easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

sonaveratque

antiportable

muriculate

warttenberg

gozon

arboris

styrol

platelet

nontheistic

headpenny

faciebamus

antilemic

osteoids

shorewards

ziggurats

lignifications

keews

wirick


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: pertulitque
cipher variations:
qfsuvmjurvf rgtvwnkvswg shuwxolwtxh tivxypmxuyi ujwyzqnyvzj
vkxzarozwak wlyabspaxbl xmzbctqbycm ynacdurczdn zobdevsdaeo
apcefwtebfp bqdfgxufcgq creghyvgdhr dsfhizwheis etgijaxifjt
fuhjkbyjgku gviklczkhlv hwjlmdalimw ixkmnebmjnx jylnofcnkoy
kzmopgdolpz lanpqhepmqa mboqrifqnrb ncprsjgrosc odqstkhsptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: pertulitque
Cipher: kvigforgjfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: pertulitque
Cipher: ABBBA AABAA BAAAA BAABA BAABB ABABA ABAAA BAABA ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: pertulitque
cipher variations:
qfsuvmjurvfunagjizgxjnyvisxepsdxvcdqelafejldglyqzwvqpzlktgcnslcvntsjwapkrahpjwremdghmndr
azmyrcxytrzehukfynkzfhipcwtudwftpmxkihqtilhxrgtvwnkvswgvobhkjahykozwjtyfqteywderfmbgfkme
hmzraxwrqamluhdotmdwoutkxbqlsbiqkxsfnehinoesbanzsdyzusafivlgzolagijqdxuvexguqnyljirujmiy
shuwxolwtxhwpcilkbizlpaxkuzgrufzxefsgnchglnfinasbyxsrbnmviepunexpvulycrmtcjrlytgofijopft
cboatezavtbgjwmhapmbhjkreyvwfyhvrozmkjsvknjztivxypmxuyixqdjmlcjamqbylvahsvgayfgthodihmog
jobtczytsconwjfqvofyqwvmzdsnudksmzuhpgjkpqgudcpbufabwuchkxnibqnciklsfzwxgziwspanlktwloka
ujwyzqnyvzjyreknmdkbnrczmwbitwhbzghuipejinphkpcudazutdpoxkgrwpgzrxwnaetoveltnaviqhklqrhv
edqcvgbcxvdilyojcrodjlmtgaxyhajxtqbomluxmplbvkxzarozwakzsflonelcosdanxcjuxicahivjqfkjoqi
lqdvebavueqpylhsxqhasyxobfupwfmuobwjrilmrsiwferdwhcdywejmzpkdspekmnuhbyzibkyurcpnmvynqmc
wlyabspaxblatgmpofmdpteboydkvyjdbijwkrglkprjmrewfcbwvfrqzmityribtzypcgvqxgnvpcxksjmnstjx
gfsexidezxfknaqletqflnoviczajclzvsdqonwzorndxmzbctqbycmbuhnqpgnequfcpzelwzkecjkxlshmlqsk
nsfxgdcxwgsranjuzsjcuazqdhwryhowqdyltknotukyhgtfyjefayglobrmfurgmopwjdabkdmawterpoxapsoe
ynacdurczdncviorqhofrvgdqafmxalfdklymtinmrtlotgyhedyxhtsbokvatkdvbareixszipxrezmulopuvlz
ihugzkfgbzhmpcsngvshnpqxkebclenbxufsqpybqtpfzobdevsdaeodwjpsripgswherbgnybmgelmznujonsum
puhzifezyiutcplwbulewcbsfjytajqysfanvmpqvwmajivhalghcainqdtohwtioqrylfcdmfocyvgtrqzcruqg
apcefwtebfpexkqtsjqhtxifschozcnhfmnaovkpotvnqviajgfazjvudqmxcvmfxdctgkzubkrztgbownqrwxnb
kjwibmhidbjoreupixujprszmgdengpdzwhusradsvrhbqdfgxufcgqfylrutkriuyjgtdipadoignobpwlqpuwo
rwjbkhgbakwvernydwngyeduhlavclsauhcpxorsxyoclkxjcnijeckpsfvqjyvkqstanhefohqeaxivtsbetwsi
creghyvgdhrgzmsvulsjvzkhuejqbepjhopcqxmrqvxpsxkclihcblxwfsozexohzfevimbwdmtbvidqypstyzpd
mlykdojkfdlqtgwrkzwlrtuboifgpirfbyjwutcfuxtjdsfhizwheishantwvmtkwalivfkrcfqkipqdrynsrwyq
tyldmjidcmyxgtpafypiagfwjncxenucwjerzqtuzaqenmzlepklgemruhxslaxmsuvcpjghqjsgczkxvudgvyuk
etgijaxifjtibouxwnulxbmjwglsdgrljqreszotsxzruzmenkjednzyhuqbgzqjbhgxkodyfovdxkfsaruvabrf
onamfqlmhfnsviytmbyntvwdqkhirkthdalywvehwzvlfuhjkbyjgkujcpvyxovmycnkxhmtehsmkrsftaputyas
vanfolkfeoazivrcharkcihylpezgpweylgtbsvwbcsgpobngrmnigotwjzunczouwxerlijsluiebmzxwfixawm
gviklczkhlvkdqwzypwnzdolyinufitnlstgubqvuzbtwbogpmlgfpbajwsdibsldjizmqfahqxfzmhuctwxcdth
qpcohsnojhpuxkavodapvxyfsmjktmvjfcnayxgjybxnhwjlmdalimwlerxazqxoaepmzjovgjuomtuhvcrwvacu
xcphqnmhgqcbkxtejctmekjanrgbiryganivduxydeuirqdpitopkiqvylbwpebqwyzgtnklunwkgdobzyhkzcyo
ixkmnebmjnxmfsybarypbfqnakpwhkvpnuviwdsxwbdvydqironihrdclyufkdunflkboshcjszhbojwevyzefvj
sreqjupqljrwzmcxqfcrxzahuolmvoxlhepcaziladzpjylnofcnkoyngtzcbszqcgroblqxilwqovwjxetyxcew
zerjspojisedmzvglevogmlcptidktaicpkxfwzafgwktsfrkvqrmksxandyrgdsyabivpmnwpymifqdbajmbeaq
kzmopgdolpzohuadctardhspcmryjmxrpwxkyfuzydfxafsktqpkjtfenawhmfwphnmdqujelubjdqlygxabghxl
utgslwrsnltyboezshetzbcjwqnoxqznjgrecbkncfbrlanpqhepmqapivbedubseitqdnszknysqxylzgvazegy
bgtlurqlkugfobxingxqionervkfmvckermzhybchiymvuhtmxstomuzcpfatifuacdkxropyraokhsfdclodgcs
mboqrifqnrbqjwcfevctfjureotaloztryzmahwbafhzchumvsrmlvhgpcyjohyrjpofswlgnwdlfsnaizcdijzn
wviunytupnvadqgbujgvbdelyspqzsbplitgedmpehdtncprsjgroscrkxdgfwdugkvsfpubmpauszanbixcbgia
divnwtsnmwihqdzkpizskqpgtxmhoxemgtobjadejkaoxwjvozuvqowberhcvkhwcefmztqratcqmjuhfenqfieu
odqstkhsptdslyehgxevhlwtgqvcnqbvtabocjydchjbejwoxutonxjirealqjatlrqhuynipyfnhupckbefklbp
yxkwpavwrpxcfsidwlixdfgnaursbudrnkvigforgjfvpertulitquetmzfihyfwimxuhrwdorcwubcpdkzedikc
fkxpyvupoykjsfbmrkbumsrivzojqzgoivqdlcfglmcqzylxqbwxsqydgtjexmjyeghobvstcvesolwjhgpshkgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: pertulitque
Cipher: creghyvgdhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: pertulitque
Cipher: 5351244454134244145451

