easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

uncapableness

macaques

chippie

umbilicar

nullas

tastelessness

socko

famave

recoaling

krolikowski

altadena

argentate

vagabaminique

ameloblast

earwise

rossiniana

meiosis

amyloids


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: perueniebasque
cipher variations:
qfsvfojfcbtrvf rgtwgpkgdcuswg shuxhqlhedvtxh tivyirmifewuyi ujwzjsnjgfxvzj
vkxaktokhgywak wlybluplihzxbl xmzcmvqmjiaycm ynadnwrnkjbzdn zobeoxsolkcaeo
apcfpytpmldbfp bqdgqzuqnmecgq crehravronfdhr dsfisbwspogeis etgjtcxtqphfjt
fuhkudyurqigku gvilvezvsrjhlv hwjmwfawtskimw ixknxgbxutljnx jyloyhcyvumkoy
kzmpzidzwvnlpz lanqajeaxwomqa mborbkfbyxpnrb ncpsclgczyqosc odqtdmhdazrptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: perueniebasque
Cipher: kvifvmrvyzhjfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: perueniebasque
Cipher: ABBBA AABAA BAAAA BAABB AABAA ABBAA ABAAA AABAA AAAAB AAAAA BAAAB ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: perueniebasque
cipher variations:
qfsvfojfcbtrvfunajnoznebdxjnyvixvopvgbndxvcdqldofdibxjldglyzlovlkbhpzlktgntoltmbrvntsjwpjorjqblhpjwredrohrsbvndr
azmrzoxzubftrzehufhonhwbpzfhipctpodpybzftpmxkhxotxabjlhxrgtwgpkgdcuswgvobkopaofceykozwjywpqwhcoeywdermepgejcykme
hmzampwmlciqamluhoupmuncswoutkxqkpskrcmiqkxsfespistcwoesbansapyavcgusafivgipoixcqagijqduqpeqzcaguqnyliypuybckmiy
shuxhqlhedvtxhwpclpqbpgdfzlpaxkzxqrxidpfzxefsnfqhfkdzlnfinabnqxnmdjrbnmvipvqnvodtxpvulyrlqtlsdnjrlytgftqjtudxpft
cbotbqzbwdhvtbgjwhjqpjydrbhjkrevrqfradbhvrozmjzqvzcdlnjztivyirmifewuyixqdmqrcqhegamqbylayrsyjeqgayfgtogrigleamog
jobcoryoneksconwjqwrowpeuyqwvmzsmrumteoksmzuhgurkuveyqgudcpucracxeiwuchkxikrqkzesciklsfwsrgsbeciwspankarwademoka
ujwzjsnjgfxvzjyrenrsdrifhbnrczmbzstzkfrhbzghuphsjhmfbnphkpcdpszpofltdpoxkrxspxqfvzrxwnatnsvnufpltnavihvslvwfzrhv
edqvdsbdyfjxvdilyjlsrlaftdjlmtgxtshtcfdjxtqbolbsxbefnplbvkxaktokhgywakzsfostesjgicosdancatualgsicahivqitkingcoqi
lqdeqtaqpgmueqpylsytqyrgwasyxobuotwovgqmuobwjiwtmwxgasiwferwetcezgkywejmzkmtsmbguekmnuhyutiudgekyurcpmctycfgoqmc
wlybluplihzxblatgptuftkhjdptebodbuvbmhtjdbijwrjuljohdprjmrefrubrqhnvfrqzmtzurzshxbtzypcvpuxpwhrnvpcxkjxunxyhbtjx
gfsxfudfahlzxfknalnutnchvflnovizvujvehflzvsdqnduzdghprndxmzcmvqmjiaycmbuhquvgulikequfcpecvwcniukecjkxskvmkpieqsk
nsfgsvcsriowgsranuavsatiycuazqdwqvyqxisowqdylkyvoyzicukyhgtygvegbimayglobmovuodiwgmopwjawvkwfigmawteroevaehiqsoe
ynadnwrnkjbzdncvirvwhvmjlfrvgdqfdwxdojvlfdklytlwnlqjfrtlotghtwdtsjpxhtsbovbwtbujzdvbarexrwzryjtpxrezmlzwpzajdvlz
ihuzhwfhcjnbzhmpcnpwvpejxhnpqxkbxwlxgjhnbxufspfwbfijrtpfzobeoxsolkcaeodwjswxiwnkmgswhergexyepkwmgelmzumxomrkgsum
puhiuxeutkqyiutcpwcxucvkaewcbsfysxaszkuqysfanmaxqabkewmajivaixgidkocainqdoqxwqfkyioqrylcyxmyhkiocyvgtqgxcgjksuqg
apcfpytpmldbfpexktxyjxolnhtxifshfyzfqlxnhfmnavnypnslhtvnqvijvyfvulrzjvudqxdyvdwlbfxdctgztybtalvrztgbonbyrbclfxnb
kjwbjyhjelpdbjorepryxrglzjprszmdzynziljpdzwhurhydhkltvrhbqdgqzuqnmecgqfyluyzkypmoiuyjgtigzagrmyoignobwozqotmiuwo
rwjkwzgwvmsakwveryezwexmcgyeduhauzcubmwsauhcpoczscdmgyoclkxckzikfmqeckpsfqszyshmakqstaneazoajmkqeaxivsizeilmuwsi
crehravronfdhrgzmvzalzqnpjvzkhujhabhsnzpjhopcxparpunjvxpsxklxahxwntblxwfszfaxfyndhzfevibvadvcnxtbvidqpdatdenhzpd
mlydlajlgnrfdlqtgrtaztinblrtubofbapbknlrfbyjwtjafjmnvxtjdsfisbwspogeishanwabmaroqkwalivkibcitoaqkipqdyqbsqvokwyq
tylmybiyxoucmyxgtagbygzoeiagfwjcwbewdoyucwjerqebuefoiaqenmzembkmhosgemruhsubaujocmsuvcpgcbqclomsgczkxukbgknowyuk
etgjtcxtqphfjtiboxbcnbsprlxbmjwljcdjupbrljqrezrctrwplxzruzmnzcjzypvdnzyhubhczhapfjbhgxkdxcfxepzvdxkfsrfcvfgpjbrf
onafnclnipthfnsvitvcbvkpdntvwdqhdcrdmpnthdalyvlchlopxzvlfuhkudyurqigkujcpycdoctqsmycnkxmkdekvqcsmkrsfasdusxqmyas
vanoadkazqweoazivcidaibqgkcihyleydgyfqaweylgtsgdwghqkcsgpobgodmojquigotwjuwdcwlqeouwxeriedsenqouiebmzwmdimpqyawm
gvilvezvsrjhlvkdqzdepdurtnzdolynleflwrdtnlstgbtevtyrnzbtwbopbelbarxfpbajwdjebjcrhldjizmfzehzgrbxfzmhuthexhirldth
qpchpenpkrvjhpuxkvxedxmrfpvxyfsjfetforpvjfcnaxnejnqrzbxnhwjmwfawtskimwleraefqevsuoaepmzomfgmxseuomtuhcufwuzsoacu
xcpqcfmcbsygqcbkxekfckdsimekjangafiahscyganivuifyijsmeuirqdiqfoqlswkiqvylwyfeynsgqwyzgtkgfugpsqwkgdobyofkorsacyo
ixknxgbxutljnxmfsbfgrfwtvpbfqnapnghnytfvpnuvidvgxvatpbdvydqrdgndctzhrdclyflgdletjnflkbohbgjbitdzhbojwvjgzjktnfvj
srejrgprmtxljrwzmxzgfzothrxzahulhgvhqtrxlhepczpglpstbdzpjyloyhcyvumkoyngtcghsgxuwqcgrobqohiozugwqovwjewhywbuqcew
zersehoeduaisedmzgmhemfukogmlcpichkcjueaicpkxwkhakluogwktsfkshqsnuymksxanyahgapuisyabivmihwirusymifqdaqhmqtuceaq
kzmpzidzwvnlpzohudhithyvxrdhspcrpijpavhxrpwxkfxizxcvrdfxafstfipfevbjtfenahnifngvlphnmdqjdildkvfbjdqlyxliblmvphxl
utgltirtovznltybozbihbqvjtzbcjwnjixjsvtznjgrebrinruvdfbrlanqajeaxwomqapiveijuizwyseitqdsqjkqbwiysqxylgyjaydwsegy
bgtugjqgfwckugfobiojgohwmqionerkejmelwgckermzymjcmnwqiymvuhmujsupwaomuzcpacjicrwkuacdkxokjyktwuaokhsfcsjosvwegcs
mborbkfbyxpnrbqjwfjkvjaxztfjuretrklrcxjztryzmhzkbzextfhzchuvhkrhgxdlvhgpcjpkhpixnrjpofslfknfmxhdlfsnaznkdnoxrjzn
wvinvktvqxbpnvadqbdkjdsxlvbdelyplkzluxvbplitgdtkptwxfhdtncpsclgczyqoscrkxgklwkbyaugkvsfuslmsdykauszanialcafyugia
divwilsihyemwihqdkqliqjyoskqpgtmglognyiemgtobaoleopyskaoxwjowluwrycqowbercelketymwcefmzqmlamvywcqmjuheulquxygieu
odqtdmhdazrptdslyhlmxlczbvhlwtgvtmntezlbvtabojbmdbgzvhjbejwxjmtjizfnxjirelrmjrkzptlrqhunhmphozjfnhupcbpmfpqztlbp
yxkpxmvxszdrpxcfsdfmlfuznxdfgnarnmbnwzxdrnkvifvmrvyzhjfvperueniebasquetmzimnymdacwimxuhwunoufamcwubcpkcnechawikc
fkxyknukjagoykjsfmsnkslaqumsrivoinqipakgoivqdcqngqraumcqzylqynwytaesqydgtegnmgvaoyeghobsoncoxayesolwjgwnswzaikgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: perueniebasque
Cipher: crehravronfdhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: perueniebasque
Cipher: 5351245451334251211134145451

Extended Methods:
Method #1

Plaintext: perueniebasque
method variations:
ukwzksokgfxvzkzpbepxtpmlcaepeugkucyurqhfkukzmpzhdzwvnlpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
p e r u e n i e b a s q u e 
5 5 2 5 5 3 4 5 2 1 3 1 5 5 
3 1 4 4 1 3 2 1 1 1 4 4 4 1 
They are then read out in rows:
5525534521315531441321114441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: perueniebasque
Cipher: zwpybczctlbatd

Read more ...
Method #3

Plaintext: perueniebasque
method variations:
xfyylswfaldyyv fyylswfaldyyvx yylswfaldyyvxf
ylswfaldyyvxfy lswfaldyyvxfyy swfaldyyvxfyyl
wfaldyyvxfyyls faldyyvxfyylsw aldyyvxfyylswf
ldyyvxfyylswfa dyyvxfyylswfal yyvxfyylswfald
yvxfyylswfaldy vxfyylswfaldyy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: perueniebasque

