plqaguea
plqageua plqageau plqaugae plqaugea plqauage plqauaeg plqaueag plqauega plqaegua plqaegau plqaeuga
plqaeuag plqaeaug plqaeagu plquaage plquaaeg plquagae plquagea plquaega plquaeag plquaage plquaaeg
plquagae plquagea plquaega plquaeag plqugaae plqugaea plqugaae plqugaea plqugeaa plqugeaa plqueaga
plqueaag plquegaa plquegaa plqueaga plqueaag plqeaaug plqeaagu plqeauag plqeauga plqeagua plqeagau
plqeaaug plqeaagu plqeauag plqeauga plqeagua plqeagau plqeuaag plqeuaga plqeuaag plqeuaga plqeugaa
plqeugaa plqegaua plqegaau plqeguaa plqeguaa plqegaua plqegaau plugaqae plugaqea plugaaqe plugaaeq
plugaeaq plugaeqa plugqaae plugqaea plugqaae plugqaea plugqeaa plugqeaa plugaqae plugaqea plugaaqe
plugaaeq plugaeaq plugaeqa plugeqaa plugeqaa plugeaqa plugeaaq plugeaaq plugeaqa pluagqae pluagqea
pluagaqe pluagaeq pluageaq pluageqa pluaqgae pluaqgea pluaqage pluaqaeg pluaqeag pluaqega pluaaqge
pluaaqeg pluaagqe pluaageq pluaaegq pluaaeqg pluaeqag pluaeqga pluaeaqg pluaeagq pluaegaq pluaegqa
pluqagae pluqagea pluqaage pluqaaeg pluqaeag pluqaega pluqgaae pluqgaea pluqgaae pluqgaea pluqgeaa
pluqgeaa pluqagae pluqagea pluqaage pluqaaeg pluqaeag pluqaega pluqegaa pluqegaa pluqeaga pluqeaag
pluqeaag pluqeaga pluaaqge pluaaqeg pluaagqe pluaageq pluaaegq pluaaeqg pluaqage pluaqaeg pluaqgae
pluaqgea pluaqega pluaqeag pluagqae pluagqea pluagaqe pluagaeq pluageaq pluageqa pluaeqga pluaeqag
pluaegqa pluaegaq pluaeagq pluaeaqg plueaqag plueaqga plueaaqg plueaagq plueagaq plueagqa plueqaag
plueqaga plueqaag plueqaga plueqgaa plueqgaa plueaqag plueaqga plueaaqg plueaagq plueagaq plueagqa
pluegqaa pluegqaa pluegaqa pluegaaq pluegaaq pluegaqa plegaqua plegaqau plegauqa plegauaq plegaauq
plegaaqu plegqaua plegqaau plegquaa plegquaa plegqaua plegqaau pleguqaa pleguqaa pleguaqa pleguaaq
pleguaaq pleguaqa plegaqua plegaqau plegauqa plegauaq plegaauq plegaaqu pleagqua pleagqau pleaguqa
pleaguaq pleagauq pleagaqu pleaqgua pleaqgau pleaquga pleaquag pleaqaug pleaqagu pleauqga pleauqag
pleaugqa pleaugaq pleauagq pleauaqg pleaaqug pleaaqgu pleaauqg pleaaugq pleaaguq pleaagqu pleqagua
pleqagau pleqauga pleqauag pleqaaug pleqaagu pleqgaua pleqgaau pleqguaa pleqguaa pleqgaua pleqgaau
plequgaa plequgaa plequaga plequaag plequaag plequaga pleqagua pleqagau pleqauga pleqauag pleqaaug
pleqaagu pleuaqga pleuaqag pleuagqa pleuagaq pleuaagq pleuaaqg pleuqaga pleuqaag pleuqgaa pleuqgaa
pleuqaga pleuqaag pleugqaa pleugqaa pleugaqa pleugaaq pleugaaq pleugaqa pleuaqga pleuaqag pleuagqa
pleuagaq pleuaagq pleuaaqg pleaaqug pleaaqgu pleaauqg pleaaugq pleaaguq pleaagqu pleaqaug pleaqagu
pleaquag pleaquga pleaqgua pleaqgau pleauqag pleauqga pleauaqg pleauagq pleaugaq pleaugqa pleagqua
pleagqau pleaguqa pleaguaq pleagauq pleagaqu palgaque palgaqeu palgauqe palgaueq palgaeuq palgaequ
palgqaue palgqaeu palgquae palgquea palgqeua palgqeau palguqae palguqea palguaqe palguaeq palgueaq
palgueqa palgequa palgeqau palgeuqa palgeuaq palgeauq palgeaqu palagque palagqeu palaguqe palagueq
palageuq palagequ palaqgue palaqgeu palaquge palaqueg palaqeug palaqegu palauqge palauqeg palaugqe
palaugeq palauegq palaueqg palaequg palaeqgu palaeuqg palaeugq palaeguq palaegqu palqague palqageu
palqauge palqaueg palqaeug palqaegu palqgaue palqgaeu palqguae palqguea palqgeua palqgeau palqugae
palqugea palquage palquaeg palqueag palquega palqegua palqegau palqeuga palqeuag palqeaug palqeagu
paluaqge paluaqeg paluagqe paluageq paluaegq paluaeqg paluqage paluqaeg paluqgae paluqgea paluqega
paluqeag palugqae palugqea palugaqe palugaeq palugeaq palugeqa palueqga palueqag paluegqa paluegaq
palueagq palueaqg paleaqug paleaqgu paleauqg paleaugq paleaguq paleagqu paleqaug paleqagu palequag
palequga paleqgua paleqgau paleuqag paleuqga paleuaqg paleuagq paleugaq paleugqa palegqua palegqau
paleguqa paleguaq palegauq palegaqu paglaque paglaqeu paglauqe paglaueq paglaeuq paglaequ paglqaue
paglqaeu paglquae paglquea paglqeua paglqeau pagluqae pagluqea pagluaqe pagluaeq paglueaq paglueqa
paglequa pagleqau pagleuqa pagleuaq pagleauq pagleaqu pagalque pagalqeu pagaluqe pagalueq pagaleuq
pagalequ pagaqlue pagaqleu pagaqule pagaquel pagaqeul pagaqelu pagauqle pagauqel pagaulqe pagauleq
pagauelq pagaueql pagaequl pagaeqlu pagaeuql pagaeulq pagaeluq pagaelqu pagqalue pagqaleu pagqaule
pagqauel pagqaeul pagqaelu pagqlaue pagqlaeu pagqluae pagqluea pagqleua pagqleau pagqulae pagqulea
pagquale pagquael pagqueal pagquela pagqelua pagqelau pagqeula pagqeual pagqeaul pagqealu paguaqle
paguaqel pagualqe pagualeq paguaelq paguaeql paguqale paguqael paguqlae paguqlea paguqela paguqeal
pagulqae pagulqea pagulaqe pagulaeq paguleaq paguleqa pagueqla pagueqal paguelqa paguelaq paguealq
pagueaql pageaqul pageaqlu pageauql pageaulq pagealuq pagealqu pageqaul pageqalu pagequal pagequla
pageqlua pageqlau pageuqal pageuqla pageuaql pageualq pageulaq pageulqa pagelqua pagelqau pageluqa
pageluaq pagelauq pagelaqu paaglque paaglqeu paagluqe paaglueq paagleuq paaglequ paagqlue paagqleu
paagqule paagquel paagqeul paagqelu paaguqle paaguqel paagulqe paaguleq paaguelq paagueql paagequl
paageqlu paageuql paageulq paageluq paagelqu paalgque paalgqeu paalguqe paalgueq paalgeuq paalgequ
paalqgue paalqgeu paalquge paalqueg paalqeug paalqegu paaluqge paaluqeg paalugqe paalugeq paaluegq