Extended Methods:
Method #1

Plaintext: pertulitque
method variations:
ukwyzqoyvzkzpbdevtdaepeugikayifkukzmopfdolpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
p e r t u l i t q u e 
5 5 2 4 5 1 4 4 1 5 5 
3 1 4 4 4 3 2 4 4 4 1 
They are then read out in rows:
5524514415531444324441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: pertulitque
Cipher: zretvpqthtd

Read more ...
Method #3

Plaintext: pertulitque
method variations:
xftydsrdyyv ftydsrdyyvx tydsrdyyvxf
ydsrdyyvxft dsrdyyvxfty srdyyvxftyd
rdyyvxftyds dyyvxftydsr yyvxftydsrd
yvxftydsrdy vxftydsrdyy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: pertulitque

first 5040 cipher variations(39615626 total)
pertulitque pertulitqeu pertulituqe pertulitueq pertuliteuq pertulitequ pertuliqtue pertuliqteu pertuliqute pertuliquet
pertuliqeut pertuliqetu pertuliuqte pertuliuqet pertuliutqe pertuliuteq pertuliuetq pertuliueqt pertuliequt pertulieqtu
pertulieuqt pertulieutq pertulietuq pertulietqu pertultique pertultiqeu pertultiuqe pertultiueq pertultieuq pertultiequ
pertultqiue pertultqieu pertultquie pertultquei pertultqeui pertultqeiu pertultuqie pertultuqei pertultuiqe pertultuieq
pertultueiq pertultueqi pertultequi pertulteqiu pertulteuqi pertulteuiq pertulteiuq pertulteiqu pertulqtiue pertulqtieu
pertulqtuie pertulqtuei pertulqteui pertulqteiu pertulqitue pertulqiteu pertulqiute pertulqiuet pertulqieut pertulqietu
pertulquite pertulquiet pertulqutie pertulqutei pertulqueti pertulqueit pertulqeiut pertulqeitu pertulqeuit pertulqeuti
pertulqetui pertulqetiu pertulutqie pertulutqei pertulutiqe pertulutieq pertuluteiq pertuluteqi pertuluqtie pertuluqtei
pertuluqite pertuluqiet pertuluqeit pertuluqeti pertuluiqte pertuluiqet pertuluitqe pertuluiteq pertuluietq pertuluieqt
pertulueqit pertulueqti pertulueiqt pertulueitq pertuluetiq pertuluetqi pertuletqui pertuletqiu pertuletuqi pertuletuiq
pertuletiuq pertuletiqu pertuleqtui pertuleqtiu pertulequti pertulequit pertuleqiut pertuleqitu pertuleuqti pertuleuqit
pertuleutqi pertuleutiq pertuleuitq pertuleuiqt pertuleiqut pertuleiqtu pertuleiuqt pertuleiutq pertuleituq pertuleitqu
pertuiltque pertuiltqeu pertuiltuqe pertuiltueq pertuilteuq pertuiltequ pertuilqtue pertuilqteu pertuilqute pertuilquet
pertuilqeut pertuilqetu pertuiluqte pertuiluqet pertuilutqe pertuiluteq pertuiluetq pertuilueqt pertuilequt pertuileqtu
pertuileuqt pertuileutq pertuiletuq pertuiletqu pertuitlque pertuitlqeu pertuitluqe pertuitlueq pertuitleuq pertuitlequ
pertuitqlue pertuitqleu pertuitqule pertuitquel pertuitqeul pertuitqelu pertuituqle pertuituqel pertuitulqe pertuituleq
pertuituelq pertuitueql pertuitequl pertuiteqlu pertuiteuql pertuiteulq pertuiteluq pertuitelqu pertuiqtlue pertuiqtleu
pertuiqtule pertuiqtuel pertuiqteul pertuiqtelu pertuiqltue pertuiqlteu pertuiqlute pertuiqluet pertuiqleut pertuiqletu
pertuiqulte pertuiqulet pertuiqutle pertuiqutel pertuiquetl pertuiquelt pertuiqelut pertuiqeltu pertuiqeult pertuiqeutl
pertuiqetul pertuiqetlu pertuiutqle pertuiutqel pertuiutlqe pertuiutleq pertuiutelq pertuiuteql pertuiuqtle pertuiuqtel
pertuiuqlte pertuiuqlet pertuiuqelt pertuiuqetl pertuiulqte pertuiulqet pertuiultqe pertuiulteq pertuiuletq pertuiuleqt
pertuiueqlt pertuiueqtl pertuiuelqt pertuiueltq pertuiuetlq pertuiuetql pertuietqul pertuietqlu pertuietuql pertuietulq
pertuietluq pertuietlqu pertuieqtul pertuieqtlu pertuiequtl pertuieqult pertuieqlut pertuieqltu pertuieuqtl pertuieuqlt
pertuieutql pertuieutlq pertuieultq pertuieulqt pertuielqut pertuielqtu pertuieluqt pertuielutq pertuieltuq pertuieltqu
pertutilque pertutilqeu pertutiluqe pertutilueq pertutileuq pertutilequ pertutiqlue pertutiqleu pertutiqule pertutiquel
pertutiqeul pertutiqelu pertutiuqle pertutiuqel pertutiulqe pertutiuleq pertutiuelq pertutiueql pertutiequl pertutieqlu
pertutieuql pertutieulq pertutieluq pertutielqu pertutlique pertutliqeu pertutliuqe pertutliueq pertutlieuq pertutliequ
pertutlqiue pertutlqieu pertutlquie pertutlquei pertutlqeui pertutlqeiu pertutluqie pertutluqei pertutluiqe pertutluieq
pertutlueiq pertutlueqi pertutlequi pertutleqiu pertutleuqi pertutleuiq pertutleiuq pertutleiqu pertutqliue pertutqlieu
pertutqluie pertutqluei pertutqleui pertutqleiu pertutqilue pertutqileu pertutqiule pertutqiuel pertutqieul pertutqielu
pertutquile pertutquiel pertutqulie pertutqulei pertutqueli pertutqueil pertutqeiul pertutqeilu pertutqeuil pertutqeuli
pertutqelui pertutqeliu pertutulqie pertutulqei pertutuliqe pertutulieq pertutuleiq pertutuleqi pertutuqlie pertutuqlei
pertutuqile pertutuqiel pertutuqeil pertutuqeli pertutuiqle pertutuiqel pertutuilqe pertutuileq pertutuielq pertutuieql
pertutueqil pertutueqli pertutueiql pertutueilq pertutueliq pertutuelqi pertutelqui pertutelqiu pertuteluqi pertuteluiq
pertuteliuq pertuteliqu pertuteqlui pertuteqliu pertutequli pertutequil pertuteqiul pertuteqilu pertuteuqli pertuteuqil
pertuteulqi pertuteuliq pertuteuilq pertuteuiql pertuteiqul pertuteiqlu pertuteiuql pertuteiulq pertuteiluq pertuteilqu
pertuqitlue pertuqitleu pertuqitule pertuqituel pertuqiteul pertuqitelu pertuqiltue pertuqilteu pertuqilute pertuqiluet
pertuqileut pertuqiletu pertuqiulte pertuqiulet pertuqiutle pertuqiutel pertuqiuetl pertuqiuelt pertuqielut pertuqieltu
pertuqieult pertuqieutl pertuqietul pertuqietlu pertuqtilue pertuqtileu pertuqtiule pertuqtiuel pertuqtieul pertuqtielu
pertuqtliue pertuqtlieu pertuqtluie pertuqtluei pertuqtleui pertuqtleiu pertuqtulie pertuqtulei pertuqtuile pertuqtuiel