first 5040 cipher variations(86661001946 total)
perueniebasque perueniebasqeu perueniebasuqe perueniebasueq perueniebaseuq perueniebasequ perueniebaqsue perueniebaqseu
perueniebaquse perueniebaques perueniebaqeus perueniebaqesu perueniebauqse perueniebauqes perueniebausqe perueniebauseq
perueniebauesq perueniebaueqs perueniebaequs perueniebaeqsu perueniebaeuqs perueniebaeusq perueniebaesuq perueniebaesqu
perueniebsaque perueniebsaqeu perueniebsauqe perueniebsaueq perueniebsaeuq perueniebsaequ perueniebsqaue perueniebsqaeu
perueniebsquae perueniebsquea perueniebsqeua perueniebsqeau perueniebsuqae perueniebsuqea perueniebsuaqe perueniebsuaeq
perueniebsueaq perueniebsueqa perueniebsequa perueniebseqau perueniebseuqa perueniebseuaq perueniebseauq perueniebseaqu
perueniebqsaue perueniebqsaeu perueniebqsuae perueniebqsuea perueniebqseua perueniebqseau perueniebqasue perueniebqaseu
perueniebqause perueniebqaues perueniebqaeus perueniebqaesu perueniebquase perueniebquaes perueniebqusae perueniebqusea
perueniebquesa perueniebqueas perueniebqeaus perueniebqeasu perueniebqeuas perueniebqeusa perueniebqesua perueniebqesau
perueniebusqae perueniebusqea perueniebusaqe perueniebusaeq perueniebuseaq perueniebuseqa perueniebuqsae perueniebuqsea
perueniebuqase perueniebuqaes perueniebuqeas perueniebuqesa perueniebuaqse perueniebuaqes perueniebuasqe perueniebuaseq
perueniebuaesq perueniebuaeqs perueniebueqas perueniebueqsa perueniebueaqs perueniebueasq perueniebuesaq perueniebuesqa
perueniebesqua perueniebesqau perueniebesuqa perueniebesuaq perueniebesauq perueniebesaqu perueniebeqsua perueniebeqsau
perueniebequsa perueniebequas perueniebeqaus perueniebeqasu perueniebeuqsa perueniebeuqas perueniebeusqa perueniebeusaq
perueniebeuasq perueniebeuaqs perueniebeaqus perueniebeaqsu perueniebeauqs perueniebeausq perueniebeasuq perueniebeasqu
peruenieabsque peruenieabsqeu peruenieabsuqe peruenieabsueq peruenieabseuq peruenieabsequ peruenieabqsue peruenieabqseu
peruenieabquse peruenieabques peruenieabqeus peruenieabqesu peruenieabuqse peruenieabuqes peruenieabusqe peruenieabuseq
peruenieabuesq peruenieabueqs peruenieabequs peruenieabeqsu peruenieabeuqs peruenieabeusq peruenieabesuq peruenieabesqu
peruenieasbque peruenieasbqeu peruenieasbuqe peruenieasbueq peruenieasbeuq peruenieasbequ peruenieasqbue peruenieasqbeu
peruenieasqube peruenieasqueb peruenieasqeub peruenieasqebu peruenieasuqbe peruenieasuqeb peruenieasubqe peruenieasubeq
peruenieasuebq peruenieasueqb peruenieasequb peruenieaseqbu peruenieaseuqb peruenieaseubq peruenieasebuq peruenieasebqu
peruenieaqsbue peruenieaqsbeu peruenieaqsube peruenieaqsueb peruenieaqseub peruenieaqsebu peruenieaqbsue peruenieaqbseu
peruenieaqbuse peruenieaqbues peruenieaqbeus peruenieaqbesu peruenieaqubse peruenieaqubes peruenieaqusbe peruenieaquseb
peruenieaquesb peruenieaquebs peruenieaqebus peruenieaqebsu peruenieaqeubs peruenieaqeusb peruenieaqesub peruenieaqesbu
peruenieausqbe peruenieausqeb peruenieausbqe peruenieausbeq peruenieausebq peruenieauseqb peruenieauqsbe peruenieauqseb
peruenieauqbse peruenieauqbes peruenieauqebs peruenieauqesb peruenieaubqse peruenieaubqes peruenieaubsqe peruenieaubseq
peruenieaubesq peruenieaubeqs peruenieaueqbs peruenieaueqsb peruenieauebqs peruenieauebsq peruenieauesbq peruenieauesqb
peruenieaesqub peruenieaesqbu peruenieaesuqb peruenieaesubq peruenieaesbuq peruenieaesbqu peruenieaeqsub peruenieaeqsbu
peruenieaequsb peruenieaequbs peruenieaeqbus peruenieaeqbsu peruenieaeuqsb peruenieaeuqbs peruenieaeusqb peruenieaeusbq
peruenieaeubsq peruenieaeubqs peruenieaebqus peruenieaebqsu peruenieaebuqs peruenieaebusq peruenieaebsuq peruenieaebsqu
perueniesabque perueniesabqeu perueniesabuqe perueniesabueq perueniesabeuq perueniesabequ perueniesaqbue perueniesaqbeu
perueniesaqube perueniesaqueb perueniesaqeub perueniesaqebu perueniesauqbe perueniesauqeb perueniesaubqe perueniesaubeq
perueniesauebq perueniesaueqb perueniesaequb perueniesaeqbu perueniesaeuqb perueniesaeubq perueniesaebuq perueniesaebqu
perueniesbaque perueniesbaqeu perueniesbauqe perueniesbaueq perueniesbaeuq perueniesbaequ perueniesbqaue perueniesbqaeu
perueniesbquae perueniesbquea perueniesbqeua perueniesbqeau perueniesbuqae perueniesbuqea perueniesbuaqe perueniesbuaeq
perueniesbueaq perueniesbueqa perueniesbequa perueniesbeqau perueniesbeuqa perueniesbeuaq perueniesbeauq perueniesbeaqu
perueniesqbaue perueniesqbaeu perueniesqbuae perueniesqbuea perueniesqbeua perueniesqbeau perueniesqabue perueniesqabeu
perueniesqaube perueniesqaueb perueniesqaeub perueniesqaebu perueniesquabe perueniesquaeb perueniesqubae perueniesqubea
perueniesqueba perueniesqueab perueniesqeaub perueniesqeabu perueniesqeuab perueniesqeuba perueniesqebua perueniesqebau
perueniesubqae perueniesubqea perueniesubaqe perueniesubaeq perueniesubeaq perueniesubeqa perueniesuqbae perueniesuqbea
perueniesuqabe perueniesuqaeb perueniesuqeab perueniesuqeba perueniesuaqbe perueniesuaqeb perueniesuabqe perueniesuabeq
perueniesuaebq perueniesuaeqb perueniesueqab perueniesueqba perueniesueaqb perueniesueabq perueniesuebaq perueniesuebqa
perueniesebqua perueniesebqau perueniesebuqa perueniesebuaq perueniesebauq perueniesebaqu peruenieseqbua peruenieseqbau
perueniesequba perueniesequab peruenieseqaub peruenieseqabu peruenieseuqba peruenieseuqab peruenieseubqa peruenieseubaq
peruenieseuabq peruenieseuaqb peruenieseaqub peruenieseaqbu peruenieseauqb peruenieseaubq peruenieseabuq peruenieseabqu
peruenieqasbue peruenieqasbeu peruenieqasube peruenieqasueb peruenieqaseub peruenieqasebu peruenieqabsue peruenieqabseu
peruenieqabuse peruenieqabues peruenieqabeus peruenieqabesu peruenieqaubse peruenieqaubes peruenieqausbe peruenieqauseb
peruenieqauesb peruenieqauebs peruenieqaebus peruenieqaebsu peruenieqaeubs peruenieqaeusb peruenieqaesub peruenieqaesbu
peruenieqsabue peruenieqsabeu peruenieqsaube peruenieqsaueb peruenieqsaeub peruenieqsaebu peruenieqsbaue peruenieqsbaeu
peruenieqsbuae peruenieqsbuea peruenieqsbeua peruenieqsbeau peruenieqsubae peruenieqsubea peruenieqsuabe peruenieqsuaeb
peruenieqsueab peruenieqsueba peruenieqsebua peruenieqsebau peruenieqseuba peruenieqseuab peruenieqseaub peruenieqseabu
peruenieqbsaue peruenieqbsaeu peruenieqbsuae peruenieqbsuea peruenieqbseua peruenieqbseau peruenieqbasue peruenieqbaseu
peruenieqbause peruenieqbaues peruenieqbaeus peruenieqbaesu peruenieqbuase peruenieqbuaes peruenieqbusae peruenieqbusea
peruenieqbuesa peruenieqbueas peruenieqbeaus peruenieqbeasu peruenieqbeuas peruenieqbeusa peruenieqbesua peruenieqbesau
perueniequsbae perueniequsbea perueniequsabe perueniequsaeb perueniequseab perueniequseba perueniequbsae perueniequbsea
perueniequbase perueniequbaes perueniequbeas perueniequbesa perueniequabse perueniequabes perueniequasbe perueniequaseb
perueniequaesb perueniequaebs perueniequebas perueniequebsa perueniequeabs perueniequeasb perueniequesab perueniequesba
peruenieqesbua peruenieqesbau peruenieqesuba peruenieqesuab peruenieqesaub peruenieqesabu peruenieqebsua peruenieqebsau
peruenieqebusa peruenieqebuas peruenieqebaus peruenieqebasu peruenieqeubsa peruenieqeubas peruenieqeusba peruenieqeusab
peruenieqeuasb peruenieqeuabs peruenieqeabus peruenieqeabsu peruenieqeaubs peruenieqeausb peruenieqeasub peruenieqeasbu
peruenieuasqbe peruenieuasqeb peruenieuasbqe peruenieuasbeq peruenieuasebq peruenieuaseqb peruenieuaqsbe peruenieuaqseb
peruenieuaqbse peruenieuaqbes peruenieuaqebs peruenieuaqesb peruenieuabqse peruenieuabqes peruenieuabsqe peruenieuabseq
peruenieuabesq peruenieuabeqs peruenieuaeqbs peruenieuaeqsb peruenieuaebqs peruenieuaebsq peruenieuaesbq peruenieuaesqb
peruenieusaqbe peruenieusaqeb peruenieusabqe peruenieusabeq peruenieusaebq peruenieusaeqb peruenieusqabe peruenieusqaeb
peruenieusqbae peruenieusqbea peruenieusqeba peruenieusqeab peruenieusbqae peruenieusbqea peruenieusbaqe peruenieusbaeq
peruenieusbeaq peruenieusbeqa peruenieuseqba peruenieuseqab peruenieusebqa peruenieusebaq peruenieuseabq peruenieuseaqb
peruenieuqsabe peruenieuqsaeb peruenieuqsbae peruenieuqsbea peruenieuqseba peruenieuqseab peruenieuqasbe peruenieuqaseb
peruenieuqabse peruenieuqabes peruenieuqaebs peruenieuqaesb peruenieuqbase peruenieuqbaes peruenieuqbsae peruenieuqbsea
peruenieuqbesa peruenieuqbeas peruenieuqeabs peruenieuqeasb peruenieuqebas peruenieuqebsa peruenieuqesba peruenieuqesab
peruenieubsqae peruenieubsqea peruenieubsaqe peruenieubsaeq peruenieubseaq peruenieubseqa peruenieubqsae peruenieubqsea
peruenieubqase peruenieubqaes peruenieubqeas peruenieubqesa peruenieubaqse peruenieubaqes peruenieubasqe peruenieubaseq
peruenieubaesq peruenieubaeqs peruenieubeqas peruenieubeqsa peruenieubeaqs peruenieubeasq peruenieubesaq peruenieubesqa
peruenieuesqba peruenieuesqab peruenieuesbqa peruenieuesbaq peruenieuesabq peruenieuesaqb peruenieueqsba peruenieueqsab
peruenieueqbsa peruenieueqbas peruenieueqabs peruenieueqasb peruenieuebqsa peruenieuebqas peruenieuebsqa peruenieuebsaq
peruenieuebasq peruenieuebaqs peruenieueaqbs peruenieueaqsb peruenieueabqs peruenieueabsq peruenieueasbq peruenieueasqb
peruenieeasqub peruenieeasqbu peruenieeasuqb peruenieeasubq peruenieeasbuq peruenieeasbqu peruenieeaqsub peruenieeaqsbu
peruenieeaqusb peruenieeaqubs peruenieeaqbus peruenieeaqbsu peruenieeauqsb peruenieeauqbs peruenieeausqb peruenieeausbq
peruenieeaubsq peruenieeaubqs peruenieeabqus peruenieeabqsu peruenieeabuqs peruenieeabusq peruenieeabsuq peruenieeabsqu
peruenieesaqub peruenieesaqbu peruenieesauqb peruenieesaubq peruenieesabuq peruenieesabqu peruenieesqaub peruenieesqabu
peruenieesquab peruenieesquba peruenieesqbua peruenieesqbau peruenieesuqab peruenieesuqba peruenieesuaqb peruenieesuabq
peruenieesubaq peruenieesubqa peruenieesbqua peruenieesbqau peruenieesbuqa peruenieesbuaq peruenieesbauq peruenieesbaqu
peruenieeqsaub peruenieeqsabu peruenieeqsuab peruenieeqsuba peruenieeqsbua peruenieeqsbau peruenieeqasub peruenieeqasbu
peruenieeqausb peruenieeqaubs peruenieeqabus peruenieeqabsu peruenieequasb peruenieequabs peruenieequsab peruenieequsba
peruenieequbsa peruenieequbas peruenieeqbaus peruenieeqbasu peruenieeqbuas peruenieeqbusa peruenieeqbsua peruenieeqbsau
peruenieeusqab peruenieeusqba peruenieeusaqb peruenieeusabq peruenieeusbaq peruenieeusbqa peruenieeuqsab peruenieeuqsba
peruenieeuqasb peruenieeuqabs peruenieeuqbas peruenieeuqbsa peruenieeuaqsb peruenieeuaqbs peruenieeuasqb peruenieeuasbq
peruenieeuabsq peruenieeuabqs peruenieeubqas peruenieeubqsa peruenieeubaqs peruenieeubasq peruenieeubsaq peruenieeubsqa
peruenieebsqua peruenieebsqau peruenieebsuqa peruenieebsuaq peruenieebsauq peruenieebsaqu peruenieebqsua peruenieebqsau
peruenieebqusa peruenieebquas peruenieebqaus peruenieebqasu peruenieebuqsa peruenieebuqas peruenieebusqa peruenieebusaq
peruenieebuasq peruenieebuaqs peruenieebaqus peruenieebaqsu peruenieebauqs peruenieebausq peruenieebasuq peruenieebasqu