paalueqg paalequg paaleqgu paaleuqg paaleugq paaleguq paalegqu paaqlgue paaqlgeu paaqluge paaqlueg
paaqleug paaqlegu paaqglue paaqgleu paaqgule paaqguel paaqgeul paaqgelu paaqugle paaqugel paaqulge
paaquleg paaquelg paaquegl paaqegul paaqeglu paaqeugl paaqeulg paaqelug paaqelgu paaulqge paaulqeg
paaulgqe paaulgeq paaulegq paauleqg paauqlge paauqleg paauqgle paauqgel paauqegl paauqelg paaugqle
paaugqel paauglqe paaugleq paaugelq paaugeql paaueqgl paaueqlg paauegql paaueglq paauelgq paauelqg
paaelqug paaelqgu paaeluqg paaelugq paaelguq paaelgqu paaeqlug paaeqlgu paaequlg paaequgl paaeqgul
paaeqglu paaeuqlg paaeuqgl paaeulqg paaeulgq paaeuglq paaeugql paaegqul paaegqlu paaeguql paaegulq
paaegluq paaeglqu paqgalue paqgaleu paqgaule paqgauel paqgaeul paqgaelu paqglaue paqglaeu paqgluae
paqgluea paqgleua paqgleau paqgulae paqgulea paqguale paqguael paqgueal paqguela paqgelua paqgelau
paqgeula paqgeual paqgeaul paqgealu paqaglue paqagleu paqagule paqaguel paqageul paqagelu paqalgue
paqalgeu paqaluge paqalueg paqaleug paqalegu paqaulge paqauleg paqaugle paqaugel paqauegl paqauelg
paqaelug paqaelgu paqaeulg paqaeugl paqaegul paqaeglu paqlague paqlageu paqlauge paqlaueg paqlaeug
paqlaegu paqlgaue paqlgaeu paqlguae paqlguea paqlgeua paqlgeau paqlugae paqlugea paqluage paqluaeg
paqlueag paqluega paqlegua paqlegau paqleuga paqleuag paqleaug paqleagu paqualge paqualeg paquagle
paquagel paquaegl paquaelg paqulage paqulaeg paqulgae paqulgea paqulega paquleag paquglae paquglea
paqugale paqugael paqugeal paqugela paquelga paquelag paquegla paquegal paqueagl paquealg paqealug
paqealgu paqeaulg paqeaugl paqeagul paqeaglu paqelaug paqelagu paqeluag paqeluga paqelgua paqelgau
paqeulag paqeulga paqeualg paqeuagl paqeugal paqeugla paqeglua paqeglau paqegula paqegual paqegaul
paqegalu paugaqle paugaqel paugalqe paugaleq paugaelq paugaeql paugqale paugqael paugqlae paugqlea
paugqela paugqeal pauglqae pauglqea pauglaqe pauglaeq paugleaq paugleqa paugeqla paugeqal paugelqa
paugelaq paugealq paugeaql pauagqle pauagqel pauaglqe pauagleq pauagelq pauageql pauaqgle pauaqgel
pauaqlge pauaqleg pauaqelg pauaqegl paualqge paualqeg paualgqe paualgeq paualegq paualeqg pauaeqlg
pauaeqgl pauaelqg pauaelgq pauaeglq pauaegql pauqagle pauqagel pauqalge pauqaleg pauqaelg pauqaegl
pauqgale pauqgael pauqglae pauqglea pauqgela pauqgeal pauqlgae pauqlgea pauqlage pauqlaeg pauqleag
pauqlega pauqegla pauqegal pauqelga pauqelag pauqealg pauqeagl paulaqge paulaqeg paulagqe paulageq
paulaegq paulaeqg paulqage paulqaeg paulqgae paulqgea paulqega paulqeag paulgqae paulgqea paulgaqe
paulgaeq paulgeaq paulgeqa pauleqga pauleqag paulegqa paulegaq pauleagq pauleaqg paueaqlg paueaqgl
pauealqg pauealgq paueaglq paueagql paueqalg paueqagl paueqlag paueqlga paueqgla paueqgal pauelqag
pauelqga pauelaqg pauelagq pauelgaq pauelgqa pauegqla pauegqal paueglqa paueglaq pauegalq pauegaql
paegaqul paegaqlu paegauql paegaulq paegaluq paegalqu paegqaul paegqalu paegqual paegqula paegqlua
paegqlau paeguqal paeguqla paeguaql paegualq paegulaq paegulqa paeglqua paeglqau paegluqa paegluaq
paeglauq paeglaqu paeagqul paeagqlu paeaguql paeagulq paeagluq paeaglqu paeaqgul paeaqglu paeaqugl
paeaqulg paeaqlug paeaqlgu paeauqgl paeauqlg paeaugql paeauglq paeaulgq paeaulqg paealqug paealqgu
paealuqg paealugq paealguq paealgqu paeqagul paeqaglu paeqaugl paeqaulg paeqalug paeqalgu paeqgaul
paeqgalu paeqgual paeqgula paeqglua paeqglau paequgal paequgla paequagl paequalg paequlag paequlga
paeqlgua paeqlgau paeqluga paeqluag paeqlaug paeqlagu paeuaqgl paeuaqlg paeuagql paeuaglq paeualgq
paeualqg paeuqagl paeuqalg paeuqgal paeuqgla paeuqlga paeuqlag paeugqal paeugqla paeugaql paeugalq
paeuglaq paeuglqa paeulqga paeulqag paeulgqa paeulgaq paeulagq paeulaqg paelaqug paelaqgu paelauqg
paelaugq paelaguq paelagqu paelqaug paelqagu paelquag paelquga paelqgua paelqgau paeluqag paeluqga
paeluaqg paeluagq paelugaq paelugqa paelgqua paelgqau paelguqa paelguaq paelgauq paelgaqu pgalaque
pgalaqeu pgalauqe pgalaueq pgalaeuq pgalaequ pgalqaue pgalqaeu pgalquae pgalquea pgalqeua pgalqeau
pgaluqae pgaluqea pgaluaqe pgaluaeq pgalueaq pgalueqa pgalequa pgaleqau pgaleuqa pgaleuaq pgaleauq
pgaleaqu pgaalque pgaalqeu pgaaluqe pgaalueq pgaaleuq pgaalequ pgaaqlue pgaaqleu pgaaqule pgaaquel
pgaaqeul pgaaqelu pgaauqle pgaauqel pgaaulqe pgaauleq pgaauelq pgaaueql pgaaequl pgaaeqlu pgaaeuql
pgaaeulq pgaaeluq pgaaelqu pgaqalue pgaqaleu pgaqaule pgaqauel pgaqaeul pgaqaelu pgaqlaue pgaqlaeu
pgaqluae pgaqluea pgaqleua pgaqleau pgaqulae pgaqulea pgaquale pgaquael pgaqueal pgaquela pgaqelua
pgaqelau pgaqeula pgaqeual pgaqeaul pgaqealu pgauaqle pgauaqel pgaualqe pgaualeq pgauaelq pgauaeql
pgauqale pgauqael pgauqlae pgauqlea pgauqela pgauqeal pgaulqae pgaulqea pgaulaqe pgaulaeq pgauleaq
pgauleqa pgaueqla pgaueqal pgauelqa pgauelaq pgauealq pgaueaql pgaeaqul pgaeaqlu pgaeauql pgaeaulq
pgaealuq pgaealqu pgaeqaul pgaeqalu pgaequal pgaequla pgaeqlua pgaeqlau pgaeuqal pgaeuqla pgaeuaql
pgaeualq pgaeulaq pgaeulqa pgaelqua pgaelqau pgaeluqa pgaeluaq pgaelauq pgaelaqu pglaaque pglaaqeu
pglaauqe pglaaueq pglaaeuq pglaaequ pglaqaue pglaqaeu pglaquae pglaquea pglaqeua pglaqeau pglauqae