pertuqtueil pertuqtueli pertuqtelui pertuqteliu pertuqteuli pertuqteuil pertuqteiul pertuqteilu pertuqltiue pertuqltieu
pertuqltuie pertuqltuei pertuqlteui pertuqlteiu pertuqlitue pertuqliteu pertuqliute pertuqliuet pertuqlieut pertuqlietu
pertuqluite pertuqluiet pertuqlutie pertuqlutei pertuqlueti pertuqlueit pertuqleiut pertuqleitu pertuqleuit pertuqleuti
pertuqletui pertuqletiu pertuqutlie pertuqutlei pertuqutile pertuqutiel pertuquteil pertuquteli pertuqultie pertuqultei
pertuqulite pertuquliet pertuquleit pertuquleti pertuquilte pertuquilet pertuquitle pertuquitel pertuquietl pertuquielt
pertuquelit pertuquelti pertuqueilt pertuqueitl pertuquetil pertuquetli pertuqetlui pertuqetliu pertuqetuli pertuqetuil
pertuqetiul pertuqetilu pertuqeltui pertuqeltiu pertuqeluti pertuqeluit pertuqeliut pertuqelitu pertuqeulti pertuqeulit
pertuqeutli pertuqeutil pertuqeuitl pertuqeuilt pertuqeilut pertuqeiltu pertuqeiult pertuqeiutl pertuqeitul pertuqeitlu
pertuuitqle pertuuitqel pertuuitlqe pertuuitleq pertuuitelq pertuuiteql pertuuiqtle pertuuiqtel pertuuiqlte pertuuiqlet
pertuuiqelt pertuuiqetl pertuuilqte pertuuilqet pertuuiltqe pertuuilteq pertuuiletq pertuuileqt pertuuieqlt pertuuieqtl
pertuuielqt pertuuieltq pertuuietlq pertuuietql pertuutiqle pertuutiqel pertuutilqe pertuutileq pertuutielq pertuutieql
pertuutqile pertuutqiel pertuutqlie pertuutqlei pertuutqeli pertuutqeil pertuutlqie pertuutlqei pertuutliqe pertuutlieq
pertuutleiq pertuutleqi pertuuteqli pertuuteqil pertuutelqi pertuuteliq pertuuteilq pertuuteiql pertuuqtile pertuuqtiel
pertuuqtlie pertuuqtlei pertuuqteli pertuuqteil pertuuqitle pertuuqitel pertuuqilte pertuuqilet pertuuqielt pertuuqietl
pertuuqlite pertuuqliet pertuuqltie pertuuqltei pertuuqleti pertuuqleit pertuuqeilt pertuuqeitl pertuuqelit pertuuqelti
pertuuqetli pertuuqetil pertuultqie pertuultqei pertuultiqe pertuultieq pertuulteiq pertuulteqi pertuulqtie pertuulqtei
pertuulqite pertuulqiet pertuulqeit pertuulqeti pertuuliqte pertuuliqet pertuulitqe pertuuliteq pertuulietq pertuulieqt
pertuuleqit pertuuleqti pertuuleiqt pertuuleitq pertuuletiq pertuuletqi pertuuetqli pertuuetqil pertuuetlqi pertuuetliq
pertuuetilq pertuuetiql pertuueqtli pertuueqtil pertuueqlti pertuueqlit pertuueqilt pertuueqitl pertuuelqti pertuuelqit
pertuueltqi pertuueltiq pertuuelitq pertuueliqt pertuueiqlt pertuueiqtl pertuueilqt pertuueiltq pertuueitlq pertuueitql
pertueitqul pertueitqlu pertueituql pertueitulq pertueitluq pertueitlqu pertueiqtul pertueiqtlu pertueiqutl pertueiqult
pertueiqlut pertueiqltu pertueiuqtl pertueiuqlt pertueiutql pertueiutlq pertueiultq pertueiulqt pertueilqut pertueilqtu
pertueiluqt pertueilutq pertueiltuq pertueiltqu pertuetiqul pertuetiqlu pertuetiuql pertuetiulq pertuetiluq pertuetilqu
pertuetqiul pertuetqilu pertuetquil pertuetquli pertuetqlui pertuetqliu pertuetuqil pertuetuqli pertuetuiql pertuetuilq
pertuetuliq pertuetulqi pertuetlqui pertuetlqiu pertuetluqi pertuetluiq pertuetliuq pertuetliqu pertueqtiul pertueqtilu
pertueqtuil pertueqtuli pertueqtlui pertueqtliu pertueqitul pertueqitlu pertueqiutl pertueqiult pertueqilut pertueqiltu
pertuequitl pertuequilt pertuequtil pertuequtli pertuequlti pertuequlit pertueqliut pertueqlitu pertueqluit pertueqluti
pertueqltui pertueqltiu pertueutqil pertueutqli pertueutiql pertueutilq pertueutliq pertueutlqi pertueuqtil pertueuqtli
pertueuqitl pertueuqilt pertueuqlit pertueuqlti pertueuiqtl pertueuiqlt pertueuitql pertueuitlq pertueuiltq pertueuilqt
pertueulqit pertueulqti pertueuliqt pertueulitq pertueultiq pertueultqi pertueltqui pertueltqiu pertueltuqi pertueltuiq
pertueltiuq pertueltiqu pertuelqtui pertuelqtiu pertuelquti pertuelquit pertuelqiut pertuelqitu pertueluqti pertueluqit
pertuelutqi pertuelutiq pertueluitq pertueluiqt pertueliqut pertueliqtu pertueliuqt pertueliutq pertuelituq pertuelitqu
pertluitque pertluitqeu pertluituqe pertluitueq pertluiteuq pertluitequ pertluiqtue pertluiqteu pertluiqute pertluiquet
pertluiqeut pertluiqetu pertluiuqte pertluiuqet pertluiutqe pertluiuteq pertluiuetq pertluiueqt pertluiequt pertluieqtu
pertluieuqt pertluieutq pertluietuq pertluietqu pertlutique pertlutiqeu pertlutiuqe pertlutiueq pertlutieuq pertlutiequ
pertlutqiue pertlutqieu pertlutquie pertlutquei pertlutqeui pertlutqeiu pertlutuqie pertlutuqei pertlutuiqe pertlutuieq
pertlutueiq pertlutueqi pertlutequi pertluteqiu pertluteuqi pertluteuiq pertluteiuq pertluteiqu pertluqtiue pertluqtieu
pertluqtuie pertluqtuei pertluqteui pertluqteiu pertluqitue pertluqiteu pertluqiute pertluqiuet pertluqieut pertluqietu
pertluquite pertluquiet pertluqutie pertluqutei pertluqueti pertluqueit pertluqeiut pertluqeitu pertluqeuit pertluqeuti
pertluqetui pertluqetiu pertluutqie pertluutqei pertluutiqe pertluutieq pertluuteiq pertluuteqi pertluuqtie pertluuqtei
pertluuqite pertluuqiet pertluuqeit pertluuqeti pertluuiqte pertluuiqet pertluuitqe pertluuiteq pertluuietq pertluuieqt
pertluueqit pertluueqti pertluueiqt pertluueitq pertluuetiq pertluuetqi pertluetqui pertluetqiu pertluetuqi pertluetuiq
pertluetiuq pertluetiqu pertlueqtui pertlueqtiu pertluequti pertluequit pertlueqiut pertlueqitu pertlueuqti pertlueuqit
pertlueutqi pertlueutiq pertlueuitq pertlueuiqt pertlueiqut pertlueiqtu pertlueiuqt pertlueiutq pertlueituq pertlueitqu
pertliutque pertliutqeu pertliutuqe pertliutueq pertliuteuq pertliutequ pertliuqtue pertliuqteu pertliuqute pertliuquet