peruenibeasque peruenibeasqeu peruenibeasuqe peruenibeasueq peruenibeaseuq peruenibeasequ peruenibeaqsue peruenibeaqseu
peruenibeaquse peruenibeaques peruenibeaqeus peruenibeaqesu peruenibeauqse peruenibeauqes peruenibeausqe peruenibeauseq
peruenibeauesq peruenibeaueqs peruenibeaequs peruenibeaeqsu peruenibeaeuqs peruenibeaeusq peruenibeaesuq peruenibeaesqu
peruenibesaque peruenibesaqeu peruenibesauqe peruenibesaueq peruenibesaeuq peruenibesaequ peruenibesqaue peruenibesqaeu
peruenibesquae peruenibesquea peruenibesqeua peruenibesqeau peruenibesuqae peruenibesuqea peruenibesuaqe peruenibesuaeq
peruenibesueaq peruenibesueqa peruenibesequa peruenibeseqau peruenibeseuqa peruenibeseuaq peruenibeseauq peruenibeseaqu
peruenibeqsaue peruenibeqsaeu peruenibeqsuae peruenibeqsuea peruenibeqseua peruenibeqseau peruenibeqasue peruenibeqaseu
peruenibeqause peruenibeqaues peruenibeqaeus peruenibeqaesu peruenibequase peruenibequaes peruenibequsae peruenibequsea
peruenibequesa peruenibequeas peruenibeqeaus peruenibeqeasu peruenibeqeuas peruenibeqeusa peruenibeqesua peruenibeqesau
peruenibeusqae peruenibeusqea peruenibeusaqe peruenibeusaeq peruenibeuseaq peruenibeuseqa peruenibeuqsae peruenibeuqsea
peruenibeuqase peruenibeuqaes peruenibeuqeas peruenibeuqesa peruenibeuaqse peruenibeuaqes peruenibeuasqe peruenibeuaseq
peruenibeuaesq peruenibeuaeqs peruenibeueqas peruenibeueqsa peruenibeueaqs peruenibeueasq peruenibeuesaq peruenibeuesqa
peruenibeesqua peruenibeesqau peruenibeesuqa peruenibeesuaq peruenibeesauq peruenibeesaqu peruenibeeqsua peruenibeeqsau
peruenibeequsa peruenibeequas peruenibeeqaus peruenibeeqasu peruenibeeuqsa peruenibeeuqas peruenibeeusqa peruenibeeusaq
peruenibeeuasq peruenibeeuaqs peruenibeeaqus peruenibeeaqsu peruenibeeauqs peruenibeeausq peruenibeeasuq peruenibeeasqu
peruenibaesque peruenibaesqeu peruenibaesuqe peruenibaesueq peruenibaeseuq peruenibaesequ peruenibaeqsue peruenibaeqseu
peruenibaequse peruenibaeques peruenibaeqeus peruenibaeqesu peruenibaeuqse peruenibaeuqes peruenibaeusqe peruenibaeuseq
peruenibaeuesq peruenibaeueqs peruenibaeequs peruenibaeeqsu peruenibaeeuqs peruenibaeeusq peruenibaeesuq peruenibaeesqu
peruenibaseque peruenibaseqeu peruenibaseuqe peruenibaseueq peruenibaseeuq peruenibaseequ peruenibasqeue peruenibasqeeu
peruenibasquee peruenibasquee peruenibasqeue peruenibasqeeu peruenibasuqee peruenibasuqee peruenibasueqe peruenibasueeq
peruenibasueeq peruenibasueqe peruenibaseque peruenibaseqeu peruenibaseuqe peruenibaseueq peruenibaseeuq peruenibaseequ
peruenibaqseue peruenibaqseeu peruenibaqsuee peruenibaqsuee peruenibaqseue peruenibaqseeu peruenibaqesue peruenibaqeseu
peruenibaqeuse peruenibaqeues peruenibaqeeus peruenibaqeesu peruenibaquese peruenibaquees peruenibaqusee peruenibaqusee
peruenibaquese peruenibaquees peruenibaqeeus peruenibaqeesu peruenibaqeues peruenibaqeuse peruenibaqesue peruenibaqeseu
peruenibausqee peruenibausqee peruenibauseqe peruenibauseeq peruenibauseeq peruenibauseqe peruenibauqsee peruenibauqsee
peruenibauqese peruenibauqees peruenibauqees peruenibauqese peruenibaueqse peruenibaueqes peruenibauesqe peruenibaueseq
peruenibaueesq peruenibaueeqs peruenibaueqes peruenibaueqse peruenibaueeqs peruenibaueesq peruenibaueseq peruenibauesqe
peruenibaesque peruenibaesqeu peruenibaesuqe peruenibaesueq peruenibaeseuq peruenibaesequ peruenibaeqsue peruenibaeqseu
peruenibaequse peruenibaeques peruenibaeqeus peruenibaeqesu peruenibaeuqse peruenibaeuqes peruenibaeusqe peruenibaeuseq
peruenibaeuesq peruenibaeueqs peruenibaeequs peruenibaeeqsu peruenibaeeuqs peruenibaeeusq peruenibaeesuq peruenibaeesqu
peruenibsaeque peruenibsaeqeu peruenibsaeuqe peruenibsaeueq peruenibsaeeuq peruenibsaeequ peruenibsaqeue peruenibsaqeeu
peruenibsaquee peruenibsaquee peruenibsaqeue peruenibsaqeeu peruenibsauqee peruenibsauqee peruenibsaueqe peruenibsaueeq
peruenibsaueeq peruenibsaueqe peruenibsaeque peruenibsaeqeu peruenibsaeuqe peruenibsaeueq peruenibsaeeuq peruenibsaeequ
peruenibseaque peruenibseaqeu peruenibseauqe peruenibseaueq peruenibseaeuq peruenibseaequ peruenibseqaue peruenibseqaeu
peruenibsequae peruenibsequea peruenibseqeua peruenibseqeau peruenibseuqae peruenibseuqea peruenibseuaqe peruenibseuaeq
peruenibseueaq peruenibseueqa peruenibseequa peruenibseeqau peruenibseeuqa peruenibseeuaq peruenibseeauq peruenibseeaqu
peruenibsqeaue peruenibsqeaeu peruenibsqeuae peruenibsqeuea peruenibsqeeua peruenibsqeeau peruenibsqaeue peruenibsqaeeu
peruenibsqauee peruenibsqauee peruenibsqaeue peruenibsqaeeu peruenibsquaee peruenibsquaee peruenibsqueae peruenibsqueea
peruenibsqueea peruenibsqueae peruenibsqeaue peruenibsqeaeu peruenibsqeuae peruenibsqeuea peruenibsqeeua peruenibsqeeau
peruenibsueqae peruenibsueqea peruenibsueaqe peruenibsueaeq peruenibsueeaq peruenibsueeqa peruenibsuqeae peruenibsuqeea
peruenibsuqaee peruenibsuqaee peruenibsuqeae peruenibsuqeea peruenibsuaqee peruenibsuaqee peruenibsuaeqe peruenibsuaeeq
peruenibsuaeeq peruenibsuaeqe peruenibsueqae peruenibsueqea peruenibsueaqe peruenibsueaeq peruenibsueeaq peruenibsueeqa
peruenibseequa peruenibseeqau peruenibseeuqa peruenibseeuaq peruenibseeauq peruenibseeaqu peruenibseqeua peruenibseqeau
peruenibsequea peruenibsequae peruenibseqaue peruenibseqaeu peruenibseuqea peruenibseuqae peruenibseueqa peruenibseueaq
peruenibseuaeq peruenibseuaqe peruenibseaque peruenibseaqeu peruenibseauqe peruenibseaueq peruenibseaeuq peruenibseaequ
peruenibqaseue peruenibqaseeu peruenibqasuee peruenibqasuee peruenibqaseue peruenibqaseeu peruenibqaesue peruenibqaeseu
peruenibqaeuse peruenibqaeues peruenibqaeeus peruenibqaeesu peruenibqauese peruenibqauees peruenibqausee peruenibqausee
peruenibqauese peruenibqauees peruenibqaeeus peruenibqaeesu peruenibqaeues peruenibqaeuse peruenibqaesue peruenibqaeseu
peruenibqsaeue peruenibqsaeeu peruenibqsauee peruenibqsauee peruenibqsaeue peruenibqsaeeu peruenibqseaue peruenibqseaeu
peruenibqseuae peruenibqseuea peruenibqseeua peruenibqseeau peruenibqsueae peruenibqsueea peruenibqsuaee peruenibqsuaee
peruenibqsueae peruenibqsueea peruenibqseeua peruenibqseeau peruenibqseuea peruenibqseuae peruenibqseaue peruenibqseaeu
peruenibqesaue peruenibqesaeu peruenibqesuae peruenibqesuea peruenibqeseua peruenibqeseau peruenibqeasue peruenibqeaseu
peruenibqeause peruenibqeaues peruenibqeaeus peruenibqeaesu peruenibqeuase peruenibqeuaes peruenibqeusae peruenibqeusea
peruenibqeuesa peruenibqeueas peruenibqeeaus peruenibqeeasu peruenibqeeuas peruenibqeeusa peruenibqeesua peruenibqeesau
peruenibquseae peruenibquseea peruenibqusaee peruenibqusaee peruenibquseae peruenibquseea peruenibquesae peruenibquesea
peruenibquease peruenibqueaes peruenibqueeas peruenibqueesa peruenibquaese peruenibquaees peruenibquasee peruenibquasee
peruenibquaese peruenibquaees peruenibqueeas peruenibqueesa peruenibqueaes peruenibquease peruenibquesae peruenibquesea
peruenibqeseua peruenibqeseau peruenibqesuea peruenibqesuae peruenibqesaue peruenibqesaeu peruenibqeesua peruenibqeesau
peruenibqeeusa peruenibqeeuas peruenibqeeaus peruenibqeeasu peruenibqeuesa peruenibqeueas peruenibqeusea peruenibqeusae
peruenibqeuase peruenibqeuaes peruenibqeaeus peruenibqeaesu peruenibqeaues peruenibqeause peruenibqeasue peruenibqeaseu
peruenibuasqee peruenibuasqee peruenibuaseqe peruenibuaseeq peruenibuaseeq peruenibuaseqe peruenibuaqsee peruenibuaqsee
peruenibuaqese peruenibuaqees peruenibuaqees peruenibuaqese peruenibuaeqse peruenibuaeqes peruenibuaesqe peruenibuaeseq
peruenibuaeesq peruenibuaeeqs peruenibuaeqes peruenibuaeqse peruenibuaeeqs peruenibuaeesq peruenibuaeseq peruenibuaesqe
peruenibusaqee peruenibusaqee peruenibusaeqe peruenibusaeeq peruenibusaeeq peruenibusaeqe peruenibusqaee peruenibusqaee
peruenibusqeae peruenibusqeea peruenibusqeea peruenibusqeae peruenibuseqae peruenibuseqea peruenibuseaqe peruenibuseaeq
peruenibuseeaq peruenibuseeqa peruenibuseqea peruenibuseqae peruenibuseeqa peruenibuseeaq peruenibuseaeq peruenibuseaqe
peruenibuqsaee peruenibuqsaee peruenibuqseae peruenibuqseea peruenibuqseea peruenibuqseae peruenibuqasee peruenibuqasee
peruenibuqaese peruenibuqaees peruenibuqaees peruenibuqaese peruenibuqease peruenibuqeaes peruenibuqesae peruenibuqesea
peruenibuqeesa peruenibuqeeas peruenibuqeaes peruenibuqease peruenibuqeeas peruenibuqeesa peruenibuqesea peruenibuqesae
peruenibuesqae peruenibuesqea peruenibuesaqe peruenibuesaeq peruenibueseaq peruenibueseqa peruenibueqsae peruenibueqsea
peruenibueqase peruenibueqaes peruenibueqeas peruenibueqesa peruenibueaqse peruenibueaqes peruenibueasqe peruenibueaseq
peruenibueaesq peruenibueaeqs peruenibueeqas peruenibueeqsa peruenibueeaqs peruenibueeasq peruenibueesaq peruenibueesqa
peruenibuesqea peruenibuesqae peruenibueseqa peruenibueseaq peruenibuesaeq peruenibuesaqe peruenibueqsea peruenibueqsae
peruenibueqesa peruenibueqeas peruenibueqaes peruenibueqase peruenibueeqsa peruenibueeqas peruenibueesqa peruenibueesaq
peruenibueeasq peruenibueeaqs peruenibueaqes peruenibueaqse peruenibueaeqs peruenibueaesq peruenibueaseq peruenibueasqe
peruenibeasque peruenibeasqeu peruenibeasuqe peruenibeasueq peruenibeaseuq peruenibeasequ peruenibeaqsue peruenibeaqseu
peruenibeaquse peruenibeaques peruenibeaqeus peruenibeaqesu peruenibeauqse peruenibeauqes peruenibeausqe peruenibeauseq
peruenibeauesq peruenibeaueqs peruenibeaequs peruenibeaeqsu peruenibeaeuqs peruenibeaeusq peruenibeaesuq peruenibeaesqu
peruenibesaque peruenibesaqeu peruenibesauqe peruenibesaueq peruenibesaeuq peruenibesaequ peruenibesqaue peruenibesqaeu
peruenibesquae peruenibesquea peruenibesqeua peruenibesqeau peruenibesuqae peruenibesuqea peruenibesuaqe peruenibesuaeq
peruenibesueaq peruenibesueqa peruenibesequa peruenibeseqau peruenibeseuqa peruenibeseuaq peruenibeseauq peruenibeseaqu
peruenibeqsaue peruenibeqsaeu peruenibeqsuae peruenibeqsuea peruenibeqseua peruenibeqseau peruenibeqasue peruenibeqaseu
peruenibeqause peruenibeqaues peruenibeqaeus peruenibeqaesu peruenibequase peruenibequaes peruenibequsae peruenibequsea
peruenibequesa peruenibequeas peruenibeqeaus peruenibeqeasu peruenibeqeuas peruenibeqeusa peruenibeqesua peruenibeqesau
peruenibeusqae peruenibeusqea peruenibeusaqe peruenibeusaeq peruenibeuseaq peruenibeuseqa peruenibeuqsae peruenibeuqsea
peruenibeuqase peruenibeuqaes peruenibeuqeas peruenibeuqesa peruenibeuaqse peruenibeuaqes peruenibeuasqe peruenibeuaseq
peruenibeuaesq peruenibeuaeqs peruenibeueqas peruenibeueqsa peruenibeueaqs peruenibeueasq peruenibeuesaq peruenibeuesqa
peruenibeesqua peruenibeesqau peruenibeesuqa peruenibeesuaq peruenibeesauq peruenibeesaqu peruenibeeqsua peruenibeeqsau
peruenibeequsa peruenibeequas peruenibeeqaus peruenibeeqasu peruenibeeuqsa peruenibeeuqas peruenibeeusqa peruenibeeusaq
peruenibeeuasq peruenibeeuaqs peruenibeeaqus peruenibeeaqsu peruenibeeauqs peruenibeeausq peruenibeeasuq peruenibeeasqu