pglauqea pglauaqe pglauaeq pglaueaq pglaueqa pglaequa pglaeqau pglaeuqa pglaeuaq pglaeauq pglaeaqu
pglaaque pglaaqeu pglaauqe pglaaueq pglaaeuq pglaaequ pglaqaue pglaqaeu pglaquae pglaquea pglaqeua
pglaqeau pglauqae pglauqea pglauaqe pglauaeq pglaueaq pglaueqa pglaequa pglaeqau pglaeuqa pglaeuaq
pglaeauq pglaeaqu pglqaaue pglqaaeu pglqauae pglqauea pglqaeua pglqaeau pglqaaue pglqaaeu pglqauae
pglqauea pglqaeua pglqaeau pglquaae pglquaea pglquaae pglquaea pglqueaa pglqueaa pglqeaua pglqeaau
pglqeuaa pglqeuaa pglqeaua pglqeaau pgluaqae pgluaqea pgluaaqe pgluaaeq pgluaeaq pgluaeqa pgluqaae
pgluqaea pgluqaae pgluqaea pgluqeaa pgluqeaa pgluaqae pgluaqea pgluaaqe pgluaaeq pgluaeaq pgluaeqa
pglueqaa pglueqaa pglueaqa pglueaaq pglueaaq pglueaqa pgleaqua pgleaqau pgleauqa pgleauaq pgleaauq
pgleaaqu pgleqaua pgleqaau pglequaa pglequaa pgleqaua pgleqaau pgleuqaa pgleuqaa pgleuaqa pgleuaaq
pgleuaaq pgleuaqa pgleaqua pgleaqau pgleauqa pgleauaq pgleaauq pgleaaqu pgalaque pgalaqeu pgalauqe
pgalaueq pgalaeuq pgalaequ pgalqaue pgalqaeu pgalquae pgalquea pgalqeua pgalqeau pgaluqae pgaluqea
pgaluaqe pgaluaeq pgalueaq pgalueqa pgalequa pgaleqau pgaleuqa pgaleuaq pgaleauq pgaleaqu pgaalque
pgaalqeu pgaaluqe pgaalueq pgaaleuq pgaalequ pgaaqlue pgaaqleu pgaaqule pgaaquel pgaaqeul pgaaqelu
pgaauqle pgaauqel pgaaulqe pgaauleq pgaauelq pgaaueql pgaaequl pgaaeqlu pgaaeuql pgaaeulq pgaaeluq
pgaaelqu pgaqalue pgaqaleu pgaqaule pgaqauel pgaqaeul pgaqaelu pgaqlaue pgaqlaeu pgaqluae pgaqluea
pgaqleua pgaqleau pgaqulae pgaqulea pgaquale pgaquael pgaqueal pgaquela pgaqelua pgaqelau pgaqeula
pgaqeual pgaqeaul pgaqealu pgauaqle pgauaqel pgaualqe pgaualeq pgauaelq pgauaeql pgauqale pgauqael
pgauqlae pgauqlea pgauqela pgauqeal pgaulqae pgaulqea pgaulaqe pgaulaeq pgauleaq pgauleqa pgaueqla
pgaueqal pgauelqa pgauelaq pgauealq pgaueaql pgaeaqul pgaeaqlu pgaeauql pgaeaulq pgaealuq pgaealqu
pgaeqaul pgaeqalu pgaequal pgaequla pgaeqlua pgaeqlau pgaeuqal pgaeuqla pgaeuaql pgaeualq pgaeulaq
pgaeulqa pgaelqua pgaelqau pgaeluqa pgaeluaq pgaelauq pgaelaqu pgqlaaue pgqlaaeu pgqlauae pgqlauea
pgqlaeua pgqlaeau pgqlaaue pgqlaaeu pgqlauae pgqlauea pgqlaeua pgqlaeau pgqluaae pgqluaea pgqluaae
pgqluaea pgqlueaa pgqlueaa pgqleaua pgqleaau pgqleuaa pgqleuaa pgqleaua pgqleaau pgqalaue pgqalaeu
pgqaluae pgqaluea pgqaleua pgqaleau pgqaalue pgqaaleu pgqaaule pgqaauel pgqaaeul pgqaaelu pgqauale
pgqauael pgqaulae pgqaulea pgqauela pgqaueal pgqaeaul pgqaealu pgqaeual pgqaeula pgqaelua pgqaelau
pgqaalue pgqaaleu pgqaaule pgqaauel pgqaaeul pgqaaelu pgqalaue pgqalaeu pgqaluae pgqaluea pgqaleua
pgqaleau pgqaulae pgqaulea pgqauale pgqauael pgqaueal pgqauela pgqaelua pgqaelau pgqaeula pgqaeual
pgqaeaul pgqaealu pgquaale pgquaael pgqualae pgqualea pgquaela pgquaeal pgquaale pgquaael pgqualae
pgqualea pgquaela pgquaeal pgqulaae pgqulaea pgqulaae pgqulaea pgquleaa pgquleaa pgqueala pgqueaal
pgquelaa pgquelaa pgqueala pgqueaal pgqeaaul pgqeaalu pgqeaual pgqeaula pgqealua pgqealau pgqeaaul
pgqeaalu pgqeaual pgqeaula pgqealua pgqealau pgqeuaal pgqeuala pgqeuaal pgqeuala pgqeulaa pgqeulaa
pgqelaua pgqelaau pgqeluaa pgqeluaa pgqelaua pgqelaau pgulaqae pgulaqea pgulaaqe pgulaaeq pgulaeaq
pgulaeqa pgulqaae pgulqaea pgulqaae pgulqaea pgulqeaa pgulqeaa pgulaqae pgulaqea pgulaaqe pgulaaeq
pgulaeaq pgulaeqa pguleqaa pguleqaa pguleaqa pguleaaq pguleaaq pguleaqa pgualqae pgualqea pgualaqe
pgualaeq pgualeaq pgualeqa pguaqlae pguaqlea pguaqale pguaqael pguaqeal pguaqela pguaaqle pguaaqel
pguaalqe pguaaleq pguaaelq pguaaeql pguaeqal pguaeqla pguaeaql pguaealq pguaelaq pguaelqa pguqalae
pguqalea pguqaale pguqaael pguqaeal pguqaela pguqlaae pguqlaea pguqlaae pguqlaea pguqleaa pguqleaa
pguqalae pguqalea pguqaale pguqaael pguqaeal pguqaela pguqelaa pguqelaa pguqeala pguqeaal pguqeaal
pguqeala pguaaqle pguaaqel pguaalqe pguaaleq pguaaelq pguaaeql pguaqale pguaqael pguaqlae pguaqlea
pguaqela pguaqeal pgualqae pgualqea pgualaqe pgualaeq pgualeaq pgualeqa pguaeqla pguaeqal pguaelqa
pguaelaq pguaealq pguaeaql pgueaqal pgueaqla pgueaaql pgueaalq pguealaq pguealqa pgueqaal pgueqala
pgueqaal pgueqala pgueqlaa pgueqlaa pgueaqal pgueaqla pgueaaql pgueaalq pguealaq pguealqa pguelqaa
pguelqaa pguelaqa pguelaaq pguelaaq pguelaqa pgelaqua pgelaqau pgelauqa pgelauaq pgelaauq pgelaaqu
pgelqaua pgelqaau pgelquaa pgelquaa pgelqaua pgelqaau pgeluqaa pgeluqaa pgeluaqa pgeluaaq pgeluaaq
pgeluaqa pgelaqua pgelaqau pgelauqa pgelauaq pgelaauq pgelaaqu pgealqua pgealqau pgealuqa pgealuaq
pgealauq pgealaqu pgeaqlua pgeaqlau pgeaqula pgeaqual pgeaqaul pgeaqalu pgeauqla pgeauqal pgeaulqa
pgeaulaq pgeaualq pgeauaql pgeaaqul pgeaaqlu pgeaauql pgeaaulq pgeaaluq pgeaalqu pgeqalua pgeqalau
pgeqaula pgeqaual pgeqaaul pgeqaalu pgeqlaua pgeqlaau pgeqluaa pgeqluaa pgeqlaua pgeqlaau pgequlaa
pgequlaa pgequala pgequaal pgequaal pgequala pgeqalua pgeqalau pgeqaula pgeqaual pgeqaaul pgeqaalu
pgeuaqla pgeuaqal pgeualqa pgeualaq pgeuaalq pgeuaaql pgeuqala pgeuqaal pgeuqlaa pgeuqlaa pgeuqala
pgeuqaal pgeulqaa pgeulqaa pgeulaqa pgeulaaq pgeulaaq pgeulaqa pgeuaqla pgeuaqal pgeualqa pgeualaq
pgeuaalq pgeuaaql pgeaaqul pgeaaqlu pgeaauql pgeaaulq pgeaaluq pgeaalqu pgeaqaul pgeaqalu pgeaqual
pgeaqula pgeaqlua pgeaqlau pgeauqal pgeauqla pgeauaql pgeaualq pgeaulaq pgeaulqa pgealqua pgealqau