pertliuqeut pertliuqetu pertliuuqte pertliuuqet pertliuutqe pertliuuteq pertliuuetq pertliuueqt pertliuequt pertliueqtu
pertliueuqt pertliueutq pertliuetuq pertliuetqu pertlituque pertlituqeu pertlituuqe pertlituueq pertlitueuq pertlituequ
pertlitquue pertlitqueu pertlitquue pertlitqueu pertlitqeuu pertlitqeuu pertlituque pertlituqeu pertlituuqe pertlituueq
pertlitueuq pertlituequ pertlitequu pertlitequu pertliteuqu pertliteuuq pertliteuuq pertliteuqu pertliqtuue pertliqtueu
pertliqtuue pertliqtueu pertliqteuu pertliqteuu pertliqutue pertliquteu pertliquute pertliquuet pertliqueut pertliquetu
pertliquute pertliquuet pertliqutue pertliquteu pertliquetu pertliqueut pertliqeuut pertliqeutu pertliqeuut pertliqeutu
pertliqetuu pertliqetuu pertliutque pertliutqeu pertliutuqe pertliutueq pertliuteuq pertliutequ pertliuqtue pertliuqteu
pertliuqute pertliuquet pertliuqeut pertliuqetu pertliuuqte pertliuuqet pertliuutqe pertliuuteq pertliuuetq pertliuueqt
pertliuequt pertliueqtu pertliueuqt pertliueutq pertliuetuq pertliuetqu pertlietquu pertlietquu pertlietuqu pertlietuuq
pertlietuuq pertlietuqu pertlieqtuu pertlieqtuu pertliequtu pertliequut pertliequut pertliequtu pertlieuqtu pertlieuqut
pertlieutqu pertlieutuq pertlieuutq pertlieuuqt pertlieuqut pertlieuqtu pertlieuuqt pertlieuutq pertlieutuq pertlieutqu
pertltiuque pertltiuqeu pertltiuuqe pertltiuueq pertltiueuq pertltiuequ pertltiquue pertltiqueu pertltiquue pertltiqueu
pertltiqeuu pertltiqeuu pertltiuque pertltiuqeu pertltiuuqe pertltiuueq pertltiueuq pertltiuequ pertltiequu pertltiequu
pertltieuqu pertltieuuq pertltieuuq pertltieuqu pertltuique pertltuiqeu pertltuiuqe pertltuiueq pertltuieuq pertltuiequ
pertltuqiue pertltuqieu pertltuquie pertltuquei pertltuqeui pertltuqeiu pertltuuqie pertltuuqei pertltuuiqe pertltuuieq
pertltuueiq pertltuueqi pertltuequi pertltueqiu pertltueuqi pertltueuiq pertltueiuq pertltueiqu pertltquiue pertltquieu
pertltquuie pertltquuei pertltqueui pertltqueiu pertltqiuue pertltqiueu pertltqiuue pertltqiueu pertltqieuu pertltqieuu
pertltquiue pertltquieu pertltquuie pertltquuei pertltqueui pertltqueiu pertltqeiuu pertltqeiuu pertltqeuiu pertltqeuui
pertltqeuui pertltqeuiu pertltuuqie pertltuuqei pertltuuiqe pertltuuieq pertltuueiq pertltuueqi pertltuquie pertltuquei
pertltuqiue pertltuqieu pertltuqeiu pertltuqeui pertltuique pertltuiqeu pertltuiuqe pertltuiueq pertltuieuq pertltuiequ
pertltueqiu pertltuequi pertltueiqu pertltueiuq pertltueuiq pertltueuqi pertlteuqui pertlteuqiu pertlteuuqi pertlteuuiq
pertlteuiuq pertlteuiqu pertltequui pertltequiu pertltequui pertltequiu pertlteqiuu pertlteqiuu pertlteuqui pertlteuqiu
pertlteuuqi pertlteuuiq pertlteuiuq pertlteuiqu pertlteiquu pertlteiquu pertlteiuqu pertlteiuuq pertlteiuuq pertlteiuqu
pertlqituue pertlqitueu pertlqituue pertlqitueu pertlqiteuu pertlqiteuu pertlqiutue pertlqiuteu pertlqiuute pertlqiuuet
pertlqiueut pertlqiuetu pertlqiuute pertlqiuuet pertlqiutue pertlqiuteu pertlqiuetu pertlqiueut pertlqieuut pertlqieutu
pertlqieuut pertlqieutu pertlqietuu pertlqietuu pertlqtiuue pertlqtiueu pertlqtiuue pertlqtiueu pertlqtieuu pertlqtieuu
pertlqtuiue pertlqtuieu pertlqtuuie pertlqtuuei pertlqtueui pertlqtueiu pertlqtuuie pertlqtuuei pertlqtuiue pertlqtuieu
pertlqtueiu pertlqtueui pertlqteuui pertlqteuiu pertlqteuui pertlqteuiu pertlqteiuu pertlqteiuu pertlqutiue pertlqutieu
pertlqutuie pertlqutuei pertlquteui pertlquteiu pertlquitue pertlquiteu pertlquiute pertlquiuet pertlquieut pertlquietu
pertlquuite pertlquuiet pertlquutie pertlquutei pertlquueti pertlquueit pertlqueiut pertlqueitu pertlqueuit pertlqueuti
pertlquetui pertlquetiu pertlqutuie pertlqutuei pertlqutiue pertlqutieu pertlquteiu pertlquteui pertlquutie pertlquutei
pertlquuite pertlquuiet pertlquueit pertlquueti pertlquiute pertlquiuet pertlquitue pertlquiteu pertlquietu pertlquieut
pertlqueuit pertlqueuti pertlqueiut pertlqueitu pertlquetiu pertlquetui pertlqetuui pertlqetuiu pertlqetuui pertlqetuiu
pertlqetiuu pertlqetiuu pertlqeutui pertlqeutiu pertlqeuuti pertlqeuuit pertlqeuiut pertlqeuitu pertlqeuuti pertlqeuuit
pertlqeutui pertlqeutiu pertlqeuitu pertlqeuiut pertlqeiuut pertlqeiutu pertlqeiuut pertlqeiutu pertlqeituu pertlqeituu
pertluitque pertluitqeu pertluituqe pertluitueq pertluiteuq pertluitequ pertluiqtue pertluiqteu pertluiqute pertluiquet
pertluiqeut pertluiqetu pertluiuqte pertluiuqet pertluiutqe pertluiuteq pertluiuetq pertluiueqt pertluiequt pertluieqtu
pertluieuqt pertluieutq pertluietuq pertluietqu pertlutique pertlutiqeu pertlutiuqe pertlutiueq pertlutieuq pertlutiequ
pertlutqiue pertlutqieu pertlutquie pertlutquei pertlutqeui pertlutqeiu pertlutuqie pertlutuqei pertlutuiqe pertlutuieq
pertlutueiq pertlutueqi pertlutequi pertluteqiu pertluteuqi pertluteuiq pertluteiuq pertluteiqu pertluqtiue pertluqtieu
pertluqtuie pertluqtuei pertluqteui pertluqteiu pertluqitue pertluqiteu pertluqiute pertluqiuet pertluqieut pertluqietu
pertluquite pertluquiet pertluqutie pertluqutei pertluqueti pertluqueit pertluqeiut pertluqeitu pertluqeuit pertluqeuti
pertluqetui pertluqetiu pertluutqie pertluutqei pertluutiqe pertluutieq pertluuteiq pertluuteqi pertluuqtie pertluuqtei
pertluuqite pertluuqiet pertluuqeit pertluuqeti pertluuiqte pertluuiqet pertluuitqe pertluuiteq pertluuietq pertluuieqt
pertluueqit pertluueqti pertluueiqt pertluueitq pertluuetiq pertluuetqi pertluetqui pertluetqiu pertluetuqi pertluetuiq
pertluetiuq pertluetiqu pertlueqtui pertlueqtiu pertluequti pertluequit pertlueqiut pertlueqitu pertlueuqti pertlueuqit