perueniabesque perueniabesqeu perueniabesuqe perueniabesueq perueniabeseuq perueniabesequ perueniabeqsue perueniabeqseu
perueniabequse perueniabeques perueniabeqeus perueniabeqesu perueniabeuqse perueniabeuqes perueniabeusqe perueniabeuseq
perueniabeuesq perueniabeueqs perueniabeequs perueniabeeqsu perueniabeeuqs perueniabeeusq perueniabeesuq perueniabeesqu
perueniabseque perueniabseqeu perueniabseuqe perueniabseueq perueniabseeuq perueniabseequ perueniabsqeue perueniabsqeeu
perueniabsquee perueniabsquee perueniabsqeue perueniabsqeeu perueniabsuqee perueniabsuqee perueniabsueqe perueniabsueeq
perueniabsueeq perueniabsueqe perueniabseque perueniabseqeu perueniabseuqe perueniabseueq perueniabseeuq perueniabseequ
perueniabqseue perueniabqseeu perueniabqsuee perueniabqsuee perueniabqseue perueniabqseeu perueniabqesue perueniabqeseu
perueniabqeuse perueniabqeues perueniabqeeus perueniabqeesu perueniabquese perueniabquees perueniabqusee perueniabqusee
perueniabquese perueniabquees perueniabqeeus perueniabqeesu perueniabqeues perueniabqeuse perueniabqesue perueniabqeseu
perueniabusqee perueniabusqee perueniabuseqe perueniabuseeq perueniabuseeq perueniabuseqe perueniabuqsee perueniabuqsee
perueniabuqese perueniabuqees perueniabuqees perueniabuqese perueniabueqse perueniabueqes perueniabuesqe perueniabueseq
perueniabueesq perueniabueeqs perueniabueqes perueniabueqse perueniabueeqs perueniabueesq perueniabueseq perueniabuesqe
perueniabesque perueniabesqeu perueniabesuqe perueniabesueq perueniabeseuq perueniabesequ perueniabeqsue perueniabeqseu
perueniabequse perueniabeques perueniabeqeus perueniabeqesu perueniabeuqse perueniabeuqes perueniabeusqe perueniabeuseq
perueniabeuesq perueniabeueqs perueniabeequs perueniabeeqsu perueniabeeuqs perueniabeeusq perueniabeesuq perueniabeesqu
perueniaebsque perueniaebsqeu perueniaebsuqe perueniaebsueq perueniaebseuq perueniaebsequ perueniaebqsue perueniaebqseu
perueniaebquse perueniaebques perueniaebqeus perueniaebqesu perueniaebuqse perueniaebuqes perueniaebusqe perueniaebuseq
perueniaebuesq perueniaebueqs perueniaebequs perueniaebeqsu perueniaebeuqs perueniaebeusq perueniaebesuq perueniaebesqu
perueniaesbque perueniaesbqeu perueniaesbuqe perueniaesbueq perueniaesbeuq perueniaesbequ perueniaesqbue perueniaesqbeu
perueniaesqube perueniaesqueb perueniaesqeub perueniaesqebu perueniaesuqbe perueniaesuqeb perueniaesubqe perueniaesubeq
perueniaesuebq perueniaesueqb perueniaesequb perueniaeseqbu perueniaeseuqb perueniaeseubq perueniaesebuq perueniaesebqu
perueniaeqsbue perueniaeqsbeu perueniaeqsube perueniaeqsueb perueniaeqseub perueniaeqsebu perueniaeqbsue perueniaeqbseu
perueniaeqbuse perueniaeqbues perueniaeqbeus perueniaeqbesu perueniaequbse perueniaequbes perueniaequsbe perueniaequseb
perueniaequesb perueniaequebs perueniaeqebus perueniaeqebsu perueniaeqeubs perueniaeqeusb perueniaeqesub perueniaeqesbu
perueniaeusqbe perueniaeusqeb perueniaeusbqe perueniaeusbeq perueniaeusebq perueniaeuseqb perueniaeuqsbe perueniaeuqseb
perueniaeuqbse perueniaeuqbes perueniaeuqebs perueniaeuqesb perueniaeubqse perueniaeubqes perueniaeubsqe perueniaeubseq
perueniaeubesq perueniaeubeqs perueniaeueqbs perueniaeueqsb perueniaeuebqs perueniaeuebsq perueniaeuesbq perueniaeuesqb
perueniaeesqub perueniaeesqbu perueniaeesuqb perueniaeesubq perueniaeesbuq perueniaeesbqu perueniaeeqsub perueniaeeqsbu
perueniaeequsb perueniaeequbs perueniaeeqbus perueniaeeqbsu perueniaeeuqsb perueniaeeuqbs perueniaeeusqb perueniaeeusbq
perueniaeeubsq perueniaeeubqs perueniaeebqus perueniaeebqsu perueniaeebuqs perueniaeebusq perueniaeebsuq perueniaeebsqu
perueniasebque perueniasebqeu perueniasebuqe perueniasebueq perueniasebeuq perueniasebequ perueniaseqbue perueniaseqbeu
perueniaseqube perueniasequeb perueniaseqeub perueniaseqebu perueniaseuqbe perueniaseuqeb perueniaseubqe perueniaseubeq
perueniaseuebq perueniaseueqb perueniaseequb perueniaseeqbu perueniaseeuqb perueniaseeubq perueniaseebuq perueniaseebqu
perueniasbeque perueniasbeqeu perueniasbeuqe perueniasbeueq perueniasbeeuq perueniasbeequ perueniasbqeue perueniasbqeeu
perueniasbquee perueniasbquee perueniasbqeue perueniasbqeeu perueniasbuqee perueniasbuqee perueniasbueqe perueniasbueeq
perueniasbueeq perueniasbueqe perueniasbeque perueniasbeqeu perueniasbeuqe perueniasbeueq perueniasbeeuq perueniasbeequ
perueniasqbeue perueniasqbeeu perueniasqbuee perueniasqbuee perueniasqbeue perueniasqbeeu perueniasqebue perueniasqebeu
perueniasqeube perueniasqeueb perueniasqeeub perueniasqeebu perueniasquebe perueniasqueeb perueniasqubee perueniasqubee
perueniasquebe perueniasqueeb perueniasqeeub perueniasqeebu perueniasqeueb perueniasqeube perueniasqebue perueniasqebeu
perueniasubqee perueniasubqee perueniasubeqe perueniasubeeq perueniasubeeq perueniasubeqe perueniasuqbee perueniasuqbee
perueniasuqebe perueniasuqeeb perueniasuqeeb perueniasuqebe perueniasueqbe perueniasueqeb perueniasuebqe perueniasuebeq
perueniasueebq perueniasueeqb perueniasueqeb perueniasueqbe perueniasueeqb perueniasueebq perueniasuebeq perueniasuebqe
perueniasebque perueniasebqeu perueniasebuqe perueniasebueq perueniasebeuq perueniasebequ perueniaseqbue perueniaseqbeu
perueniaseqube perueniasequeb perueniaseqeub perueniaseqebu perueniaseuqbe perueniaseuqeb perueniaseubqe perueniaseubeq
perueniaseuebq perueniaseueqb perueniaseequb perueniaseeqbu perueniaseeuqb perueniaseeubq perueniaseebuq perueniaseebqu
perueniaqesbue perueniaqesbeu perueniaqesube perueniaqesueb perueniaqeseub perueniaqesebu perueniaqebsue perueniaqebseu
perueniaqebuse perueniaqebues perueniaqebeus perueniaqebesu perueniaqeubse perueniaqeubes perueniaqeusbe perueniaqeuseb
perueniaqeuesb perueniaqeuebs perueniaqeebus perueniaqeebsu perueniaqeeubs perueniaqeeusb perueniaqeesub perueniaqeesbu
perueniaqsebue perueniaqsebeu perueniaqseube perueniaqseueb perueniaqseeub perueniaqseebu perueniaqsbeue perueniaqsbeeu
perueniaqsbuee perueniaqsbuee perueniaqsbeue perueniaqsbeeu perueniaqsubee perueniaqsubee perueniaqsuebe perueniaqsueeb
perueniaqsueeb perueniaqsuebe perueniaqsebue perueniaqsebeu perueniaqseube perueniaqseueb perueniaqseeub perueniaqseebu
perueniaqbseue perueniaqbseeu perueniaqbsuee perueniaqbsuee perueniaqbseue perueniaqbseeu perueniaqbesue perueniaqbeseu
perueniaqbeuse perueniaqbeues perueniaqbeeus perueniaqbeesu perueniaqbuese perueniaqbuees perueniaqbusee perueniaqbusee
perueniaqbuese perueniaqbuees perueniaqbeeus perueniaqbeesu perueniaqbeues perueniaqbeuse perueniaqbesue perueniaqbeseu
perueniaqusbee perueniaqusbee perueniaqusebe perueniaquseeb perueniaquseeb perueniaqusebe perueniaqubsee perueniaqubsee
perueniaqubese perueniaqubees perueniaqubees perueniaqubese perueniaquebse perueniaquebes perueniaquesbe perueniaqueseb
perueniaqueesb perueniaqueebs perueniaquebes perueniaquebse perueniaqueebs perueniaqueesb perueniaqueseb perueniaquesbe
perueniaqesbue perueniaqesbeu perueniaqesube perueniaqesueb perueniaqeseub perueniaqesebu perueniaqebsue perueniaqebseu
perueniaqebuse perueniaqebues perueniaqebeus perueniaqebesu perueniaqeubse perueniaqeubes perueniaqeusbe perueniaqeuseb
perueniaqeuesb perueniaqeuebs perueniaqeebus perueniaqeebsu perueniaqeeubs perueniaqeeusb perueniaqeesub perueniaqeesbu
perueniauesqbe perueniauesqeb perueniauesbqe perueniauesbeq perueniauesebq perueniaueseqb perueniaueqsbe perueniaueqseb
perueniaueqbse perueniaueqbes perueniaueqebs perueniaueqesb perueniauebqse perueniauebqes perueniauebsqe perueniauebseq
perueniauebesq perueniauebeqs perueniaueeqbs perueniaueeqsb perueniaueebqs perueniaueebsq perueniaueesbq perueniaueesqb
perueniauseqbe perueniauseqeb perueniausebqe perueniausebeq perueniauseebq perueniauseeqb perueniausqebe perueniausqeeb
perueniausqbee perueniausqbee perueniausqebe perueniausqeeb perueniausbqee perueniausbqee perueniausbeqe perueniausbeeq
perueniausbeeq perueniausbeqe perueniauseqbe perueniauseqeb perueniausebqe perueniausebeq perueniauseebq perueniauseeqb
perueniauqsebe perueniauqseeb perueniauqsbee perueniauqsbee perueniauqsebe perueniauqseeb perueniauqesbe perueniauqeseb
perueniauqebse perueniauqebes perueniauqeebs perueniauqeesb perueniauqbese perueniauqbees perueniauqbsee perueniauqbsee
perueniauqbese perueniauqbees perueniauqeebs perueniauqeesb perueniauqebes perueniauqebse perueniauqesbe perueniauqeseb
perueniaubsqee perueniaubsqee perueniaubseqe perueniaubseeq perueniaubseeq perueniaubseqe perueniaubqsee perueniaubqsee
perueniaubqese perueniaubqees perueniaubqees perueniaubqese perueniaubeqse perueniaubeqes perueniaubesqe perueniaubeseq
perueniaubeesq perueniaubeeqs perueniaubeqes perueniaubeqse perueniaubeeqs perueniaubeesq perueniaubeseq perueniaubesqe
perueniauesqbe perueniauesqeb perueniauesbqe perueniauesbeq perueniauesebq perueniaueseqb perueniaueqsbe perueniaueqseb
perueniaueqbse perueniaueqbes perueniaueqebs perueniaueqesb perueniauebqse perueniauebqes perueniauebsqe perueniauebseq
perueniauebesq perueniauebeqs perueniaueeqbs perueniaueeqsb perueniaueebqs perueniaueebsq perueniaueesbq perueniaueesqb
perueniaeesqub perueniaeesqbu perueniaeesuqb perueniaeesubq perueniaeesbuq perueniaeesbqu perueniaeeqsub perueniaeeqsbu
perueniaeequsb perueniaeequbs perueniaeeqbus perueniaeeqbsu perueniaeeuqsb perueniaeeuqbs perueniaeeusqb perueniaeeusbq
perueniaeeubsq perueniaeeubqs perueniaeebqus perueniaeebqsu perueniaeebuqs perueniaeebusq perueniaeebsuq perueniaeebsqu
perueniaesequb perueniaeseqbu perueniaeseuqb perueniaeseubq perueniaesebuq perueniaesebqu perueniaesqeub perueniaesqebu
perueniaesqueb perueniaesqube perueniaesqbue perueniaesqbeu perueniaesuqeb perueniaesuqbe perueniaesueqb perueniaesuebq
perueniaesubeq perueniaesubqe perueniaesbque perueniaesbqeu perueniaesbuqe perueniaesbueq perueniaesbeuq perueniaesbequ
perueniaeqseub perueniaeqsebu perueniaeqsueb perueniaeqsube perueniaeqsbue perueniaeqsbeu perueniaeqesub perueniaeqesbu
perueniaeqeusb perueniaeqeubs perueniaeqebus perueniaeqebsu perueniaequesb perueniaequebs perueniaequseb perueniaequsbe
perueniaequbse perueniaequbes perueniaeqbeus perueniaeqbesu perueniaeqbues perueniaeqbuse perueniaeqbsue perueniaeqbseu
perueniaeusqeb perueniaeusqbe perueniaeuseqb perueniaeusebq perueniaeusbeq perueniaeusbqe perueniaeuqseb perueniaeuqsbe
perueniaeuqesb perueniaeuqebs perueniaeuqbes perueniaeuqbse perueniaeueqsb perueniaeueqbs perueniaeuesqb perueniaeuesbq
perueniaeuebsq perueniaeuebqs perueniaeubqes perueniaeubqse perueniaeubeqs perueniaeubesq perueniaeubseq perueniaeubsqe
perueniaebsque perueniaebsqeu perueniaebsuqe perueniaebsueq perueniaebseuq perueniaebsequ perueniaebqsue perueniaebqseu
perueniaebquse perueniaebques perueniaebqeus perueniaebqesu perueniaebuqse perueniaebuqes perueniaebusqe perueniaebuseq
perueniaebuesq perueniaebueqs perueniaebequs perueniaebeqsu perueniaebeuqs perueniaebeusq perueniaebesuq perueniaebesqu