pgealuqa pgealuaq pgealauq pgealaqu paaglque paaglqeu paagluqe paaglueq paagleuq paaglequ paagqlue
paagqleu paagqule paagquel paagqeul paagqelu paaguqle paaguqel paagulqe paaguleq paaguelq paagueql
paagequl paageqlu paageuql paageulq paageluq paagelqu paalgque paalgqeu paalguqe paalgueq paalgeuq
paalgequ paalqgue paalqgeu paalquge paalqueg paalqeug paalqegu paaluqge paaluqeg paalugqe paalugeq
paaluegq paalueqg paalequg paaleqgu paaleuqg paaleugq paaleguq paalegqu paaqlgue paaqlgeu paaqluge
paaqlueg paaqleug paaqlegu paaqglue paaqgleu paaqgule paaqguel paaqgeul paaqgelu paaqugle paaqugel
paaqulge paaquleg paaquelg paaquegl paaqegul paaqeglu paaqeugl paaqeulg paaqelug paaqelgu paaulqge
paaulqeg paaulgqe paaulgeq paaulegq paauleqg paauqlge paauqleg paauqgle paauqgel paauqegl paauqelg
paaugqle paaugqel paauglqe paaugleq paaugelq paaugeql paaueqgl paaueqlg paauegql paaueglq paauelgq
paauelqg paaelqug paaelqgu paaeluqg paaelugq paaelguq paaelgqu paaeqlug paaeqlgu paaequlg paaequgl
paaeqgul paaeqglu paaeuqlg paaeuqgl paaeulqg paaeulgq paaeuglq paaeugql paaegqul paaegqlu paaeguql
paaegulq paaegluq paaeglqu pagalque pagalqeu pagaluqe pagalueq pagaleuq pagalequ pagaqlue pagaqleu
pagaqule pagaquel pagaqeul pagaqelu pagauqle pagauqel pagaulqe pagauleq pagauelq pagaueql pagaequl
pagaeqlu pagaeuql pagaeulq pagaeluq pagaelqu paglaque paglaqeu paglauqe paglaueq paglaeuq paglaequ
paglqaue paglqaeu paglquae paglquea paglqeua paglqeau pagluqae pagluqea pagluaqe pagluaeq paglueaq
paglueqa paglequa pagleqau pagleuqa pagleuaq pagleauq pagleaqu pagqlaue pagqlaeu pagqluae pagqluea
pagqleua pagqleau pagqalue pagqaleu pagqaule pagqauel pagqaeul pagqaelu pagquale pagquael pagqulae
pagqulea pagquela pagqueal pagqeaul pagqealu pagqeual pagqeula pagqelua pagqelau pagulqae pagulqea
pagulaqe pagulaeq paguleaq paguleqa paguqlae paguqlea paguqale paguqael paguqeal paguqela paguaqle
paguaqel pagualqe pagualeq paguaelq paguaeql pagueqal pagueqla pagueaql paguealq paguelaq paguelqa
pagelqua pagelqau pageluqa pageluaq pagelauq pagelaqu pageqlua pageqlau pagequla pagequal pageqaul
pageqalu pageuqla pageuqal pageulqa pageulaq pageualq pageuaql pageaqul pageaqlu pageauql pageaulq
pagealuq pagealqu palgaque palgaqeu palgauqe palgaueq palgaeuq palgaequ palgqaue palgqaeu palgquae
palgquea palgqeua palgqeau palguqae palguqea palguaqe palguaeq palgueaq palgueqa palgequa palgeqau
palgeuqa palgeuaq palgeauq palgeaqu palagque palagqeu palaguqe palagueq palageuq palagequ palaqgue
palaqgeu palaquge palaqueg palaqeug palaqegu palauqge palauqeg palaugqe palaugeq palauegq palaueqg
palaequg palaeqgu palaeuqg palaeugq palaeguq palaegqu palqague palqageu palqauge palqaueg palqaeug
palqaegu palqgaue palqgaeu palqguae palqguea palqgeua palqgeau palqugae palqugea palquage palquaeg
palqueag palquega palqegua palqegau palqeuga palqeuag palqeaug palqeagu paluaqge paluaqeg paluagqe
paluageq paluaegq paluaeqg paluqage paluqaeg paluqgae paluqgea paluqega paluqeag palugqae palugqea
palugaqe palugaeq palugeaq palugeqa palueqga palueqag paluegqa paluegaq palueagq palueaqg paleaqug
paleaqgu paleauqg paleaugq paleaguq paleagqu paleqaug paleqagu palequag palequga paleqgua paleqgau
paleuqag paleuqga paleuaqg paleuagq paleugaq paleugqa palegqua palegqau paleguqa paleguaq palegauq
palegaqu paqglaue paqglaeu paqgluae paqgluea paqgleua paqgleau paqgalue paqgaleu paqgaule paqgauel
paqgaeul paqgaelu paqguale paqguael paqgulae paqgulea paqguela paqgueal paqgeaul paqgealu paqgeual
paqgeula paqgelua paqgelau paqlgaue paqlgaeu paqlguae paqlguea paqlgeua paqlgeau paqlague paqlageu
paqlauge paqlaueg paqlaeug paqlaegu paqluage paqluaeg paqlugae paqlugea paqluega paqlueag paqleaug
paqleagu paqleuag paqleuga paqlegua paqlegau paqalgue paqalgeu paqaluge paqalueg paqaleug paqalegu
paqaglue paqagleu paqagule paqaguel paqageul paqagelu paqaugle paqaugel paqaulge paqauleg paqauelg
paqauegl paqaegul paqaeglu paqaeugl paqaeulg paqaelug paqaelgu paqulage paqulaeg paqulgae paqulgea
paqulega paquleag paqualge paqualeg paquagle paquagel paquaegl paquaelg paqugale paqugael paquglae
paquglea paqugela paqugeal paqueagl paquealg paquegal paquegla paquelga paquelag paqelaug paqelagu
paqeluag paqeluga paqelgua paqelgau paqealug paqealgu paqeaulg paqeaugl paqeagul paqeaglu paqeualg
paqeuagl paqeulag paqeulga paqeugla paqeugal paqegaul paqegalu paqegual paqegula paqeglua paqeglau
pauglqae pauglqea pauglaqe pauglaeq paugleaq paugleqa paugqlae paugqlea paugqale paugqael paugqeal
paugqela paugaqle paugaqel paugalqe paugaleq paugaelq paugaeql paugeqal paugeqla paugeaql paugealq
paugelaq paugelqa paulgqae paulgqea paulgaqe paulgaeq paulgeaq paulgeqa paulqgae paulqgea paulqage
paulqaeg paulqeag paulqega paulaqge paulaqeg paulagqe paulageq paulaegq paulaeqg pauleqag pauleqga
pauleaqg pauleagq paulegaq paulegqa pauqlgae pauqlgea pauqlage pauqlaeg pauqleag pauqlega pauqglae
pauqglea pauqgale pauqgael pauqgeal pauqgela pauqagle pauqagel pauqalge pauqaleg pauqaelg pauqaegl
pauqegal pauqegla pauqeagl pauqealg pauqelag pauqelga paualqge paualqeg paualgqe paualgeq paualegq
paualeqg pauaqlge pauaqleg pauaqgle pauaqgel pauaqegl pauaqelg pauagqle pauagqel pauaglqe pauagleq