pertlueutqi pertlueutiq pertlueuitq pertlueuiqt pertlueiqut pertlueiqtu pertlueiuqt pertlueiutq pertlueituq pertlueitqu
pertleitquu pertleitquu pertleituqu pertleituuq pertleituuq pertleituqu pertleiqtuu pertleiqtuu pertleiqutu pertleiquut
pertleiquut pertleiqutu pertleiuqtu pertleiuqut pertleiutqu pertleiutuq pertleiuutq pertleiuuqt pertleiuqut pertleiuqtu
pertleiuuqt pertleiuutq pertleiutuq pertleiutqu pertletiquu pertletiquu pertletiuqu pertletiuuq pertletiuuq pertletiuqu
pertletqiuu pertletqiuu pertletquiu pertletquui pertletquui pertletquiu pertletuqiu pertletuqui pertletuiqu pertletuiuq
pertletuuiq pertletuuqi pertletuqui pertletuqiu pertletuuqi pertletuuiq pertletuiuq pertletuiqu pertleqtiuu pertleqtiuu
pertleqtuiu pertleqtuui pertleqtuui pertleqtuiu pertleqituu pertleqituu pertleqiutu pertleqiuut pertleqiuut pertleqiutu
pertlequitu pertlequiut pertlequtiu pertlequtui pertlequuti pertlequuit pertlequiut pertlequitu pertlequuit pertlequuti
pertlequtui pertlequtiu pertleutqiu pertleutqui pertleutiqu pertleutiuq pertleutuiq pertleutuqi pertleuqtiu pertleuqtui
pertleuqitu pertleuqiut pertleuquit pertleuquti pertleuiqtu pertleuiqut pertleuitqu pertleuituq pertleuiutq pertleuiuqt
pertleuuqit pertleuuqti pertleuuiqt pertleuuitq pertleuutiq pertleuutqi pertleutqui pertleutqiu pertleutuqi pertleutuiq
pertleutiuq pertleutiqu pertleuqtui pertleuqtiu pertleuquti pertleuquit pertleuqiut pertleuqitu pertleuuqti pertleuuqit
pertleuutqi pertleuutiq pertleuuitq pertleuuiqt pertleuiqut pertleuiqtu pertleuiuqt pertleuiutq pertleuituq pertleuitqu
pertilutque pertilutqeu pertilutuqe pertilutueq pertiluteuq pertilutequ pertiluqtue pertiluqteu pertiluqute pertiluquet
pertiluqeut pertiluqetu pertiluuqte pertiluuqet pertiluutqe pertiluuteq pertiluuetq pertiluueqt pertiluequt pertilueqtu
pertilueuqt pertilueutq pertiluetuq pertiluetqu pertiltuque pertiltuqeu pertiltuuqe pertiltuueq pertiltueuq pertiltuequ
pertiltquue pertiltqueu pertiltquue pertiltqueu pertiltqeuu pertiltqeuu pertiltuque pertiltuqeu pertiltuuqe pertiltuueq
pertiltueuq pertiltuequ pertiltequu pertiltequu pertilteuqu pertilteuuq pertilteuuq pertilteuqu pertilqtuue pertilqtueu
pertilqtuue pertilqtueu pertilqteuu pertilqteuu pertilqutue pertilquteu pertilquute pertilquuet pertilqueut pertilquetu
pertilquute pertilquuet pertilqutue pertilquteu pertilquetu pertilqueut pertilqeuut pertilqeutu pertilqeuut pertilqeutu
pertilqetuu pertilqetuu pertilutque pertilutqeu pertilutuqe pertilutueq pertiluteuq pertilutequ pertiluqtue pertiluqteu
pertiluqute pertiluquet pertiluqeut pertiluqetu pertiluuqte pertiluuqet pertiluutqe pertiluuteq pertiluuetq pertiluueqt
pertiluequt pertilueqtu pertilueuqt pertilueutq pertiluetuq pertiluetqu pertiletquu pertiletquu pertiletuqu pertiletuuq
pertiletuuq pertiletuqu pertileqtuu pertileqtuu pertilequtu pertilequut pertilequut pertilequtu pertileuqtu pertileuqut
pertileutqu pertileutuq pertileuutq pertileuuqt pertileuqut pertileuqtu pertileuuqt pertileuutq pertileutuq pertileutqu
pertiultque pertiultqeu pertiultuqe pertiultueq pertiulteuq pertiultequ pertiulqtue pertiulqteu pertiulqute pertiulquet
pertiulqeut pertiulqetu pertiuluqte pertiuluqet pertiulutqe pertiuluteq pertiuluetq pertiulueqt pertiulequt pertiuleqtu
pertiuleuqt pertiuleutq pertiuletuq pertiuletqu pertiutlque pertiutlqeu pertiutluqe pertiutlueq pertiutleuq pertiutlequ
pertiutqlue pertiutqleu pertiutqule pertiutquel pertiutqeul pertiutqelu pertiutuqle pertiutuqel pertiutulqe pertiutuleq
pertiutuelq pertiutueql pertiutequl pertiuteqlu pertiuteuql pertiuteulq pertiuteluq pertiutelqu pertiuqtlue pertiuqtleu
pertiuqtule pertiuqtuel pertiuqteul pertiuqtelu pertiuqltue pertiuqlteu pertiuqlute pertiuqluet pertiuqleut pertiuqletu
pertiuqulte pertiuqulet pertiuqutle pertiuqutel pertiuquetl pertiuquelt pertiuqelut pertiuqeltu pertiuqeult pertiuqeutl
pertiuqetul pertiuqetlu pertiuutqle pertiuutqel pertiuutlqe pertiuutleq pertiuutelq pertiuuteql pertiuuqtle pertiuuqtel
pertiuuqlte pertiuuqlet pertiuuqelt pertiuuqetl pertiuulqte pertiuulqet pertiuultqe pertiuulteq pertiuuletq pertiuuleqt
pertiuueqlt pertiuueqtl pertiuuelqt pertiuueltq pertiuuetlq pertiuuetql pertiuetqul pertiuetqlu pertiuetuql pertiuetulq
pertiuetluq pertiuetlqu pertiueqtul pertiueqtlu pertiuequtl pertiueqult pertiueqlut pertiueqltu pertiueuqtl pertiueuqlt
pertiueutql pertiueutlq pertiueultq pertiueulqt pertiuelqut pertiuelqtu pertiueluqt pertiuelutq pertiueltuq pertiueltqu
pertitulque pertitulqeu pertituluqe pertitulueq pertituleuq pertitulequ pertituqlue pertituqleu pertituqule pertituquel
pertituqeul pertituqelu pertituuqle pertituuqel pertituulqe pertituuleq pertituuelq pertituueql pertituequl pertitueqlu
pertitueuql pertitueulq pertitueluq pertituelqu pertitluque pertitluqeu pertitluuqe pertitluueq pertitlueuq pertitluequ
pertitlquue pertitlqueu pertitlquue pertitlqueu pertitlqeuu pertitlqeuu pertitluque pertitluqeu pertitluuqe pertitluueq
pertitlueuq pertitluequ pertitlequu pertitlequu pertitleuqu pertitleuuq pertitleuuq pertitleuqu pertitqluue pertitqlueu
pertitqluue pertitqlueu pertitqleuu pertitqleuu pertitqulue pertitquleu pertitquule pertitquuel pertitqueul pertitquelu
pertitquule pertitquuel pertitqulue pertitquleu pertitquelu pertitqueul pertitqeuul pertitqeulu pertitqeuul pertitqeulu
pertitqeluu pertitqeluu pertitulque pertitulqeu pertituluqe pertitulueq pertituleuq pertitulequ pertituqlue pertituqleu