peruenisbaeque peruenisbaeqeu peruenisbaeuqe peruenisbaeueq peruenisbaeeuq peruenisbaeequ peruenisbaqeue peruenisbaqeeu
peruenisbaquee peruenisbaquee peruenisbaqeue peruenisbaqeeu peruenisbauqee peruenisbauqee peruenisbaueqe peruenisbaueeq
peruenisbaueeq peruenisbaueqe peruenisbaeque peruenisbaeqeu peruenisbaeuqe peruenisbaeueq peruenisbaeeuq peruenisbaeequ
peruenisbeaque peruenisbeaqeu peruenisbeauqe peruenisbeaueq peruenisbeaeuq peruenisbeaequ peruenisbeqaue peruenisbeqaeu
peruenisbequae peruenisbequea peruenisbeqeua peruenisbeqeau peruenisbeuqae peruenisbeuqea peruenisbeuaqe peruenisbeuaeq
peruenisbeueaq peruenisbeueqa peruenisbeequa peruenisbeeqau peruenisbeeuqa peruenisbeeuaq peruenisbeeauq peruenisbeeaqu
peruenisbqeaue peruenisbqeaeu peruenisbqeuae peruenisbqeuea peruenisbqeeua peruenisbqeeau peruenisbqaeue peruenisbqaeeu
peruenisbqauee peruenisbqauee peruenisbqaeue peruenisbqaeeu peruenisbquaee peruenisbquaee peruenisbqueae peruenisbqueea
peruenisbqueea peruenisbqueae peruenisbqeaue peruenisbqeaeu peruenisbqeuae peruenisbqeuea peruenisbqeeua peruenisbqeeau
peruenisbueqae peruenisbueqea peruenisbueaqe peruenisbueaeq peruenisbueeaq peruenisbueeqa peruenisbuqeae peruenisbuqeea
peruenisbuqaee peruenisbuqaee peruenisbuqeae peruenisbuqeea peruenisbuaqee peruenisbuaqee peruenisbuaeqe peruenisbuaeeq
peruenisbuaeeq peruenisbuaeqe peruenisbueqae peruenisbueqea peruenisbueaqe peruenisbueaeq peruenisbueeaq peruenisbueeqa
peruenisbeequa peruenisbeeqau peruenisbeeuqa peruenisbeeuaq peruenisbeeauq peruenisbeeaqu peruenisbeqeua peruenisbeqeau
peruenisbequea peruenisbequae peruenisbeqaue peruenisbeqaeu peruenisbeuqea peruenisbeuqae peruenisbeueqa peruenisbeueaq
peruenisbeuaeq peruenisbeuaqe peruenisbeaque peruenisbeaqeu peruenisbeauqe peruenisbeaueq peruenisbeaeuq peruenisbeaequ
peruenisabeque peruenisabeqeu peruenisabeuqe peruenisabeueq peruenisabeeuq peruenisabeequ peruenisabqeue peruenisabqeeu
peruenisabquee peruenisabquee peruenisabqeue peruenisabqeeu peruenisabuqee peruenisabuqee peruenisabueqe peruenisabueeq
peruenisabueeq peruenisabueqe peruenisabeque peruenisabeqeu peruenisabeuqe peruenisabeueq peruenisabeeuq peruenisabeequ
peruenisaebque peruenisaebqeu peruenisaebuqe peruenisaebueq peruenisaebeuq peruenisaebequ peruenisaeqbue peruenisaeqbeu
peruenisaeqube peruenisaequeb peruenisaeqeub peruenisaeqebu peruenisaeuqbe peruenisaeuqeb peruenisaeubqe peruenisaeubeq
peruenisaeuebq peruenisaeueqb peruenisaeequb peruenisaeeqbu peruenisaeeuqb peruenisaeeubq peruenisaeebuq peruenisaeebqu
peruenisaqebue peruenisaqebeu peruenisaqeube peruenisaqeueb peruenisaqeeub peruenisaqeebu peruenisaqbeue peruenisaqbeeu
peruenisaqbuee peruenisaqbuee peruenisaqbeue peruenisaqbeeu peruenisaqubee peruenisaqubee peruenisaquebe peruenisaqueeb
peruenisaqueeb peruenisaquebe peruenisaqebue peruenisaqebeu peruenisaqeube peruenisaqeueb peruenisaqeeub peruenisaqeebu
peruenisaueqbe peruenisaueqeb peruenisauebqe peruenisauebeq peruenisaueebq peruenisaueeqb peruenisauqebe peruenisauqeeb
peruenisauqbee peruenisauqbee peruenisauqebe peruenisauqeeb peruenisaubqee peruenisaubqee peruenisaubeqe peruenisaubeeq
peruenisaubeeq peruenisaubeqe peruenisaueqbe peruenisaueqeb peruenisauebqe peruenisauebeq peruenisaueebq peruenisaueeqb
peruenisaeequb peruenisaeeqbu peruenisaeeuqb peruenisaeeubq peruenisaeebuq peruenisaeebqu peruenisaeqeub peruenisaeqebu
peruenisaequeb peruenisaeqube peruenisaeqbue peruenisaeqbeu peruenisaeuqeb peruenisaeuqbe peruenisaeueqb peruenisaeuebq
peruenisaeubeq peruenisaeubqe peruenisaebque peruenisaebqeu peruenisaebuqe peruenisaebueq peruenisaebeuq peruenisaebequ
perueniseabque perueniseabqeu perueniseabuqe perueniseabueq perueniseabeuq perueniseabequ perueniseaqbue perueniseaqbeu
perueniseaqube perueniseaqueb perueniseaqeub perueniseaqebu perueniseauqbe perueniseauqeb perueniseaubqe perueniseaubeq
perueniseauebq perueniseaueqb perueniseaequb perueniseaeqbu perueniseaeuqb perueniseaeubq perueniseaebuq perueniseaebqu
peruenisebaque peruenisebaqeu peruenisebauqe peruenisebaueq peruenisebaeuq peruenisebaequ peruenisebqaue peruenisebqaeu
peruenisebquae peruenisebquea peruenisebqeua peruenisebqeau peruenisebuqae peruenisebuqea peruenisebuaqe peruenisebuaeq
peruenisebueaq peruenisebueqa peruenisebequa peruenisebeqau peruenisebeuqa peruenisebeuaq peruenisebeauq peruenisebeaqu
perueniseqbaue perueniseqbaeu perueniseqbuae perueniseqbuea perueniseqbeua perueniseqbeau perueniseqabue perueniseqabeu
perueniseqaube perueniseqaueb perueniseqaeub perueniseqaebu peruenisequabe peruenisequaeb peruenisequbae peruenisequbea
peruenisequeba peruenisequeab perueniseqeaub perueniseqeabu perueniseqeuab perueniseqeuba perueniseqebua perueniseqebau
perueniseubqae perueniseubqea perueniseubaqe perueniseubaeq perueniseubeaq perueniseubeqa perueniseuqbae perueniseuqbea
perueniseuqabe perueniseuqaeb perueniseuqeab perueniseuqeba perueniseuaqbe perueniseuaqeb perueniseuabqe perueniseuabeq
perueniseuaebq perueniseuaeqb perueniseueqab perueniseueqba perueniseueaqb perueniseueabq perueniseuebaq perueniseuebqa
perueniseebqua perueniseebqau perueniseebuqa perueniseebuaq perueniseebauq perueniseebaqu perueniseeqbua perueniseeqbau
perueniseequba perueniseequab perueniseeqaub perueniseeqabu perueniseeuqba perueniseeuqab perueniseeubqa perueniseeubaq
perueniseeuabq perueniseeuaqb perueniseeaqub perueniseeaqbu perueniseeauqb perueniseeaubq perueniseeabuq perueniseeabqu
peruenisqaebue peruenisqaebeu peruenisqaeube peruenisqaeueb peruenisqaeeub peruenisqaeebu peruenisqabeue peruenisqabeeu
peruenisqabuee peruenisqabuee peruenisqabeue peruenisqabeeu peruenisqaubee peruenisqaubee peruenisqauebe peruenisqaueeb
peruenisqaueeb peruenisqauebe peruenisqaebue peruenisqaebeu peruenisqaeube peruenisqaeueb peruenisqaeeub peruenisqaeebu
peruenisqeabue peruenisqeabeu peruenisqeaube peruenisqeaueb peruenisqeaeub peruenisqeaebu peruenisqebaue peruenisqebaeu
peruenisqebuae peruenisqebuea peruenisqebeua peruenisqebeau peruenisqeubae peruenisqeubea peruenisqeuabe peruenisqeuaeb
peruenisqeueab peruenisqeueba peruenisqeebua peruenisqeebau peruenisqeeuba peruenisqeeuab peruenisqeeaub peruenisqeeabu
peruenisqbeaue peruenisqbeaeu peruenisqbeuae peruenisqbeuea peruenisqbeeua peruenisqbeeau peruenisqbaeue peruenisqbaeeu
peruenisqbauee peruenisqbauee peruenisqbaeue peruenisqbaeeu peruenisqbuaee peruenisqbuaee peruenisqbueae peruenisqbueea
peruenisqbueea peruenisqbueae peruenisqbeaue peruenisqbeaeu peruenisqbeuae peruenisqbeuea peruenisqbeeua peruenisqbeeau
peruenisquebae peruenisquebea peruenisqueabe peruenisqueaeb peruenisqueeab peruenisqueeba peruenisqubeae peruenisqubeea
peruenisqubaee peruenisqubaee peruenisqubeae peruenisqubeea peruenisquabee peruenisquabee peruenisquaebe peruenisquaeeb
peruenisquaeeb peruenisquaebe peruenisquebae peruenisquebea peruenisqueabe peruenisqueaeb peruenisqueeab peruenisqueeba
peruenisqeebua peruenisqeebau peruenisqeeuba peruenisqeeuab peruenisqeeaub peruenisqeeabu peruenisqebeua peruenisqebeau
peruenisqebuea peruenisqebuae peruenisqebaue peruenisqebaeu peruenisqeubea peruenisqeubae peruenisqeueba peruenisqeueab
peruenisqeuaeb peruenisqeuabe peruenisqeabue peruenisqeabeu peruenisqeaube peruenisqeaueb peruenisqeaeub peruenisqeaebu
peruenisuaeqbe peruenisuaeqeb peruenisuaebqe peruenisuaebeq peruenisuaeebq peruenisuaeeqb peruenisuaqebe peruenisuaqeeb
peruenisuaqbee peruenisuaqbee peruenisuaqebe peruenisuaqeeb peruenisuabqee peruenisuabqee peruenisuabeqe peruenisuabeeq
peruenisuabeeq peruenisuabeqe peruenisuaeqbe peruenisuaeqeb peruenisuaebqe peruenisuaebeq peruenisuaeebq peruenisuaeeqb
peruenisueaqbe peruenisueaqeb peruenisueabqe peruenisueabeq peruenisueaebq peruenisueaeqb peruenisueqabe peruenisueqaeb
peruenisueqbae peruenisueqbea peruenisueqeba peruenisueqeab peruenisuebqae peruenisuebqea peruenisuebaqe peruenisuebaeq
peruenisuebeaq peruenisuebeqa peruenisueeqba peruenisueeqab peruenisueebqa peruenisueebaq peruenisueeabq peruenisueeaqb
peruenisuqeabe peruenisuqeaeb peruenisuqebae peruenisuqebea peruenisuqeeba peruenisuqeeab peruenisuqaebe peruenisuqaeeb
peruenisuqabee peruenisuqabee peruenisuqaebe peruenisuqaeeb peruenisuqbaee peruenisuqbaee peruenisuqbeae peruenisuqbeea
peruenisuqbeea peruenisuqbeae peruenisuqeabe peruenisuqeaeb peruenisuqebae peruenisuqebea peruenisuqeeba peruenisuqeeab
peruenisubeqae peruenisubeqea peruenisubeaqe peruenisubeaeq peruenisubeeaq peruenisubeeqa peruenisubqeae peruenisubqeea
peruenisubqaee peruenisubqaee peruenisubqeae peruenisubqeea peruenisubaqee peruenisubaqee peruenisubaeqe peruenisubaeeq
peruenisubaeeq peruenisubaeqe peruenisubeqae peruenisubeqea peruenisubeaqe peruenisubeaeq peruenisubeeaq peruenisubeeqa
peruenisueeqba peruenisueeqab peruenisueebqa peruenisueebaq peruenisueeabq peruenisueeaqb peruenisueqeba peruenisueqeab
peruenisueqbea peruenisueqbae peruenisueqabe peruenisueqaeb peruenisuebqea peruenisuebqae peruenisuebeqa peruenisuebeaq
peruenisuebaeq peruenisuebaqe peruenisueaqbe peruenisueaqeb peruenisueabqe peruenisueabeq peruenisueaebq peruenisueaeqb
perueniseaequb perueniseaeqbu perueniseaeuqb perueniseaeubq perueniseaebuq perueniseaebqu perueniseaqeub perueniseaqebu
perueniseaqueb perueniseaqube perueniseaqbue perueniseaqbeu perueniseauqeb perueniseauqbe perueniseaueqb perueniseauebq
perueniseaubeq perueniseaubqe perueniseabque perueniseabqeu perueniseabuqe perueniseabueq perueniseabeuq perueniseabequ
perueniseeaqub perueniseeaqbu perueniseeauqb perueniseeaubq perueniseeabuq perueniseeabqu perueniseeqaub perueniseeqabu
perueniseequab perueniseequba perueniseeqbua perueniseeqbau perueniseeuqab perueniseeuqba perueniseeuaqb perueniseeuabq
perueniseeubaq perueniseeubqa perueniseebqua perueniseebqau perueniseebuqa perueniseebuaq perueniseebauq perueniseebaqu
perueniseqeaub perueniseqeabu perueniseqeuab perueniseqeuba perueniseqebua perueniseqebau perueniseqaeub perueniseqaebu
perueniseqaueb perueniseqaube perueniseqabue perueniseqabeu peruenisequaeb peruenisequabe peruenisequeab peruenisequeba
peruenisequbea peruenisequbae perueniseqbaue perueniseqbaeu perueniseqbuae perueniseqbuea perueniseqbeua perueniseqbeau
perueniseueqab perueniseueqba perueniseueaqb perueniseueabq perueniseuebaq perueniseuebqa perueniseuqeab perueniseuqeba
perueniseuqaeb perueniseuqabe perueniseuqbae perueniseuqbea perueniseuaqeb perueniseuaqbe perueniseuaeqb perueniseuaebq
perueniseuabeq perueniseuabqe perueniseubqae perueniseubqea perueniseubaqe perueniseubaeq perueniseubeaq perueniseubeqa
peruenisebequa peruenisebeqau peruenisebeuqa peruenisebeuaq peruenisebeauq peruenisebeaqu peruenisebqeua peruenisebqeau
peruenisebquea peruenisebquae peruenisebqaue peruenisebqaeu peruenisebuqea peruenisebuqae peruenisebueqa peruenisebueaq
peruenisebuaeq peruenisebuaqe peruenisebaque peruenisebaqeu peruenisebauqe peruenisebaueq peruenisebaeuq peruenisebaequ