pauagelq pauageql pauaeqgl pauaeqlg pauaegql pauaeglq pauaelgq pauaelqg pauelqag pauelqga pauelaqg
pauelagq pauelgaq pauelgqa paueqlag paueqlga paueqalg paueqagl paueqgal paueqgla paueaqlg paueaqgl
pauealqg pauealgq paueaglq paueagql pauegqal pauegqla pauegaql pauegalq paueglaq paueglqa paeglqua
paeglqau paegluqa paegluaq paeglauq paeglaqu paegqlua paegqlau paegqula paegqual paegqaul paegqalu
paeguqla paeguqal paegulqa paegulaq paegualq paeguaql paegaqul paegaqlu paegauql paegaulq paegaluq
paegalqu paelgqua paelgqau paelguqa paelguaq paelgauq paelgaqu paelqgua paelqgau paelquga paelquag
paelqaug paelqagu paeluqga paeluqag paelugqa paelugaq paeluagq paeluaqg paelaqug paelaqgu paelauqg
paelaugq paelaguq paelagqu paeqlgua paeqlgau paeqluga paeqluag paeqlaug paeqlagu paeqglua paeqglau
paeqgula paeqgual paeqgaul paeqgalu paequgla paequgal paequlga paequlag paequalg paequagl paeqagul
paeqaglu paeqaugl paeqaulg paeqalug paeqalgu paeulqga paeulqag paeulgqa paeulgaq paeulagq paeulaqg
paeuqlga paeuqlag paeuqgla paeuqgal paeuqagl paeuqalg paeugqla paeugqal paeuglqa paeuglaq paeugalq
paeugaql paeuaqgl paeuaqlg paeuagql paeuaglq paeualgq paeualqg paealqug paealqgu paealuqg paealugq
paealguq paealgqu paeaqlug paeaqlgu paeaqulg paeaqugl paeaqgul paeaqglu paeauqlg paeauqgl paeaulqg
paeaulgq paeauglq paeaugql paeagqul paeagqlu paeaguql paeagulq paeagluq paeaglqu pqagalue pqagaleu
pqagaule pqagauel pqagaeul pqagaelu pqaglaue pqaglaeu pqagluae pqagluea pqagleua pqagleau pqagulae
pqagulea pqaguale pqaguael pqagueal pqaguela pqagelua pqagelau pqageula pqageual pqageaul pqagealu
pqaaglue pqaagleu pqaagule pqaaguel pqaageul pqaagelu pqaalgue pqaalgeu pqaaluge pqaalueg pqaaleug
pqaalegu pqaaulge pqaauleg pqaaugle pqaaugel pqaauegl pqaauelg pqaaelug pqaaelgu pqaaeulg pqaaeugl
pqaaegul pqaaeglu pqalague pqalageu pqalauge pqalaueg pqalaeug pqalaegu pqalgaue pqalgaeu pqalguae
pqalguea pqalgeua pqalgeau pqalugae pqalugea pqaluage pqaluaeg pqalueag pqaluega pqalegua pqalegau
pqaleuga pqaleuag pqaleaug pqaleagu pqaualge pqaualeg pqauagle pqauagel pqauaegl pqauaelg pqaulage
pqaulaeg pqaulgae pqaulgea pqaulega pqauleag pqauglae pqauglea pqaugale pqaugael pqaugeal pqaugela
pqauelga pqauelag pqauegla pqauegal pqaueagl pqauealg pqaealug pqaealgu pqaeaulg pqaeaugl pqaeagul
pqaeaglu pqaelaug pqaelagu pqaeluag pqaeluga pqaelgua pqaelgau pqaeulag pqaeulga pqaeualg pqaeuagl
pqaeugal pqaeugla pqaeglua pqaeglau pqaegula pqaegual pqaegaul pqaegalu pqgaalue pqgaaleu pqgaaule
pqgaauel pqgaaeul pqgaaelu pqgalaue pqgalaeu pqgaluae pqgaluea pqgaleua pqgaleau pqgaulae pqgaulea
pqgauale pqgauael pqgaueal pqgauela pqgaelua pqgaelau pqgaeula pqgaeual pqgaeaul pqgaealu pqgaalue
pqgaaleu pqgaaule pqgaauel pqgaaeul pqgaaelu pqgalaue pqgalaeu pqgaluae pqgaluea pqgaleua pqgaleau
pqgaulae pqgaulea pqgauale pqgauael pqgaueal pqgauela pqgaelua pqgaelau pqgaeula pqgaeual pqgaeaul
pqgaealu pqglaaue pqglaaeu pqglauae pqglauea pqglaeua pqglaeau pqglaaue pqglaaeu pqglauae pqglauea
pqglaeua pqglaeau pqgluaae pqgluaea pqgluaae pqgluaea pqglueaa pqglueaa pqgleaua pqgleaau pqgleuaa
pqgleuaa pqgleaua pqgleaau pqgualae pqgualea pqguaale pqguaael pqguaeal pqguaela pqgulaae pqgulaea
pqgulaae pqgulaea pqguleaa pqguleaa pqgualae pqgualea pqguaale pqguaael pqguaeal pqguaela pqguelaa
pqguelaa pqgueala pqgueaal pqgueaal pqgueala pqgealua pqgealau pqgeaula pqgeaual pqgeaaul pqgeaalu
pqgelaua pqgelaau pqgeluaa pqgeluaa pqgelaua pqgelaau pqgeulaa pqgeulaa pqgeuala pqgeuaal pqgeuaal
pqgeuala pqgealua pqgealau pqgeaula pqgeaual pqgeaaul pqgeaalu pqagalue pqagaleu pqagaule pqagauel
pqagaeul pqagaelu pqaglaue pqaglaeu pqagluae pqagluea pqagleua pqagleau pqagulae pqagulea pqaguale
pqaguael pqagueal pqaguela pqagelua pqagelau pqageula pqageual pqageaul pqagealu pqaaglue pqaagleu
pqaagule pqaaguel pqaageul pqaagelu pqaalgue pqaalgeu pqaaluge pqaalueg pqaaleug pqaalegu pqaaulge
pqaauleg pqaaugle pqaaugel pqaauegl pqaauelg pqaaelug pqaaelgu pqaaeulg pqaaeugl pqaaegul pqaaeglu
pqalague pqalageu pqalauge pqalaueg pqalaeug pqalaegu pqalgaue pqalgaeu pqalguae pqalguea pqalgeua
pqalgeau pqalugae pqalugea pqaluage pqaluaeg pqalueag pqaluega pqalegua pqalegau pqaleuga pqaleuag
pqaleaug pqaleagu pqaualge pqaualeg pqauagle pqauagel pqauaegl pqauaelg pqaulage pqaulaeg pqaulgae
pqaulgea pqaulega pqauleag pqauglae pqauglea pqaugale pqaugael pqaugeal pqaugela pqauelga pqauelag
pqauegla pqauegal pqaueagl pqauealg pqaealug pqaealgu pqaeaulg pqaeaugl pqaeagul pqaeaglu pqaelaug
pqaelagu pqaeluag pqaeluga pqaelgua pqaelgau pqaeulag pqaeulga pqaeualg pqaeuagl pqaeugal pqaeugla
pqaeglua pqaeglau pqaegula pqaegual pqaegaul pqaegalu pqlgaaue pqlgaaeu pqlgauae pqlgauea pqlgaeua
pqlgaeau pqlgaaue pqlgaaeu pqlgauae pqlgauea pqlgaeua pqlgaeau pqlguaae pqlguaea pqlguaae pqlguaea
pqlgueaa pqlgueaa pqlgeaua pqlgeaau pqlgeuaa pqlgeuaa pqlgeaua pqlgeaau pqlagaue pqlagaeu pqlaguae
pqlaguea pqlageua pqlageau pqlaague pqlaageu pqlaauge pqlaaueg pqlaaeug pqlaaegu pqlauage pqlauaeg
pqlaugae pqlaugea pqlauega pqlaueag pqlaeaug pqlaeagu pqlaeuag pqlaeuga pqlaegua pqlaegau pqlaague
pqlaageu pqlaauge pqlaaueg pqlaaeug pqlaaegu pqlagaue pqlagaeu pqlaguae pqlaguea pqlageua pqlageau
pqlaugae pqlaugea pqlauage pqlauaeg pqlaueag pqlauega pqlaegua pqlaegau pqlaeuga pqlaeuag pqlaeaug