pertituqule pertituquel pertituqeul pertituqelu pertituuqle pertituuqel pertituulqe pertituuleq pertituuelq pertituueql
pertituequl pertitueqlu pertitueuql pertitueulq pertitueluq pertituelqu pertitelquu pertitelquu pertiteluqu pertiteluuq
pertiteluuq pertiteluqu pertiteqluu pertiteqluu pertitequlu pertitequul pertitequul pertitequlu pertiteuqlu pertiteuqul
pertiteulqu pertiteuluq pertiteuulq pertiteuuql pertiteuqul pertiteuqlu pertiteuuql pertiteuulq pertiteuluq pertiteulqu
pertiqutlue pertiqutleu pertiqutule pertiqutuel pertiquteul pertiqutelu pertiqultue pertiqulteu pertiqulute pertiquluet
pertiquleut pertiquletu pertiquulte pertiquulet pertiquutle pertiquutel pertiquuetl pertiquuelt pertiquelut pertiqueltu
pertiqueult pertiqueutl pertiquetul pertiquetlu pertiqtulue pertiqtuleu pertiqtuule pertiqtuuel pertiqtueul pertiqtuelu
pertiqtluue pertiqtlueu pertiqtluue pertiqtlueu pertiqtleuu pertiqtleuu pertiqtulue pertiqtuleu pertiqtuule pertiqtuuel
pertiqtueul pertiqtuelu pertiqteluu pertiqteluu pertiqteulu pertiqteuul pertiqteuul pertiqteulu pertiqltuue pertiqltueu
pertiqltuue pertiqltueu pertiqlteuu pertiqlteuu pertiqlutue pertiqluteu pertiqluute pertiqluuet pertiqlueut pertiqluetu
pertiqluute pertiqluuet pertiqlutue pertiqluteu pertiqluetu pertiqlueut pertiqleuut pertiqleutu pertiqleuut pertiqleutu
pertiqletuu pertiqletuu pertiqutlue pertiqutleu pertiqutule pertiqutuel pertiquteul pertiqutelu pertiqultue pertiqulteu
pertiqulute pertiquluet pertiquleut pertiquletu pertiquulte pertiquulet pertiquutle pertiquutel pertiquuetl pertiquuelt
pertiquelut pertiqueltu pertiqueult pertiqueutl pertiquetul pertiquetlu pertiqetluu pertiqetluu pertiqetulu pertiqetuul
pertiqetuul pertiqetulu pertiqeltuu pertiqeltuu pertiqelutu pertiqeluut pertiqeluut pertiqelutu pertiqeultu pertiqeulut
pertiqeutlu pertiqeutul pertiqeuutl pertiqeuult pertiqeulut pertiqeultu pertiqeuult pertiqeuutl pertiqeutul pertiqeutlu
pertiuutqle pertiuutqel pertiuutlqe pertiuutleq pertiuutelq pertiuuteql pertiuuqtle pertiuuqtel pertiuuqlte pertiuuqlet
pertiuuqelt pertiuuqetl pertiuulqte pertiuulqet pertiuultqe pertiuulteq pertiuuletq pertiuuleqt pertiuueqlt pertiuueqtl
pertiuuelqt pertiuueltq pertiuuetlq pertiuuetql pertiutuqle pertiutuqel pertiutulqe pertiutuleq pertiutuelq pertiutueql
pertiutqule pertiutquel pertiutqlue pertiutqleu pertiutqelu pertiutqeul pertiutlque pertiutlqeu pertiutluqe pertiutlueq
pertiutleuq pertiutlequ pertiuteqlu pertiutequl pertiutelqu pertiuteluq pertiuteulq pertiuteuql pertiuqtule pertiuqtuel
pertiuqtlue pertiuqtleu pertiuqtelu pertiuqteul pertiuqutle pertiuqutel pertiuqulte pertiuqulet pertiuquelt pertiuquetl
pertiuqlute pertiuqluet pertiuqltue pertiuqlteu pertiuqletu pertiuqleut pertiuqeult pertiuqeutl pertiuqelut pertiuqeltu
pertiuqetlu pertiuqetul pertiultque pertiultqeu pertiultuqe pertiultueq pertiulteuq pertiultequ pertiulqtue pertiulqteu
pertiulqute pertiulquet pertiulqeut pertiulqetu pertiuluqte pertiuluqet pertiulutqe pertiuluteq pertiuluetq pertiulueqt
pertiulequt pertiuleqtu pertiuleuqt pertiuleutq pertiuletuq pertiuletqu pertiuetqlu pertiuetqul pertiuetlqu pertiuetluq
pertiuetulq pertiuetuql pertiueqtlu pertiueqtul pertiueqltu pertiueqlut pertiueqult pertiuequtl pertiuelqtu pertiuelqut
pertiueltqu pertiueltuq pertiuelutq pertiueluqt pertiueuqlt pertiueuqtl pertiueulqt pertiueultq pertiueutlq pertiueutql
pertieutqul pertieutqlu pertieutuql pertieutulq pertieutluq pertieutlqu pertieuqtul pertieuqtlu pertieuqutl pertieuqult
pertieuqlut pertieuqltu pertieuuqtl pertieuuqlt pertieuutql pertieuutlq pertieuultq pertieuulqt pertieulqut pertieulqtu
pertieuluqt pertieulutq pertieultuq pertieultqu pertietuqul pertietuqlu pertietuuql pertietuulq pertietuluq pertietulqu
pertietquul pertietqulu pertietquul pertietqulu pertietqluu pertietqluu pertietuqul pertietuqlu pertietuuql pertietuulq
pertietuluq pertietulqu pertietlquu pertietlquu pertietluqu pertietluuq pertietluuq pertietluqu pertieqtuul pertieqtulu
pertieqtuul pertieqtulu pertieqtluu pertieqtluu pertiequtul pertiequtlu pertiequutl pertiequult pertiequlut pertiequltu
pertiequutl pertiequult pertiequtul pertiequtlu pertiequltu pertiequlut pertieqluut pertieqlutu pertieqluut pertieqlutu
pertieqltuu pertieqltuu pertieutqul pertieutqlu pertieutuql pertieutulq pertieutluq pertieutlqu pertieuqtul pertieuqtlu
pertieuqutl pertieuqult pertieuqlut pertieuqltu pertieuuqtl pertieuuqlt pertieuutql pertieuutlq pertieuultq pertieuulqt
pertieulqut pertieulqtu pertieuluqt pertieulutq pertieultuq pertieultqu pertieltquu pertieltquu pertieltuqu pertieltuuq
pertieltuuq pertieltuqu pertielqtuu pertielqtuu pertielqutu pertielquut pertielquut pertielqutu pertieluqtu pertieluqut
pertielutqu pertielutuq pertieluutq pertieluuqt pertieluqut pertieluqtu pertieluuqt pertieluutq pertielutuq pertielutqu
perttliuque perttliuqeu perttliuuqe perttliuueq perttliueuq perttliuequ perttliquue perttliqueu perttliquue perttliqueu
perttliqeuu perttliqeuu perttliuque perttliuqeu perttliuuqe perttliuueq perttliueuq perttliuequ perttliequu perttliequu
perttlieuqu perttlieuuq perttlieuuq perttlieuqu perttluique perttluiqeu perttluiuqe perttluiueq perttluieuq perttluiequ
perttluqiue perttluqieu perttluquie perttluquei perttluqeui perttluqeiu perttluuqie perttluuqei perttluuiqe perttluuieq
perttluueiq perttluueqi perttluequi perttlueqiu perttlueuqi perttlueuiq perttlueiuq perttlueiqu perttlquiue perttlquieu
perttlquuie perttlquuei perttlqueui perttlqueiu perttlqiuue perttlqiueu perttlqiuue perttlqiueu perttlqieuu perttlqieuu