perueniqbaseue perueniqbaseeu perueniqbasuee perueniqbasuee perueniqbaseue perueniqbaseeu perueniqbaesue perueniqbaeseu
perueniqbaeuse perueniqbaeues perueniqbaeeus perueniqbaeesu perueniqbauese perueniqbauees perueniqbausee perueniqbausee
perueniqbauese perueniqbauees perueniqbaeeus perueniqbaeesu perueniqbaeues perueniqbaeuse perueniqbaesue perueniqbaeseu
perueniqbsaeue perueniqbsaeeu perueniqbsauee perueniqbsauee perueniqbsaeue perueniqbsaeeu perueniqbseaue perueniqbseaeu
perueniqbseuae perueniqbseuea perueniqbseeua perueniqbseeau perueniqbsueae perueniqbsueea perueniqbsuaee perueniqbsuaee
perueniqbsueae perueniqbsueea perueniqbseeua perueniqbseeau perueniqbseuea perueniqbseuae perueniqbseaue perueniqbseaeu
perueniqbesaue perueniqbesaeu perueniqbesuae perueniqbesuea perueniqbeseua perueniqbeseau perueniqbeasue perueniqbeaseu
perueniqbeause perueniqbeaues perueniqbeaeus perueniqbeaesu perueniqbeuase perueniqbeuaes perueniqbeusae perueniqbeusea
perueniqbeuesa perueniqbeueas perueniqbeeaus perueniqbeeasu perueniqbeeuas perueniqbeeusa perueniqbeesua perueniqbeesau
perueniqbuseae perueniqbuseea perueniqbusaee perueniqbusaee perueniqbuseae perueniqbuseea perueniqbuesae perueniqbuesea
perueniqbuease perueniqbueaes perueniqbueeas perueniqbueesa perueniqbuaese perueniqbuaees perueniqbuasee perueniqbuasee
perueniqbuaese perueniqbuaees perueniqbueeas perueniqbueesa perueniqbueaes perueniqbuease perueniqbuesae perueniqbuesea
perueniqbeseua perueniqbeseau perueniqbesuea perueniqbesuae perueniqbesaue perueniqbesaeu perueniqbeesua perueniqbeesau
perueniqbeeusa perueniqbeeuas perueniqbeeaus perueniqbeeasu perueniqbeuesa perueniqbeueas perueniqbeusea perueniqbeusae
perueniqbeuase perueniqbeuaes perueniqbeaeus perueniqbeaesu perueniqbeaues perueniqbeause perueniqbeasue perueniqbeaseu
perueniqabseue perueniqabseeu perueniqabsuee perueniqabsuee perueniqabseue perueniqabseeu perueniqabesue perueniqabeseu
perueniqabeuse perueniqabeues perueniqabeeus perueniqabeesu perueniqabuese perueniqabuees perueniqabusee perueniqabusee
perueniqabuese perueniqabuees perueniqabeeus perueniqabeesu perueniqabeues perueniqabeuse perueniqabesue perueniqabeseu
perueniqasbeue perueniqasbeeu perueniqasbuee perueniqasbuee perueniqasbeue perueniqasbeeu perueniqasebue perueniqasebeu
perueniqaseube perueniqaseueb perueniqaseeub perueniqaseebu perueniqasuebe perueniqasueeb perueniqasubee perueniqasubee
perueniqasuebe perueniqasueeb perueniqaseeub perueniqaseebu perueniqaseueb perueniqaseube perueniqasebue perueniqasebeu
perueniqaesbue perueniqaesbeu perueniqaesube perueniqaesueb perueniqaeseub perueniqaesebu perueniqaebsue perueniqaebseu
perueniqaebuse perueniqaebues perueniqaebeus perueniqaebesu perueniqaeubse perueniqaeubes perueniqaeusbe perueniqaeuseb
perueniqaeuesb perueniqaeuebs perueniqaeebus perueniqaeebsu perueniqaeeubs perueniqaeeusb perueniqaeesub perueniqaeesbu
perueniqausebe perueniqauseeb perueniqausbee perueniqausbee perueniqausebe perueniqauseeb perueniqauesbe perueniqaueseb
perueniqauebse perueniqauebes perueniqaueebs perueniqaueesb perueniqaubese perueniqaubees perueniqaubsee perueniqaubsee
perueniqaubese perueniqaubees perueniqaueebs perueniqaueesb perueniqauebes perueniqauebse perueniqauesbe perueniqaueseb
perueniqaeseub perueniqaesebu perueniqaesueb perueniqaesube perueniqaesbue perueniqaesbeu perueniqaeesub perueniqaeesbu
perueniqaeeusb perueniqaeeubs perueniqaeebus perueniqaeebsu perueniqaeuesb perueniqaeuebs perueniqaeuseb perueniqaeusbe
perueniqaeubse perueniqaeubes perueniqaebeus perueniqaebesu perueniqaebues perueniqaebuse perueniqaebsue perueniqaebseu
perueniqsabeue perueniqsabeeu perueniqsabuee perueniqsabuee perueniqsabeue perueniqsabeeu perueniqsaebue perueniqsaebeu
perueniqsaeube perueniqsaeueb perueniqsaeeub perueniqsaeebu perueniqsauebe perueniqsaueeb perueniqsaubee perueniqsaubee
perueniqsauebe perueniqsaueeb perueniqsaeeub perueniqsaeebu perueniqsaeueb perueniqsaeube perueniqsaebue perueniqsaebeu
perueniqsbaeue perueniqsbaeeu perueniqsbauee perueniqsbauee perueniqsbaeue perueniqsbaeeu perueniqsbeaue perueniqsbeaeu
perueniqsbeuae perueniqsbeuea perueniqsbeeua perueniqsbeeau perueniqsbueae perueniqsbueea perueniqsbuaee perueniqsbuaee
perueniqsbueae perueniqsbueea perueniqsbeeua perueniqsbeeau perueniqsbeuea perueniqsbeuae perueniqsbeaue perueniqsbeaeu
perueniqsebaue perueniqsebaeu perueniqsebuae perueniqsebuea perueniqsebeua perueniqsebeau perueniqseabue perueniqseabeu
perueniqseaube perueniqseaueb perueniqseaeub perueniqseaebu perueniqseuabe perueniqseuaeb perueniqseubae perueniqseubea
perueniqseueba perueniqseueab perueniqseeaub perueniqseeabu perueniqseeuab perueniqseeuba perueniqseebua perueniqseebau
perueniqsubeae perueniqsubeea perueniqsubaee perueniqsubaee perueniqsubeae perueniqsubeea perueniqsuebae perueniqsuebea
perueniqsueabe perueniqsueaeb perueniqsueeab perueniqsueeba perueniqsuaebe perueniqsuaeeb perueniqsuabee perueniqsuabee
perueniqsuaebe perueniqsuaeeb perueniqsueeab perueniqsueeba perueniqsueaeb perueniqsueabe perueniqsuebae perueniqsuebea
perueniqsebeua perueniqsebeau perueniqsebuea perueniqsebuae perueniqsebaue perueniqsebaeu perueniqseebua perueniqseebau
perueniqseeuba perueniqseeuab perueniqseeaub perueniqseeabu perueniqseueba perueniqseueab perueniqseubea perueniqseubae
perueniqseuabe perueniqseuaeb perueniqseaeub perueniqseaebu perueniqseaueb perueniqseaube perueniqseabue perueniqseabeu
perueniqeasbue perueniqeasbeu perueniqeasube perueniqeasueb perueniqeaseub perueniqeasebu perueniqeabsue perueniqeabseu
perueniqeabuse perueniqeabues perueniqeabeus perueniqeabesu perueniqeaubse perueniqeaubes perueniqeausbe perueniqeauseb
perueniqeauesb perueniqeauebs perueniqeaebus perueniqeaebsu perueniqeaeubs perueniqeaeusb perueniqeaesub perueniqeaesbu
perueniqesabue perueniqesabeu perueniqesaube perueniqesaueb perueniqesaeub perueniqesaebu perueniqesbaue perueniqesbaeu
perueniqesbuae perueniqesbuea perueniqesbeua perueniqesbeau perueniqesubae perueniqesubea perueniqesuabe perueniqesuaeb
perueniqesueab perueniqesueba perueniqesebua perueniqesebau perueniqeseuba perueniqeseuab perueniqeseaub perueniqeseabu
perueniqebsaue perueniqebsaeu perueniqebsuae perueniqebsuea perueniqebseua perueniqebseau perueniqebasue perueniqebaseu
perueniqebause perueniqebaues perueniqebaeus perueniqebaesu perueniqebuase perueniqebuaes perueniqebusae perueniqebusea
perueniqebuesa perueniqebueas perueniqebeaus perueniqebeasu perueniqebeuas perueniqebeusa perueniqebesua perueniqebesau
perueniqeusbae perueniqeusbea perueniqeusabe perueniqeusaeb perueniqeuseab perueniqeuseba perueniqeubsae perueniqeubsea
perueniqeubase perueniqeubaes perueniqeubeas perueniqeubesa perueniqeuabse perueniqeuabes perueniqeuasbe perueniqeuaseb
perueniqeuaesb perueniqeuaebs perueniqeuebas perueniqeuebsa perueniqeueabs perueniqeueasb perueniqeuesab perueniqeuesba
perueniqeesbua perueniqeesbau perueniqeesuba perueniqeesuab perueniqeesaub perueniqeesabu perueniqeebsua perueniqeebsau
perueniqeebusa perueniqeebuas perueniqeebaus perueniqeebasu perueniqeeubsa perueniqeeubas perueniqeeusba perueniqeeusab
perueniqeeuasb perueniqeeuabs perueniqeeabus perueniqeeabsu perueniqeeaubs perueniqeeausb perueniqeeasub perueniqeeasbu
perueniquasebe perueniquaseeb perueniquasbee perueniquasbee perueniquasebe perueniquaseeb perueniquaesbe perueniquaeseb
perueniquaebse perueniquaebes perueniquaeebs perueniquaeesb perueniquabese perueniquabees perueniquabsee perueniquabsee
perueniquabese perueniquabees perueniquaeebs perueniquaeesb perueniquaebes perueniquaebse perueniquaesbe perueniquaeseb
perueniqusaebe perueniqusaeeb perueniqusabee perueniqusabee perueniqusaebe perueniqusaeeb perueniquseabe perueniquseaeb
perueniqusebae perueniqusebea perueniquseeba perueniquseeab perueniqusbeae perueniqusbeea perueniqusbaee perueniqusbaee
perueniqusbeae perueniqusbeea perueniquseeba perueniquseeab perueniqusebea perueniqusebae perueniquseabe perueniquseaeb
perueniquesabe perueniquesaeb perueniquesbae perueniquesbea perueniqueseba perueniqueseab perueniqueasbe perueniqueaseb
perueniqueabse perueniqueabes perueniqueaebs perueniqueaesb perueniquebase perueniquebaes perueniquebsae perueniquebsea
perueniquebesa perueniquebeas perueniqueeabs perueniqueeasb perueniqueebas perueniqueebsa perueniqueesba perueniqueesab
perueniqubseae perueniqubseea perueniqubsaee perueniqubsaee perueniqubseae perueniqubseea perueniqubesae perueniqubesea
perueniqubease perueniqubeaes perueniqubeeas perueniqubeesa perueniqubaese perueniqubaees perueniqubasee perueniqubasee
perueniqubaese perueniqubaees perueniqubeeas perueniqubeesa perueniqubeaes perueniqubease perueniqubesae perueniqubesea
perueniqueseba perueniqueseab perueniquesbea perueniquesbae perueniquesabe perueniquesaeb perueniqueesba perueniqueesab
perueniqueebsa perueniqueebas perueniqueeabs perueniqueeasb perueniquebesa perueniquebeas perueniquebsea perueniquebsae
perueniquebase perueniquebaes perueniqueaebs perueniqueaesb perueniqueabes perueniqueabse perueniqueasbe perueniqueaseb
perueniqeaseub perueniqeasebu perueniqeasueb perueniqeasube perueniqeasbue perueniqeasbeu perueniqeaesub perueniqeaesbu
perueniqeaeusb perueniqeaeubs perueniqeaebus perueniqeaebsu perueniqeauesb perueniqeauebs perueniqeauseb perueniqeausbe
perueniqeaubse perueniqeaubes perueniqeabeus perueniqeabesu perueniqeabues perueniqeabuse perueniqeabsue perueniqeabseu
perueniqesaeub perueniqesaebu perueniqesaueb perueniqesaube perueniqesabue perueniqesabeu perueniqeseaub perueniqeseabu
perueniqeseuab perueniqeseuba perueniqesebua perueniqesebau perueniqesueab perueniqesueba perueniqesuaeb perueniqesuabe
perueniqesubae perueniqesubea perueniqesbeua perueniqesbeau perueniqesbuea perueniqesbuae perueniqesbaue perueniqesbaeu
perueniqeesaub perueniqeesabu perueniqeesuab perueniqeesuba perueniqeesbua perueniqeesbau perueniqeeasub perueniqeeasbu
perueniqeeausb perueniqeeaubs perueniqeeabus perueniqeeabsu perueniqeeuasb perueniqeeuabs perueniqeeusab perueniqeeusba
perueniqeeubsa perueniqeeubas perueniqeebaus perueniqeebasu perueniqeebuas perueniqeebusa perueniqeebsua perueniqeebsau
perueniqeuseab perueniqeuseba perueniqeusaeb perueniqeusabe perueniqeusbae perueniqeusbea perueniqeuesab perueniqeuesba
perueniqeueasb perueniqeueabs perueniqeuebas perueniqeuebsa perueniqeuaesb perueniqeuaebs perueniqeuaseb perueniqeuasbe
perueniqeuabse perueniqeuabes perueniqeubeas perueniqeubesa perueniqeubaes perueniqeubase perueniqeubsae perueniqeubsea
perueniqebseua perueniqebseau perueniqebsuea perueniqebsuae perueniqebsaue perueniqebsaeu perueniqebesua perueniqebesau
perueniqebeusa perueniqebeuas perueniqebeaus perueniqebeasu perueniqebuesa perueniqebueas perueniqebusea perueniqebusae
perueniqebuase perueniqebuaes perueniqebaeus perueniqebaesu perueniqebaues perueniqebause perueniqebasue perueniqebaseu