pqlaeagu pqluaage pqluaaeg pqluagae pqluagea pqluaega pqluaeag pqluaage pqluaaeg pqluagae pqluagea
pqluaega pqluaeag pqlugaae pqlugaea pqlugaae pqlugaea pqlugeaa pqlugeaa pqlueaga pqlueaag pqluegaa
pqluegaa pqlueaga pqlueaag pqleaaug pqleaagu pqleauag pqleauga pqleagua pqleagau pqleaaug pqleaagu
pqleauag pqleauga pqleagua pqleagau pqleuaag pqleuaga pqleuaag pqleuaga pqleugaa pqleugaa pqlegaua
pqlegaau pqleguaa pqleguaa pqlegaua pqlegaau pqugalae pqugalea pqugaale pqugaael pqugaeal pqugaela
pquglaae pquglaea pquglaae pquglaea pqugleaa pqugleaa pqugalae pqugalea pqugaale pqugaael pqugaeal
pqugaela pqugelaa pqugelaa pqugeala pqugeaal pqugeaal pqugeala pquaglae pquaglea pquagale pquagael
pquageal pquagela pqualgae pqualgea pqualage pqualaeg pqualeag pqualega pquaalge pquaaleg pquaagle
pquaagel pquaaegl pquaaelg pquaelag pquaelga pquaealg pquaeagl pquaegal pquaegla pqulagae pqulagea
pqulaage pqulaaeg pqulaeag pqulaega pqulgaae pqulgaea pqulgaae pqulgaea pqulgeaa pqulgeaa pqulagae
pqulagea pqulaage pqulaaeg pqulaeag pqulaega pqulegaa pqulegaa pquleaga pquleaag pquleaag pquleaga
pquaalge pquaaleg pquaagle pquaagel pquaaegl pquaaelg pqualage pqualaeg pqualgae pqualgea pqualega
pqualeag pquaglae pquaglea pquagale pquagael pquageal pquagela pquaelga pquaelag pquaegla pquaegal
pquaeagl pquaealg pquealag pquealga pqueaalg pqueaagl pqueagal pqueagla pquelaag pquelaga pquelaag
pquelaga pquelgaa pquelgaa pquealag pquealga pqueaalg pqueaagl pqueagal pqueagla pqueglaa pqueglaa
pquegala pquegaal pquegaal pquegala pqegalua pqegalau pqegaula pqegaual pqegaaul pqegaalu pqeglaua
pqeglaau pqegluaa pqegluaa pqeglaua pqeglaau pqegulaa pqegulaa pqeguala pqeguaal pqeguaal pqeguala
pqegalua pqegalau pqegaula pqegaual pqegaaul pqegaalu pqeaglua pqeaglau pqeagula pqeagual pqeagaul
pqeagalu pqealgua pqealgau pqealuga pqealuag pqealaug pqealagu pqeaulga pqeaulag pqeaugla pqeaugal
pqeauagl pqeaualg pqeaalug pqeaalgu pqeaaulg pqeaaugl pqeaagul pqeaaglu pqelagua pqelagau pqelauga
pqelauag pqelaaug pqelaagu pqelgaua pqelgaau pqelguaa pqelguaa pqelgaua pqelgaau pqelugaa pqelugaa
pqeluaga pqeluaag pqeluaag pqeluaga pqelagua pqelagau pqelauga pqelauag pqelaaug pqelaagu pqeualga
pqeualag pqeuagla pqeuagal pqeuaagl pqeuaalg pqeulaga pqeulaag pqeulgaa pqeulgaa pqeulaga pqeulaag
pqeuglaa pqeuglaa pqeugala pqeugaal pqeugaal pqeugala pqeualga pqeualag pqeuagla pqeuagal pqeuaagl
pqeuaalg pqeaalug pqeaalgu pqeaaulg pqeaaugl pqeaagul pqeaaglu pqealaug pqealagu pqealuag pqealuga
pqealgua pqealgau pqeaulag pqeaulga pqeaualg pqeauagl pqeaugal pqeaugla pqeaglua pqeaglau pqeagula
pqeagual pqeagaul pqeagalu puagaqle puagaqel puagalqe puagaleq puagaelq puagaeql puagqale puagqael
puagqlae puagqlea puagqela puagqeal puaglqae puaglqea puaglaqe puaglaeq puagleaq puagleqa puageqla
puageqal puagelqa puagelaq puagealq puageaql puaagqle puaagqel puaaglqe puaagleq puaagelq puaageql
puaaqgle puaaqgel puaaqlge puaaqleg puaaqelg puaaqegl puaalqge puaalqeg puaalgqe puaalgeq puaalegq
puaaleqg puaaeqlg puaaeqgl puaaelqg puaaelgq puaaeglq puaaegql puaqagle puaqagel puaqalge puaqaleg
puaqaelg puaqaegl puaqgale puaqgael puaqglae puaqglea puaqgela puaqgeal puaqlgae puaqlgea puaqlage
puaqlaeg puaqleag puaqlega puaqegla puaqegal puaqelga puaqelag puaqealg puaqeagl pualaqge pualaqeg
pualagqe pualageq pualaegq pualaeqg pualqage pualqaeg pualqgae pualqgea pualqega pualqeag pualgqae
pualgqea pualgaqe pualgaeq pualgeaq pualgeqa pualeqga pualeqag pualegqa pualegaq pualeagq pualeaqg
puaeaqlg puaeaqgl puaealqg puaealgq puaeaglq puaeagql puaeqalg puaeqagl puaeqlag puaeqlga puaeqgla
puaeqgal puaelqag puaelqga puaelaqg puaelagq puaelgaq puaelgqa puaegqla puaegqal puaeglqa puaeglaq
puaegalq puaegaql pugaaqle pugaaqel pugaalqe pugaaleq pugaaelq pugaaeql pugaqale pugaqael pugaqlae
pugaqlea pugaqela pugaqeal pugalqae pugalqea pugalaqe pugalaeq pugaleaq pugaleqa pugaeqla pugaeqal
pugaelqa pugaelaq pugaealq pugaeaql pugaaqle pugaaqel pugaalqe pugaaleq pugaaelq pugaaeql pugaqale
pugaqael pugaqlae pugaqlea pugaqela pugaqeal pugalqae pugalqea pugalaqe pugalaeq pugaleaq pugaleqa
pugaeqla pugaeqal pugaelqa pugaelaq pugaealq pugaeaql pugqaale pugqaael pugqalae pugqalea pugqaela
pugqaeal pugqaale pugqaael pugqalae pugqalea pugqaela pugqaeal pugqlaae pugqlaea pugqlaae pugqlaea
pugqleaa pugqleaa pugqeala pugqeaal pugqelaa pugqelaa pugqeala pugqeaal puglaqae puglaqea puglaaqe
puglaaeq puglaeaq puglaeqa puglqaae puglqaea puglqaae puglqaea puglqeaa puglqeaa puglaqae puglaqea
puglaaqe puglaaeq puglaeaq puglaeqa pugleqaa pugleqaa pugleaqa pugleaaq pugleaaq pugleaqa pugeaqla
pugeaqal pugealqa pugealaq pugeaalq pugeaaql pugeqala pugeqaal pugeqlaa pugeqlaa pugeqala pugeqaal
pugelqaa pugelqaa pugelaqa pugelaaq pugelaaq pugelaqa pugeaqla pugeaqal pugealqa pugealaq pugeaalq
pugeaaql puagaqle puagaqel puagalqe puagaleq puagaelq puagaeql puagqale puagqael puagqlae puagqlea
puagqela puagqeal puaglqae puaglqea puaglaqe puaglaeq puagleaq puagleqa puageqla puageqal puagelqa
puagelaq puagealq puageaql puaagqle puaagqel puaaglqe puaagleq puaagelq puaageql puaaqgle puaaqgel
puaaqlge puaaqleg puaaqelg puaaqegl puaalqge puaalqeg puaalgqe puaalgeq puaalegq puaaleqg puaaeqlg
puaaeqgl puaaelqg puaaelgq puaaeglq puaaegql puaqagle puaqagel puaqalge puaqaleg puaqaelg puaqaegl