perttlquiue perttlquieu perttlquuie perttlquuei perttlqueui perttlqueiu perttlqeiuu perttlqeiuu perttlqeuiu perttlqeuui
perttlqeuui perttlqeuiu perttluuqie perttluuqei perttluuiqe perttluuieq perttluueiq perttluueqi perttluquie perttluquei
perttluqiue perttluqieu perttluqeiu perttluqeui perttluique perttluiqeu perttluiuqe perttluiueq perttluieuq perttluiequ
perttlueqiu perttluequi perttlueiqu perttlueiuq perttlueuiq perttlueuqi perttleuqui perttleuqiu perttleuuqi perttleuuiq
perttleuiuq perttleuiqu perttlequui perttlequiu perttlequui perttlequiu perttleqiuu perttleqiuu perttleuqui perttleuqiu
perttleuuqi perttleuuiq perttleuiuq perttleuiqu perttleiquu perttleiquu perttleiuqu perttleiuuq perttleiuuq perttleiuqu
perttiluque perttiluqeu perttiluuqe perttiluueq perttilueuq perttiluequ perttilquue perttilqueu perttilquue perttilqueu
perttilqeuu perttilqeuu perttiluque perttiluqeu perttiluuqe perttiluueq perttilueuq perttiluequ perttilequu perttilequu
perttileuqu perttileuuq perttileuuq perttileuqu perttiulque perttiulqeu perttiuluqe perttiulueq perttiuleuq perttiulequ
perttiuqlue perttiuqleu perttiuqule perttiuquel perttiuqeul perttiuqelu perttiuuqle perttiuuqel perttiuulqe perttiuuleq
perttiuuelq perttiuueql perttiuequl perttiueqlu perttiueuql perttiueulq perttiueluq perttiuelqu perttiqulue perttiquleu
perttiquule perttiquuel perttiqueul perttiquelu perttiqluue perttiqlueu perttiqluue perttiqlueu perttiqleuu perttiqleuu
perttiqulue perttiquleu perttiquule perttiquuel perttiqueul perttiquelu perttiqeluu perttiqeluu perttiqeulu perttiqeuul
perttiqeuul perttiqeulu perttiuuqle perttiuuqel perttiuulqe perttiuuleq perttiuuelq perttiuueql perttiuqule perttiuquel
perttiuqlue perttiuqleu perttiuqelu perttiuqeul perttiulque perttiulqeu perttiuluqe perttiulueq perttiuleuq perttiulequ
perttiueqlu perttiuequl perttiuelqu perttiueluq perttiueulq perttiueuql perttieuqul perttieuqlu perttieuuql perttieuulq
perttieuluq perttieulqu perttiequul perttiequlu perttiequul perttiequlu perttieqluu perttieqluu perttieuqul perttieuqlu
perttieuuql perttieuulq perttieuluq perttieulqu perttielquu perttielquu perttieluqu perttieluuq perttieluuq perttieluqu
perttuilque perttuilqeu perttuiluqe perttuilueq perttuileuq perttuilequ perttuiqlue perttuiqleu perttuiqule perttuiquel
perttuiqeul perttuiqelu perttuiuqle perttuiuqel perttuiulqe perttuiuleq perttuiuelq perttuiueql perttuiequl perttuieqlu
perttuieuql perttuieulq perttuieluq perttuielqu perttulique perttuliqeu perttuliuqe perttuliueq perttulieuq perttuliequ
perttulqiue perttulqieu perttulquie perttulquei perttulqeui perttulqeiu perttuluqie perttuluqei perttuluiqe perttuluieq
perttulueiq perttulueqi perttulequi perttuleqiu perttuleuqi perttuleuiq perttuleiuq perttuleiqu perttuqliue perttuqlieu
perttuqluie perttuqluei perttuqleui perttuqleiu perttuqilue perttuqileu perttuqiule perttuqiuel perttuqieul perttuqielu
perttuquile perttuquiel perttuqulie perttuqulei perttuqueli perttuqueil perttuqeiul perttuqeilu perttuqeuil perttuqeuli
perttuqelui perttuqeliu perttuulqie perttuulqei perttuuliqe perttuulieq perttuuleiq perttuuleqi perttuuqlie perttuuqlei
perttuuqile perttuuqiel perttuuqeil perttuuqeli perttuuiqle perttuuiqel perttuuilqe perttuuileq perttuuielq perttuuieql
perttuueqil perttuueqli perttuueiql perttuueilq perttuueliq perttuuelqi perttuelqui perttuelqiu perttueluqi perttueluiq
perttueliuq perttueliqu perttueqlui perttueqliu perttuequli perttuequil perttueqiul perttueqilu perttueuqli perttueuqil
perttueulqi perttueuliq perttueuilq perttueuiql perttueiqul perttueiqlu perttueiuql perttueiulq perttueiluq perttueilqu
perttqiulue perttqiuleu perttqiuule perttqiuuel perttqiueul perttqiuelu perttqiluue perttqilueu perttqiluue perttqilueu
perttqileuu perttqileuu perttqiulue perttqiuleu perttqiuule perttqiuuel perttqiueul perttqiuelu perttqieluu perttqieluu
perttqieulu perttqieuul perttqieuul perttqieulu perttquilue perttquileu perttquiule perttquiuel perttquieul perttquielu
perttquliue perttqulieu perttquluie perttquluei perttquleui perttquleiu perttquulie perttquulei perttquuile perttquuiel
perttquueil perttquueli perttquelui perttqueliu perttqueuli perttqueuil perttqueiul perttqueilu perttqluiue perttqluieu
perttqluuie perttqluuei perttqlueui perttqlueiu perttqliuue perttqliueu perttqliuue perttqliueu perttqlieuu perttqlieuu
perttqluiue perttqluieu perttqluuie perttqluuei perttqlueui perttqlueiu perttqleiuu perttqleiuu perttqleuiu perttqleuui
perttqleuui perttqleuiu perttquulie perttquulei perttquuile perttquuiel perttquueil perttquueli perttquluie perttquluei
perttquliue perttqulieu perttquleiu perttquleui perttquilue perttquileu perttquiule perttquiuel perttquieul perttquielu
perttqueliu perttquelui perttqueilu perttqueiul perttqueuil perttqueuli perttqeului perttqeuliu perttqeuuli perttqeuuil
perttqeuiul perttqeuilu perttqeluui perttqeluiu perttqeluui perttqeluiu perttqeliuu perttqeliuu perttqeului perttqeuliu
perttqeuuli perttqeuuil perttqeuiul perttqeuilu perttqeiluu perttqeiluu perttqeiulu perttqeiuul perttqeiuul perttqeiulu
perttuiuqle perttuiuqel perttuiulqe perttuiuleq perttuiuelq perttuiueql perttuiqule perttuiquel perttuiqlue perttuiqleu
perttuiqelu perttuiqeul perttuilque perttuilqeu perttuiluqe perttuilueq perttuileuq perttuilequ perttuieqlu perttuiequl
perttuielqu perttuieluq perttuieulq perttuieuql perttuuiqle perttuuiqel perttuuilqe perttuuileq perttuuielq perttuuieql
perttuuqile perttuuqiel perttuuqlie perttuuqlei perttuuqeli perttuuqeil perttuulqie perttuulqei perttuuliqe perttuulieq