perueniubasqee perueniubasqee perueniubaseqe perueniubaseeq perueniubaseeq perueniubaseqe perueniubaqsee perueniubaqsee
perueniubaqese perueniubaqees perueniubaqees perueniubaqese perueniubaeqse perueniubaeqes perueniubaesqe perueniubaeseq
perueniubaeesq perueniubaeeqs perueniubaeqes perueniubaeqse perueniubaeeqs perueniubaeesq perueniubaeseq perueniubaesqe
perueniubsaqee perueniubsaqee perueniubsaeqe perueniubsaeeq perueniubsaeeq perueniubsaeqe perueniubsqaee perueniubsqaee
perueniubsqeae perueniubsqeea perueniubsqeea perueniubsqeae perueniubseqae perueniubseqea perueniubseaqe perueniubseaeq
perueniubseeaq perueniubseeqa perueniubseqea perueniubseqae perueniubseeqa perueniubseeaq perueniubseaeq perueniubseaqe
perueniubqsaee perueniubqsaee perueniubqseae perueniubqseea perueniubqseea perueniubqseae perueniubqasee perueniubqasee
perueniubqaese perueniubqaees perueniubqaees perueniubqaese perueniubqease perueniubqeaes perueniubqesae perueniubqesea
perueniubqeesa perueniubqeeas perueniubqeaes perueniubqease perueniubqeeas perueniubqeesa perueniubqesea perueniubqesae
perueniubesqae perueniubesqea perueniubesaqe perueniubesaeq perueniubeseaq perueniubeseqa perueniubeqsae perueniubeqsea
perueniubeqase perueniubeqaes perueniubeqeas perueniubeqesa perueniubeaqse perueniubeaqes perueniubeasqe perueniubeaseq
perueniubeaesq perueniubeaeqs perueniubeeqas perueniubeeqsa perueniubeeaqs perueniubeeasq perueniubeesaq perueniubeesqa
perueniubesqea perueniubesqae perueniubeseqa perueniubeseaq perueniubesaeq perueniubesaqe perueniubeqsea perueniubeqsae
perueniubeqesa perueniubeqeas perueniubeqaes perueniubeqase perueniubeeqsa perueniubeeqas perueniubeesqa perueniubeesaq
perueniubeeasq perueniubeeaqs perueniubeaqes perueniubeaqse perueniubeaeqs perueniubeaesq perueniubeaseq perueniubeasqe
perueniuabsqee perueniuabsqee perueniuabseqe perueniuabseeq perueniuabseeq perueniuabseqe perueniuabqsee perueniuabqsee
perueniuabqese perueniuabqees perueniuabqees perueniuabqese perueniuabeqse perueniuabeqes perueniuabesqe perueniuabeseq
perueniuabeesq perueniuabeeqs perueniuabeqes perueniuabeqse perueniuabeeqs perueniuabeesq perueniuabeseq perueniuabesqe
perueniuasbqee perueniuasbqee perueniuasbeqe perueniuasbeeq perueniuasbeeq perueniuasbeqe perueniuasqbee perueniuasqbee
perueniuasqebe perueniuasqeeb perueniuasqeeb perueniuasqebe perueniuaseqbe perueniuaseqeb perueniuasebqe perueniuasebeq
perueniuaseebq perueniuaseeqb perueniuaseqeb perueniuaseqbe perueniuaseeqb perueniuaseebq perueniuasebeq perueniuasebqe
perueniuaqsbee perueniuaqsbee perueniuaqsebe perueniuaqseeb perueniuaqseeb perueniuaqsebe perueniuaqbsee perueniuaqbsee
perueniuaqbese perueniuaqbees perueniuaqbees perueniuaqbese perueniuaqebse perueniuaqebes perueniuaqesbe perueniuaqeseb
perueniuaqeesb perueniuaqeebs perueniuaqebes perueniuaqebse perueniuaqeebs perueniuaqeesb perueniuaqeseb perueniuaqesbe
perueniuaesqbe perueniuaesqeb perueniuaesbqe perueniuaesbeq perueniuaesebq perueniuaeseqb perueniuaeqsbe perueniuaeqseb
perueniuaeqbse perueniuaeqbes perueniuaeqebs perueniuaeqesb perueniuaebqse perueniuaebqes perueniuaebsqe perueniuaebseq
perueniuaebesq perueniuaebeqs perueniuaeeqbs perueniuaeeqsb perueniuaeebqs perueniuaeebsq perueniuaeesbq perueniuaeesqb
perueniuaesqeb perueniuaesqbe perueniuaeseqb perueniuaesebq perueniuaesbeq perueniuaesbqe perueniuaeqseb perueniuaeqsbe
perueniuaeqesb perueniuaeqebs perueniuaeqbes perueniuaeqbse perueniuaeeqsb perueniuaeeqbs perueniuaeesqb perueniuaeesbq
perueniuaeebsq perueniuaeebqs perueniuaebqes perueniuaebqse perueniuaebeqs perueniuaebesq perueniuaebseq perueniuaebsqe
perueniusabqee perueniusabqee perueniusabeqe perueniusabeeq perueniusabeeq perueniusabeqe perueniusaqbee perueniusaqbee
perueniusaqebe perueniusaqeeb perueniusaqeeb perueniusaqebe perueniusaeqbe perueniusaeqeb perueniusaebqe perueniusaebeq
perueniusaeebq perueniusaeeqb perueniusaeqeb perueniusaeqbe perueniusaeeqb perueniusaeebq perueniusaebeq perueniusaebqe
perueniusbaqee perueniusbaqee perueniusbaeqe perueniusbaeeq perueniusbaeeq perueniusbaeqe perueniusbqaee perueniusbqaee
perueniusbqeae perueniusbqeea perueniusbqeea perueniusbqeae perueniusbeqae perueniusbeqea perueniusbeaqe perueniusbeaeq
perueniusbeeaq perueniusbeeqa perueniusbeqea perueniusbeqae perueniusbeeqa perueniusbeeaq perueniusbeaeq perueniusbeaqe
perueniusqbaee perueniusqbaee perueniusqbeae perueniusqbeea perueniusqbeea perueniusqbeae perueniusqabee perueniusqabee
perueniusqaebe perueniusqaeeb perueniusqaeeb perueniusqaebe perueniusqeabe perueniusqeaeb perueniusqebae perueniusqebea
perueniusqeeba perueniusqeeab perueniusqeaeb perueniusqeabe perueniusqeeab perueniusqeeba perueniusqebea perueniusqebae
perueniusebqae perueniusebqea perueniusebaqe perueniusebaeq perueniusebeaq perueniusebeqa perueniuseqbae perueniuseqbea
perueniuseqabe perueniuseqaeb perueniuseqeab perueniuseqeba perueniuseaqbe perueniuseaqeb perueniuseabqe perueniuseabeq
perueniuseaebq perueniuseaeqb perueniuseeqab perueniuseeqba perueniuseeaqb perueniuseeabq perueniuseebaq perueniuseebqa
perueniusebqea perueniusebqae perueniusebeqa perueniusebeaq perueniusebaeq perueniusebaqe perueniuseqbea perueniuseqbae
perueniuseqeba perueniuseqeab perueniuseqaeb perueniuseqabe perueniuseeqba perueniuseeqab perueniuseebqa perueniuseebaq
perueniuseeabq perueniuseeaqb perueniuseaqeb perueniuseaqbe perueniuseaeqb perueniuseaebq perueniuseabeq perueniuseabqe
perueniuqasbee perueniuqasbee perueniuqasebe perueniuqaseeb perueniuqaseeb perueniuqasebe perueniuqabsee perueniuqabsee
perueniuqabese perueniuqabees perueniuqabees perueniuqabese perueniuqaebse perueniuqaebes perueniuqaesbe perueniuqaeseb
perueniuqaeesb perueniuqaeebs perueniuqaebes perueniuqaebse perueniuqaeebs perueniuqaeesb perueniuqaeseb perueniuqaesbe
perueniuqsabee perueniuqsabee perueniuqsaebe perueniuqsaeeb perueniuqsaeeb perueniuqsaebe perueniuqsbaee perueniuqsbaee
perueniuqsbeae perueniuqsbeea perueniuqsbeea perueniuqsbeae perueniuqsebae perueniuqsebea perueniuqseabe perueniuqseaeb
perueniuqseeab perueniuqseeba perueniuqsebea perueniuqsebae perueniuqseeba perueniuqseeab perueniuqseaeb perueniuqseabe
perueniuqbsaee perueniuqbsaee perueniuqbseae perueniuqbseea perueniuqbseea perueniuqbseae perueniuqbasee perueniuqbasee
perueniuqbaese perueniuqbaees perueniuqbaees perueniuqbaese perueniuqbease perueniuqbeaes perueniuqbesae perueniuqbesea
perueniuqbeesa perueniuqbeeas perueniuqbeaes perueniuqbease perueniuqbeeas perueniuqbeesa perueniuqbesea perueniuqbesae
perueniuqesbae perueniuqesbea perueniuqesabe perueniuqesaeb perueniuqeseab perueniuqeseba perueniuqebsae perueniuqebsea
perueniuqebase perueniuqebaes perueniuqebeas perueniuqebesa perueniuqeabse perueniuqeabes perueniuqeasbe perueniuqeaseb
perueniuqeaesb perueniuqeaebs perueniuqeebas perueniuqeebsa perueniuqeeabs perueniuqeeasb perueniuqeesab perueniuqeesba
perueniuqesbea perueniuqesbae perueniuqeseba perueniuqeseab perueniuqesaeb perueniuqesabe perueniuqebsea perueniuqebsae
perueniuqebesa perueniuqebeas perueniuqebaes perueniuqebase perueniuqeebsa perueniuqeebas perueniuqeesba perueniuqeesab
perueniuqeeasb perueniuqeeabs perueniuqeabes perueniuqeabse perueniuqeaebs perueniuqeaesb perueniuqeaseb perueniuqeasbe
perueniueasqbe perueniueasqeb perueniueasbqe perueniueasbeq perueniueasebq perueniueaseqb perueniueaqsbe perueniueaqseb
perueniueaqbse perueniueaqbes perueniueaqebs perueniueaqesb perueniueabqse perueniueabqes perueniueabsqe perueniueabseq
perueniueabesq perueniueabeqs perueniueaeqbs perueniueaeqsb perueniueaebqs perueniueaebsq perueniueaesbq perueniueaesqb
perueniuesaqbe perueniuesaqeb perueniuesabqe perueniuesabeq perueniuesaebq perueniuesaeqb perueniuesqabe perueniuesqaeb
perueniuesqbae perueniuesqbea perueniuesqeba perueniuesqeab perueniuesbqae perueniuesbqea perueniuesbaqe perueniuesbaeq
perueniuesbeaq perueniuesbeqa perueniueseqba perueniueseqab perueniuesebqa perueniuesebaq perueniueseabq perueniueseaqb
perueniueqsabe perueniueqsaeb perueniueqsbae perueniueqsbea perueniueqseba perueniueqseab perueniueqasbe perueniueqaseb
perueniueqabse perueniueqabes perueniueqaebs perueniueqaesb perueniueqbase perueniueqbaes perueniueqbsae perueniueqbsea
perueniueqbesa perueniueqbeas perueniueqeabs perueniueqeasb perueniueqebas perueniueqebsa perueniueqesba perueniueqesab
perueniuebsqae perueniuebsqea perueniuebsaqe perueniuebsaeq perueniuebseaq perueniuebseqa perueniuebqsae perueniuebqsea
perueniuebqase perueniuebqaes perueniuebqeas perueniuebqesa perueniuebaqse perueniuebaqes perueniuebasqe perueniuebaseq
perueniuebaesq perueniuebaeqs perueniuebeqas perueniuebeqsa perueniuebeaqs perueniuebeasq perueniuebesaq perueniuebesqa
perueniueesqba perueniueesqab perueniueesbqa perueniueesbaq perueniueesabq perueniueesaqb perueniueeqsba perueniueeqsab
perueniueeqbsa perueniueeqbas perueniueeqabs perueniueeqasb perueniueebqsa perueniueebqas perueniueebsqa perueniueebsaq
perueniueebasq perueniueebaqs perueniueeaqbs perueniueeaqsb perueniueeabqs perueniueeabsq perueniueeasbq perueniueeasqb
perueniueasqeb perueniueasqbe perueniueaseqb perueniueasebq perueniueasbeq perueniueasbqe perueniueaqseb perueniueaqsbe
perueniueaqesb perueniueaqebs perueniueaqbes perueniueaqbse perueniueaeqsb perueniueaeqbs perueniueaesqb perueniueaesbq
perueniueaebsq perueniueaebqs perueniueabqes perueniueabqse perueniueabeqs perueniueabesq perueniueabseq perueniueabsqe
perueniuesaqeb perueniuesaqbe perueniuesaeqb perueniuesaebq perueniuesabeq perueniuesabqe perueniuesqaeb perueniuesqabe
perueniuesqeab perueniuesqeba perueniuesqbea perueniuesqbae perueniueseqab perueniueseqba perueniueseaqb perueniueseabq
perueniuesebaq perueniuesebqa perueniuesbqea perueniuesbqae perueniuesbeqa perueniuesbeaq perueniuesbaeq perueniuesbaqe
perueniueqsaeb perueniueqsabe perueniueqseab perueniueqseba perueniueqsbea perueniueqsbae perueniueqaseb perueniueqasbe
perueniueqaesb perueniueqaebs perueniueqabes perueniueqabse perueniueqeasb perueniueqeabs perueniueqesab perueniueqesba
perueniueqebsa perueniueqebas perueniueqbaes perueniueqbase perueniueqbeas perueniueqbesa perueniueqbsea perueniueqbsae
perueniueesqab perueniueesqba perueniueesaqb perueniueesabq perueniueesbaq perueniueesbqa perueniueeqsab perueniueeqsba
perueniueeqasb perueniueeqabs perueniueeqbas perueniueeqbsa perueniueeaqsb perueniueeaqbs perueniueeasqb perueniueeasbq
perueniueeabsq perueniueeabqs perueniueebqas perueniueebqsa perueniueebaqs perueniueebasq perueniueebsaq perueniueebsqa
perueniuebsqea perueniuebsqae perueniuebseqa perueniuebseaq perueniuebsaeq perueniuebsaqe perueniuebqsea perueniuebqsae
perueniuebqesa perueniuebqeas perueniuebqaes perueniuebqase perueniuebeqsa perueniuebeqas perueniuebesqa perueniuebesaq
perueniuebeasq perueniuebeaqs perueniuebaqes perueniuebaqse perueniuebaeqs perueniuebaesq perueniuebaseq perueniuebasqe