puaqgale puaqgael puaqglae puaqglea puaqgela puaqgeal puaqlgae puaqlgea puaqlage puaqlaeg puaqleag
puaqlega puaqegla puaqegal puaqelga puaqelag puaqealg puaqeagl pualaqge pualaqeg pualagqe pualageq
pualaegq pualaeqg pualqage pualqaeg pualqgae pualqgea pualqega pualqeag pualgqae pualgqea pualgaqe
pualgaeq pualgeaq pualgeqa pualeqga pualeqag pualegqa pualegaq pualeagq pualeaqg puaeaqlg puaeaqgl
puaealqg puaealgq puaeaglq puaeagql puaeqalg puaeqagl puaeqlag puaeqlga puaeqgla puaeqgal puaelqag
puaelqga puaelaqg puaelagq puaelgaq puaelgqa puaegqla puaegqal puaeglqa puaeglaq puaegalq puaegaql
puqgaale puqgaael puqgalae puqgalea puqgaela puqgaeal puqgaale puqgaael puqgalae puqgalea puqgaela
puqgaeal puqglaae puqglaea puqglaae puqglaea puqgleaa puqgleaa puqgeala puqgeaal puqgelaa puqgelaa
puqgeala puqgeaal puqagale puqagael puqaglae puqaglea puqagela puqageal puqaagle puqaagel puqaalge
puqaaleg puqaaelg puqaaegl puqalage puqalaeg puqalgae puqalgea puqalega puqaleag puqaealg puqaeagl
puqaelag puqaelga puqaegla puqaegal puqaagle puqaagel puqaalge puqaaleg puqaaelg puqaaegl puqagale
puqagael puqaglae puqaglea puqagela puqageal puqalgae puqalgea puqalage puqalaeg puqaleag puqalega
puqaegla puqaegal puqaelga puqaelag puqaealg puqaeagl puqlaage puqlaaeg puqlagae puqlagea puqlaega
puqlaeag puqlaage puqlaaeg puqlagae puqlagea puqlaega puqlaeag puqlgaae puqlgaea puqlgaae puqlgaea
puqlgeaa puqlgeaa puqleaga puqleaag puqlegaa puqlegaa puqleaga puqleaag puqeaalg puqeaagl puqealag
puqealga puqeagla puqeagal puqeaalg puqeaagl puqealag puqealga puqeagla puqeagal puqelaag puqelaga
puqelaag puqelaga puqelgaa puqelgaa puqegala puqegaal puqeglaa puqeglaa puqegala puqegaal pulgaqae
pulgaqea pulgaaqe pulgaaeq pulgaeaq pulgaeqa pulgqaae pulgqaea pulgqaae pulgqaea pulgqeaa pulgqeaa
pulgaqae pulgaqea pulgaaqe pulgaaeq pulgaeaq pulgaeqa pulgeqaa pulgeqaa pulgeaqa pulgeaaq pulgeaaq
pulgeaqa pulagqae pulagqea pulagaqe pulagaeq pulageaq pulageqa pulaqgae pulaqgea pulaqage pulaqaeg
pulaqeag pulaqega pulaaqge pulaaqeg pulaagqe pulaageq pulaaegq pulaaeqg pulaeqag pulaeqga pulaeaqg
pulaeagq pulaegaq pulaegqa pulqagae pulqagea pulqaage pulqaaeg pulqaeag pulqaega pulqgaae pulqgaea
pulqgaae pulqgaea pulqgeaa pulqgeaa pulqagae pulqagea pulqaage pulqaaeg pulqaeag pulqaega pulqegaa
pulqegaa pulqeaga pulqeaag pulqeaag pulqeaga pulaaqge pulaaqeg pulaagqe pulaageq pulaaegq pulaaeqg
pulaqage pulaqaeg pulaqgae pulaqgea pulaqega pulaqeag pulagqae pulagqea pulagaqe pulagaeq pulageaq
pulageqa pulaeqga pulaeqag pulaegqa pulaegaq pulaeagq pulaeaqg puleaqag puleaqga puleaaqg puleaagq
puleagaq puleagqa puleqaag puleqaga puleqaag puleqaga puleqgaa puleqgaa puleaqag puleaqga puleaaqg
puleaagq puleagaq puleagqa pulegqaa pulegqaa pulegaqa pulegaaq pulegaaq pulegaqa puegaqla puegaqal
puegalqa puegalaq puegaalq puegaaql puegqala puegqaal puegqlaa puegqlaa puegqala puegqaal pueglqaa
pueglqaa pueglaqa pueglaaq pueglaaq pueglaqa puegaqla puegaqal puegalqa puegalaq puegaalq puegaaql
pueagqla pueagqal pueaglqa pueaglaq pueagalq pueagaql pueaqgla pueaqgal pueaqlga pueaqlag pueaqalg
pueaqagl puealqga puealqag puealgqa puealgaq puealagq puealaqg pueaaqlg pueaaqgl pueaalqg pueaalgq
pueaaglq pueaagql pueqagla pueqagal pueqalga pueqalag pueqaalg pueqaagl pueqgala pueqgaal pueqglaa
pueqglaa pueqgala pueqgaal pueqlgaa pueqlgaa pueqlaga pueqlaag pueqlaag pueqlaga pueqagla pueqagal
pueqalga pueqalag pueqaalg pueqaagl puelaqga puelaqag puelagqa puelagaq puelaagq puelaaqg puelqaga
puelqaag puelqgaa puelqgaa puelqaga puelqaag puelgqaa puelgqaa puelgaqa puelgaaq puelgaaq puelgaqa
puelaqga puelaqag puelagqa puelagaq puelaagq puelaaqg pueaaqlg pueaaqgl pueaalqg pueaalgq pueaaglq
pueaagql pueaqalg pueaqagl pueaqlag pueaqlga pueaqgla pueaqgal puealqag puealqga puealaqg puealagq
puealgaq puealgqa pueagqla pueagqal pueaglqa pueaglaq pueagalq pueagaql peagaqul peagaqlu peagauql
peagaulq peagaluq peagalqu peagqaul peagqalu peagqual peagqula peagqlua peagqlau peaguqal peaguqla
peaguaql peagualq peagulaq peagulqa peaglqua peaglqau peagluqa peagluaq peaglauq peaglaqu peaagqul
peaagqlu peaaguql peaagulq peaagluq peaaglqu peaaqgul peaaqglu peaaqugl peaaqulg peaaqlug peaaqlgu
peaauqgl peaauqlg peaaugql peaauglq peaaulgq peaaulqg peaalqug peaalqgu peaaluqg peaalugq peaalguq
peaalgqu peaqagul peaqaglu peaqaugl peaqaulg peaqalug peaqalgu peaqgaul peaqgalu peaqgual peaqgula
peaqglua peaqglau peaqugal peaqugla peaquagl peaqualg peaqulag peaqulga peaqlgua peaqlgau peaqluga
peaqluag peaqlaug peaqlagu peauaqgl peauaqlg peauagql peauaglq peaualgq peaualqg peauqagl peauqalg
peauqgal peauqgla peauqlga peauqlag peaugqal peaugqla peaugaql peaugalq peauglaq peauglqa peaulqga
peaulqag peaulgqa peaulgaq peaulagq peaulaqg pealaqug pealaqgu pealauqg pealaugq pealaguq pealagqu
pealqaug pealqagu pealquag pealquga pealqgua pealqgau pealuqag pealuqga pealuaqg pealuagq pealugaq
pealugqa pealgqua pealgqau pealguqa pealguaq pealgauq pealgaqu pegaaqul pegaaqlu pegaauql pegaaulq
pegaaluq pegaalqu pegaqaul pegaqalu pegaqual pegaqula pegaqlua pegaqlau pegauqal pegauqla pegauaql
pegaualq pegaulaq pegaulqa pegalqua pegalqau pegaluqa pegaluaq pegalauq pegalaqu pegaaqul pegaaqlu