perueniebasque perueniebasqeu perueniebasuqe perueniebasueq perueniebaseuq perueniebasequ perueniebaqsue perueniebaqseu
perueniebaquse perueniebaques perueniebaqeus perueniebaqesu perueniebauqse perueniebauqes perueniebausqe perueniebauseq
perueniebauesq perueniebaueqs perueniebaequs perueniebaeqsu perueniebaeuqs perueniebaeusq perueniebaesuq perueniebaesqu
perueniebsaque perueniebsaqeu perueniebsauqe perueniebsaueq perueniebsaeuq perueniebsaequ perueniebsqaue perueniebsqaeu
perueniebsquae perueniebsquea perueniebsqeua perueniebsqeau perueniebsuqae perueniebsuqea perueniebsuaqe perueniebsuaeq
perueniebsueaq perueniebsueqa perueniebsequa perueniebseqau perueniebseuqa perueniebseuaq perueniebseauq perueniebseaqu
perueniebqsaue perueniebqsaeu perueniebqsuae perueniebqsuea perueniebqseua perueniebqseau perueniebqasue perueniebqaseu
perueniebqause perueniebqaues perueniebqaeus perueniebqaesu perueniebquase perueniebquaes perueniebqusae perueniebqusea
perueniebquesa perueniebqueas perueniebqeaus perueniebqeasu perueniebqeuas perueniebqeusa perueniebqesua perueniebqesau
perueniebusqae perueniebusqea perueniebusaqe perueniebusaeq perueniebuseaq perueniebuseqa perueniebuqsae perueniebuqsea
perueniebuqase perueniebuqaes perueniebuqeas perueniebuqesa perueniebuaqse perueniebuaqes perueniebuasqe perueniebuaseq
perueniebuaesq perueniebuaeqs perueniebueqas perueniebueqsa perueniebueaqs perueniebueasq perueniebuesaq perueniebuesqa
perueniebesqua perueniebesqau perueniebesuqa perueniebesuaq perueniebesauq perueniebesaqu perueniebeqsua perueniebeqsau
perueniebequsa perueniebequas perueniebeqaus perueniebeqasu perueniebeuqsa perueniebeuqas perueniebeusqa perueniebeusaq
perueniebeuasq perueniebeuaqs perueniebeaqus perueniebeaqsu perueniebeauqs perueniebeausq perueniebeasuq perueniebeasqu
peruenieabsque peruenieabsqeu peruenieabsuqe peruenieabsueq peruenieabseuq peruenieabsequ peruenieabqsue peruenieabqseu
peruenieabquse peruenieabques peruenieabqeus peruenieabqesu peruenieabuqse peruenieabuqes peruenieabusqe peruenieabuseq
peruenieabuesq peruenieabueqs peruenieabequs peruenieabeqsu peruenieabeuqs peruenieabeusq peruenieabesuq peruenieabesqu
peruenieasbque peruenieasbqeu peruenieasbuqe peruenieasbueq peruenieasbeuq peruenieasbequ peruenieasqbue peruenieasqbeu
peruenieasqube peruenieasqueb peruenieasqeub peruenieasqebu peruenieasuqbe peruenieasuqeb peruenieasubqe peruenieasubeq
peruenieasuebq peruenieasueqb peruenieasequb peruenieaseqbu peruenieaseuqb peruenieaseubq peruenieasebuq peruenieasebqu
peruenieaqsbue peruenieaqsbeu peruenieaqsube peruenieaqsueb peruenieaqseub peruenieaqsebu peruenieaqbsue peruenieaqbseu
peruenieaqbuse peruenieaqbues peruenieaqbeus peruenieaqbesu peruenieaqubse peruenieaqubes peruenieaqusbe peruenieaquseb
peruenieaquesb peruenieaquebs peruenieaqebus peruenieaqebsu peruenieaqeubs peruenieaqeusb peruenieaqesub peruenieaqesbu
peruenieausqbe peruenieausqeb peruenieausbqe peruenieausbeq peruenieausebq peruenieauseqb peruenieauqsbe peruenieauqseb
peruenieauqbse peruenieauqbes peruenieauqebs peruenieauqesb peruenieaubqse peruenieaubqes peruenieaubsqe peruenieaubseq
peruenieaubesq peruenieaubeqs peruenieaueqbs peruenieaueqsb peruenieauebqs peruenieauebsq peruenieauesbq peruenieauesqb
peruenieaesqub peruenieaesqbu peruenieaesuqb peruenieaesubq peruenieaesbuq peruenieaesbqu peruenieaeqsub peruenieaeqsbu
peruenieaequsb peruenieaequbs peruenieaeqbus peruenieaeqbsu peruenieaeuqsb peruenieaeuqbs peruenieaeusqb peruenieaeusbq
peruenieaeubsq peruenieaeubqs peruenieaebqus peruenieaebqsu peruenieaebuqs peruenieaebusq peruenieaebsuq peruenieaebsqu
perueniesabque perueniesabqeu perueniesabuqe perueniesabueq perueniesabeuq perueniesabequ perueniesaqbue perueniesaqbeu
perueniesaqube perueniesaqueb perueniesaqeub perueniesaqebu perueniesauqbe perueniesauqeb perueniesaubqe perueniesaubeq
perueniesauebq perueniesaueqb perueniesaequb perueniesaeqbu perueniesaeuqb perueniesaeubq perueniesaebuq perueniesaebqu
perueniesbaque perueniesbaqeu perueniesbauqe perueniesbaueq perueniesbaeuq perueniesbaequ perueniesbqaue perueniesbqaeu
perueniesbquae perueniesbquea perueniesbqeua perueniesbqeau perueniesbuqae perueniesbuqea perueniesbuaqe perueniesbuaeq
perueniesbueaq perueniesbueqa perueniesbequa perueniesbeqau perueniesbeuqa perueniesbeuaq perueniesbeauq perueniesbeaqu
perueniesqbaue perueniesqbaeu perueniesqbuae perueniesqbuea perueniesqbeua perueniesqbeau perueniesqabue perueniesqabeu
perueniesqaube perueniesqaueb perueniesqaeub perueniesqaebu perueniesquabe perueniesquaeb perueniesqubae perueniesqubea
perueniesqueba perueniesqueab perueniesqeaub perueniesqeabu perueniesqeuab perueniesqeuba perueniesqebua perueniesqebau
perueniesubqae perueniesubqea perueniesubaqe perueniesubaeq perueniesubeaq perueniesubeqa perueniesuqbae perueniesuqbea
perueniesuqabe perueniesuqaeb perueniesuqeab perueniesuqeba perueniesuaqbe perueniesuaqeb perueniesuabqe perueniesuabeq
perueniesuaebq perueniesuaeqb perueniesueqab perueniesueqba perueniesueaqb perueniesueabq perueniesuebaq perueniesuebqa
perueniesebqua perueniesebqau perueniesebuqa perueniesebuaq perueniesebauq perueniesebaqu peruenieseqbua peruenieseqbau
perueniesequba perueniesequab peruenieseqaub peruenieseqabu peruenieseuqba peruenieseuqab peruenieseubqa peruenieseubaq
peruenieseuabq peruenieseuaqb peruenieseaqub peruenieseaqbu peruenieseauqb peruenieseaubq peruenieseabuq peruenieseabqu
peruenieqasbue peruenieqasbeu peruenieqasube peruenieqasueb peruenieqaseub peruenieqasebu peruenieqabsue peruenieqabseu
peruenieqabuse peruenieqabues peruenieqabeus peruenieqabesu peruenieqaubse peruenieqaubes peruenieqausbe peruenieqauseb
peruenieqauesb peruenieqauebs peruenieqaebus peruenieqaebsu peruenieqaeubs peruenieqaeusb peruenieqaesub peruenieqaesbu
peruenieqsabue peruenieqsabeu peruenieqsaube peruenieqsaueb peruenieqsaeub peruenieqsaebu peruenieqsbaue peruenieqsbaeu
peruenieqsbuae peruenieqsbuea peruenieqsbeua peruenieqsbeau peruenieqsubae peruenieqsubea peruenieqsuabe peruenieqsuaeb
peruenieqsueab peruenieqsueba peruenieqsebua peruenieqsebau peruenieqseuba peruenieqseuab peruenieqseaub peruenieqseabu
peruenieqbsaue peruenieqbsaeu peruenieqbsuae peruenieqbsuea peruenieqbseua peruenieqbseau peruenieqbasue peruenieqbaseu
peruenieqbause peruenieqbaues peruenieqbaeus peruenieqbaesu peruenieqbuase peruenieqbuaes peruenieqbusae peruenieqbusea
peruenieqbuesa peruenieqbueas peruenieqbeaus peruenieqbeasu peruenieqbeuas peruenieqbeusa peruenieqbesua peruenieqbesau
perueniequsbae perueniequsbea perueniequsabe perueniequsaeb perueniequseab perueniequseba perueniequbsae perueniequbsea
perueniequbase perueniequbaes perueniequbeas perueniequbesa perueniequabse perueniequabes perueniequasbe perueniequaseb
perueniequaesb perueniequaebs perueniequebas perueniequebsa perueniequeabs perueniequeasb perueniequesab perueniequesba
peruenieqesbua peruenieqesbau peruenieqesuba peruenieqesuab peruenieqesaub peruenieqesabu peruenieqebsua peruenieqebsau
peruenieqebusa peruenieqebuas peruenieqebaus peruenieqebasu peruenieqeubsa peruenieqeubas peruenieqeusba peruenieqeusab
peruenieqeuasb peruenieqeuabs peruenieqeabus peruenieqeabsu peruenieqeaubs peruenieqeausb peruenieqeasub peruenieqeasbu
peruenieuasqbe peruenieuasqeb peruenieuasbqe peruenieuasbeq peruenieuasebq peruenieuaseqb peruenieuaqsbe peruenieuaqseb
peruenieuaqbse peruenieuaqbes peruenieuaqebs peruenieuaqesb peruenieuabqse peruenieuabqes peruenieuabsqe peruenieuabseq
peruenieuabesq peruenieuabeqs peruenieuaeqbs peruenieuaeqsb peruenieuaebqs peruenieuaebsq peruenieuaesbq peruenieuaesqb
peruenieusaqbe peruenieusaqeb peruenieusabqe peruenieusabeq peruenieusaebq peruenieusaeqb peruenieusqabe peruenieusqaeb
peruenieusqbae peruenieusqbea peruenieusqeba peruenieusqeab peruenieusbqae peruenieusbqea peruenieusbaqe peruenieusbaeq
peruenieusbeaq peruenieusbeqa peruenieuseqba peruenieuseqab peruenieusebqa peruenieusebaq peruenieuseabq peruenieuseaqb
peruenieuqsabe peruenieuqsaeb peruenieuqsbae peruenieuqsbea peruenieuqseba peruenieuqseab peruenieuqasbe peruenieuqaseb
peruenieuqabse peruenieuqabes peruenieuqaebs peruenieuqaesb peruenieuqbase peruenieuqbaes peruenieuqbsae peruenieuqbsea
peruenieuqbesa peruenieuqbeas peruenieuqeabs peruenieuqeasb peruenieuqebas peruenieuqebsa peruenieuqesba peruenieuqesab
peruenieubsqae peruenieubsqea peruenieubsaqe peruenieubsaeq peruenieubseaq peruenieubseqa peruenieubqsae peruenieubqsea
peruenieubqase peruenieubqaes peruenieubqeas peruenieubqesa peruenieubaqse peruenieubaqes peruenieubasqe peruenieubaseq
peruenieubaesq peruenieubaeqs peruenieubeqas peruenieubeqsa peruenieubeaqs peruenieubeasq peruenieubesaq peruenieubesqa
peruenieuesqba peruenieuesqab peruenieuesbqa peruenieuesbaq peruenieuesabq peruenieuesaqb peruenieueqsba peruenieueqsab
peruenieueqbsa peruenieueqbas peruenieueqabs peruenieueqasb peruenieuebqsa peruenieuebqas peruenieuebsqa peruenieuebsaq
peruenieuebasq peruenieuebaqs peruenieueaqbs peruenieueaqsb peruenieueabqs peruenieueabsq peruenieueasbq peruenieueasqb
peruenieeasqub peruenieeasqbu peruenieeasuqb peruenieeasubq peruenieeasbuq peruenieeasbqu peruenieeaqsub peruenieeaqsbu
peruenieeaqusb peruenieeaqubs peruenieeaqbus peruenieeaqbsu peruenieeauqsb peruenieeauqbs peruenieeausqb peruenieeausbq
peruenieeaubsq peruenieeaubqs peruenieeabqus peruenieeabqsu peruenieeabuqs peruenieeabusq peruenieeabsuq peruenieeabsqu
peruenieesaqub peruenieesaqbu peruenieesauqb peruenieesaubq peruenieesabuq peruenieesabqu peruenieesqaub peruenieesqabu
peruenieesquab peruenieesquba peruenieesqbua peruenieesqbau peruenieesuqab peruenieesuqba peruenieesuaqb peruenieesuabq
peruenieesubaq peruenieesubqa peruenieesbqua peruenieesbqau peruenieesbuqa peruenieesbuaq peruenieesbauq peruenieesbaqu
peruenieeqsaub peruenieeqsabu peruenieeqsuab peruenieeqsuba peruenieeqsbua peruenieeqsbau peruenieeqasub peruenieeqasbu
peruenieeqausb peruenieeqaubs peruenieeqabus peruenieeqabsu peruenieequasb peruenieequabs peruenieequsab peruenieequsba
peruenieequbsa peruenieequbas peruenieeqbaus peruenieeqbasu peruenieeqbuas peruenieeqbusa peruenieeqbsua peruenieeqbsau
peruenieeusqab peruenieeusqba peruenieeusaqb peruenieeusabq peruenieeusbaq peruenieeusbqa peruenieeuqsab peruenieeuqsba
peruenieeuqasb peruenieeuqabs peruenieeuqbas peruenieeuqbsa peruenieeuaqsb peruenieeuaqbs peruenieeuasqb peruenieeuasbq
peruenieeuabsq peruenieeuabqs peruenieeubqas peruenieeubqsa peruenieeubaqs peruenieeubasq peruenieeubsaq peruenieeubsqa
peruenieebsqua peruenieebsqau peruenieebsuqa peruenieebsuaq peruenieebsauq peruenieebsaqu peruenieebqsua peruenieebqsau
peruenieebqusa peruenieebquas peruenieebqaus peruenieebqasu peruenieebuqsa peruenieebuqas peruenieebusqa peruenieebusaq
peruenieebuasq peruenieebuaqs peruenieebaqus peruenieebaqsu peruenieebauqs peruenieebausq peruenieebasuq peruenieebasqu

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us