pegaauql pegaaulq pegaaluq pegaalqu pegaqaul pegaqalu pegaqual pegaqula pegaqlua pegaqlau pegauqal
pegauqla pegauaql pegaualq pegaulaq pegaulqa pegalqua pegalqau pegaluqa pegaluaq pegalauq pegalaqu
pegqaaul pegqaalu pegqaual pegqaula pegqalua pegqalau pegqaaul pegqaalu pegqaual pegqaula pegqalua
pegqalau pegquaal pegquala pegquaal pegquala pegqulaa pegqulaa pegqlaua pegqlaau pegqluaa pegqluaa
pegqlaua pegqlaau peguaqal peguaqla peguaaql peguaalq pegualaq pegualqa peguqaal peguqala peguqaal
peguqala peguqlaa peguqlaa peguaqal peguaqla peguaaql peguaalq pegualaq pegualqa pegulqaa pegulqaa
pegulaqa pegulaaq pegulaaq pegulaqa peglaqua peglaqau peglauqa peglauaq peglaauq peglaaqu peglqaua
peglqaau peglquaa peglquaa peglqaua peglqaau pegluqaa pegluqaa pegluaqa pegluaaq pegluaaq pegluaqa
peglaqua peglaqau peglauqa peglauaq peglaauq peglaaqu peagaqul peagaqlu peagauql peagaulq peagaluq
peagalqu peagqaul peagqalu peagqual peagqula peagqlua peagqlau peaguqal peaguqla peaguaql peagualq
peagulaq peagulqa peaglqua peaglqau peagluqa peagluaq peaglauq peaglaqu peaagqul peaagqlu peaaguql
peaagulq peaagluq peaaglqu peaaqgul peaaqglu peaaqugl peaaqulg peaaqlug peaaqlgu peaauqgl peaauqlg
peaaugql peaauglq peaaulgq peaaulqg peaalqug peaalqgu peaaluqg peaalugq peaalguq peaalgqu peaqagul
peaqaglu peaqaugl peaqaulg peaqalug peaqalgu peaqgaul peaqgalu peaqgual peaqgula peaqglua peaqglau
peaqugal peaqugla peaquagl peaqualg peaqulag peaqulga peaqlgua peaqlgau peaqluga peaqluag peaqlaug
peaqlagu peauaqgl peauaqlg peauagql peauaglq peaualgq peaualqg peauqagl peauqalg peauqgal peauqgla
peauqlga peauqlag peaugqal peaugqla peaugaql peaugalq peauglaq peauglqa peaulqga peaulqag peaulgqa
peaulgaq peaulagq peaulaqg pealaqug pealaqgu pealauqg pealaugq pealaguq pealagqu pealqaug pealqagu
pealquag pealquga pealqgua pealqgau pealuqag pealuqga pealuaqg pealuagq pealugaq pealugqa pealgqua
pealgqau pealguqa pealguaq pealgauq pealgaqu peqgaaul peqgaalu peqgaual peqgaula peqgalua peqgalau
peqgaaul peqgaalu peqgaual peqgaula peqgalua peqgalau peqguaal peqguala peqguaal peqguala peqgulaa
peqgulaa peqglaua peqglaau peqgluaa peqgluaa peqglaua peqglaau peqagaul peqagalu peqagual peqagula
peqaglua peqaglau peqaagul peqaaglu peqaaugl peqaaulg peqaalug peqaalgu peqauagl peqaualg peqaugal
peqaugla peqaulga peqaulag peqalaug peqalagu peqaluag peqaluga peqalgua peqalgau peqaagul peqaaglu
peqaaugl peqaaulg peqaalug peqaalgu peqagaul peqagalu peqagual peqagula peqaglua peqaglau peqaugal
peqaugla peqauagl peqaualg peqaulag peqaulga peqalgua peqalgau peqaluga peqaluag peqalaug peqalagu
pequaagl pequaalg pequagal pequagla pequalga pequalag pequaagl pequaalg pequagal pequagla pequalga
pequalag pequgaal pequgala pequgaal pequgala pequglaa pequglaa pequlaga pequlaag pequlgaa pequlgaa
pequlaga pequlaag peqlaaug peqlaagu peqlauag peqlauga peqlagua peqlagau peqlaaug peqlaagu peqlauag
peqlauga peqlagua peqlagau peqluaag peqluaga peqluaag peqluaga peqlugaa peqlugaa peqlgaua peqlgaau
peqlguaa peqlguaa peqlgaua peqlgaau peugaqal peugaqla peugaaql peugaalq peugalaq peugalqa peugqaal
peugqala peugqaal peugqala peugqlaa peugqlaa peugaqal peugaqla peugaaql peugaalq peugalaq peugalqa
peuglqaa peuglqaa peuglaqa peuglaaq peuglaaq peuglaqa peuagqal peuagqla peuagaql peuagalq peuaglaq
peuaglqa peuaqgal peuaqgla peuaqagl peuaqalg peuaqlag peuaqlga peuaaqgl peuaaqlg peuaagql peuaaglq
peuaalgq peuaalqg peualqag peualqga peualaqg peualagq peualgaq peualgqa peuqagal peuqagla peuqaagl
peuqaalg peuqalag peuqalga peuqgaal peuqgala peuqgaal peuqgala peuqglaa peuqglaa peuqagal peuqagla
peuqaagl peuqaalg peuqalag peuqalga peuqlgaa peuqlgaa peuqlaga peuqlaag peuqlaag peuqlaga peuaaqgl
peuaaqlg peuaagql peuaaglq peuaalgq peuaalqg peuaqagl peuaqalg peuaqgal peuaqgla peuaqlga peuaqlag
peuagqal peuagqla peuagaql peuagalq peuaglaq peuaglqa peualqga peualqag peualgqa peualgaq peualagq
peualaqg peulaqag peulaqga peulaaqg peulaagq peulagaq peulagqa peulqaag peulqaga peulqaag peulqaga
peulqgaa peulqgaa peulaqag peulaqga peulaaqg peulaagq peulagaq peulagqa peulgqaa peulgqaa peulgaqa
peulgaaq peulgaaq peulgaqa pelgaqua pelgaqau pelgauqa pelgauaq pelgaauq pelgaaqu pelgqaua pelgqaau
pelgquaa pelgquaa pelgqaua pelgqaau pelguqaa pelguqaa pelguaqa pelguaaq pelguaaq pelguaqa pelgaqua
pelgaqau pelgauqa pelgauaq pelgaauq pelgaaqu pelagqua pelagqau pelaguqa pelaguaq pelagauq pelagaqu
pelaqgua pelaqgau pelaquga pelaquag pelaqaug pelaqagu pelauqga pelauqag pelaugqa pelaugaq pelauagq
pelauaqg pelaaqug pelaaqgu pelaauqg pelaaugq pelaaguq pelaagqu pelqagua pelqagau pelqauga pelqauag
pelqaaug pelqaagu pelqgaua pelqgaau pelqguaa pelqguaa pelqgaua pelqgaau pelqugaa pelqugaa pelquaga
pelquaag pelquaag pelquaga pelqagua pelqagau pelqauga pelqauag pelqaaug pelqaagu peluaqga peluaqag
peluagqa peluagaq peluaagq peluaaqg peluqaga peluqaag peluqgaa peluqgaa peluqaga peluqaag pelugqaa
pelugqaa pelugaqa pelugaaq pelugaaq pelugaqa peluaqga peluaqag peluagqa peluagaq peluaagq peluaaqg
pelaaqug pelaaqgu pelaauqg pelaaugq pelaaguq pelaagqu pelaqaug pelaqagu pelaquag pelaquga pelaqgua
pelaqgau pelauqag pelauqga pelauaqg pelauagq pelaugaq pelaugqa pelagqua pelagqau pelaguqa pelaguaq
pelagauq pelagaqu

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us