perttuuleiq perttuuleqi perttuueqli perttuueqil perttuuelqi perttuueliq perttuueilq perttuueiql perttuquile perttuquiel
perttuqulie perttuqulei perttuqueli perttuqueil perttuqiule perttuqiuel perttuqilue perttuqileu perttuqielu perttuqieul
perttuqliue perttuqlieu perttuqluie perttuqluei perttuqleui perttuqleiu perttuqeilu perttuqeiul perttuqeliu perttuqelui
perttuqeuli perttuqeuil perttuluqie perttuluqei perttuluiqe perttuluieq perttulueiq perttulueqi perttulquie perttulquei
perttulqiue perttulqieu perttulqeiu perttulqeui perttulique perttuliqeu perttuliuqe perttuliueq perttulieuq perttuliequ
perttuleqiu perttulequi perttuleiqu perttuleiuq perttuleuiq perttuleuqi perttueuqli perttueuqil perttueulqi perttueuliq
perttueuilq perttueuiql perttuequli perttuequil perttueqlui perttueqliu perttueqilu perttueqiul perttuelqui perttuelqiu
perttueluqi perttueluiq perttueliuq perttueliqu perttueiqlu perttueiqul perttueilqu perttueiluq perttueiulq perttueiuql
pertteiuqul pertteiuqlu pertteiuuql pertteiuulq pertteiuluq pertteiulqu pertteiquul pertteiqulu pertteiquul pertteiqulu
pertteiqluu pertteiqluu pertteiuqul pertteiuqlu pertteiuuql pertteiuulq pertteiuluq pertteiulqu pertteilquu pertteilquu
pertteiluqu pertteiluuq pertteiluuq pertteiluqu pertteuiqul pertteuiqlu pertteuiuql pertteuiulq pertteuiluq pertteuilqu
pertteuqiul pertteuqilu pertteuquil pertteuquli pertteuqlui pertteuqliu pertteuuqil pertteuuqli pertteuuiql pertteuuilq
pertteuuliq pertteuulqi pertteulqui pertteulqiu pertteuluqi pertteuluiq pertteuliuq pertteuliqu perttequiul perttequilu
perttequuil perttequuli pertteqului perttequliu pertteqiuul pertteqiulu pertteqiuul pertteqiulu pertteqiluu pertteqiluu
perttequiul perttequilu perttequuil perttequuli pertteqului perttequliu pertteqliuu pertteqliuu pertteqluiu pertteqluui
pertteqluui pertteqluiu pertteuuqil pertteuuqli pertteuuiql pertteuuilq pertteuuliq pertteuulqi pertteuquil pertteuquli
pertteuqiul pertteuqilu pertteuqliu pertteuqlui pertteuiqul pertteuiqlu pertteuiuql pertteuiulq pertteuiluq pertteuilqu
pertteulqiu pertteulqui pertteuliqu pertteuliuq pertteuluiq pertteuluqi pertteluqui pertteluqiu pertteluuqi pertteluuiq
pertteluiuq pertteluiqu perttelquui perttelquiu perttelquui perttelquiu perttelqiuu perttelqiuu pertteluqui pertteluqiu
pertteluuqi pertteluuiq pertteluiuq pertteluiqu pertteliquu pertteliquu pertteliuqu pertteliuuq pertteliuuq pertteliuqu
pertqlituue pertqlitueu pertqlituue pertqlitueu pertqliteuu pertqliteuu pertqliutue pertqliuteu pertqliuute pertqliuuet
pertqliueut pertqliuetu pertqliuute pertqliuuet pertqliutue pertqliuteu pertqliuetu pertqliueut pertqlieuut pertqlieutu
pertqlieuut pertqlieutu pertqlietuu pertqlietuu pertqltiuue pertqltiueu pertqltiuue pertqltiueu pertqltieuu pertqltieuu
pertqltuiue pertqltuieu pertqltuuie pertqltuuei pertqltueui pertqltueiu pertqltuuie pertqltuuei pertqltuiue pertqltuieu
pertqltueiu pertqltueui pertqlteuui pertqlteuiu pertqlteuui pertqlteuiu pertqlteiuu pertqlteiuu pertqlutiue pertqlutieu
pertqlutuie pertqlutuei pertqluteui pertqluteiu pertqluitue pertqluiteu pertqluiute pertqluiuet pertqluieut pertqluietu
pertqluuite pertqluuiet pertqluutie pertqluutei pertqluueti pertqluueit pertqlueiut pertqlueitu pertqlueuit pertqlueuti
pertqluetui pertqluetiu pertqlutuie pertqlutuei pertqlutiue pertqlutieu pertqluteiu pertqluteui pertqluutie pertqluutei
pertqluuite pertqluuiet pertqluueit pertqluueti pertqluiute pertqluiuet pertqluitue pertqluiteu pertqluietu pertqluieut
pertqlueuit pertqlueuti pertqlueiut pertqlueitu pertqluetiu pertqluetui pertqletuui pertqletuiu pertqletuui pertqletuiu
pertqletiuu pertqletiuu pertqleutui pertqleutiu pertqleuuti pertqleuuit pertqleuiut pertqleuitu pertqleuuti pertqleuuit
pertqleutui pertqleutiu pertqleuitu pertqleuiut pertqleiuut pertqleiutu pertqleiuut pertqleiutu pertqleituu pertqleituu
pertqiltuue pertqiltueu pertqiltuue pertqiltueu pertqilteuu pertqilteuu pertqilutue pertqiluteu pertqiluute pertqiluuet
pertqilueut pertqiluetu pertqiluute pertqiluuet pertqilutue pertqiluteu pertqiluetu pertqilueut pertqileuut pertqileutu
pertqileuut pertqileutu pertqiletuu pertqiletuu pertqitluue pertqitlueu pertqitluue pertqitlueu pertqitleuu pertqitleuu
pertqitulue pertqituleu pertqituule pertqituuel pertqitueul pertqituelu pertqituule pertqituuel pertqitulue pertqituleu
pertqituelu pertqitueul pertqiteuul pertqiteulu pertqiteuul pertqiteulu pertqiteluu pertqiteluu pertqiutlue pertqiutleu
pertqiutule pertqiutuel pertqiuteul pertqiutelu pertqiultue pertqiulteu pertqiulute pertqiuluet pertqiuleut pertqiuletu
pertqiuulte pertqiuulet pertqiuutle pertqiuutel pertqiuuetl pertqiuuelt pertqiuelut pertqiueltu pertqiueult pertqiueutl
pertqiuetul pertqiuetlu pertqiutule pertqiutuel pertqiutlue pertqiutleu pertqiutelu pertqiuteul pertqiuutle pertqiuutel
pertqiuulte pertqiuulet pertqiuuelt pertqiuuetl pertqiulute pertqiuluet pertqiultue pertqiulteu pertqiuletu pertqiuleut
pertqiueult pertqiueutl pertqiuelut pertqiueltu pertqiuetlu pertqiuetul pertqietuul pertqietulu pertqietuul pertqietulu
pertqietluu pertqietluu pertqieutul pertqieutlu pertqieuutl pertqieuult pertqieulut pertqieultu pertqieuutl pertqieuult
pertqieutul pertqieutlu pertqieultu pertqieulut pertqieluut pertqielutu pertqieluut pertqielutu pertqieltuu pertqieltuu
pertqtiluue pertqtilueu pertqtiluue pertqtilueu pertqtileuu pertqtileuu pertqtiulue pertqtiuleu pertqtiuule pertqtiuuel
pertqtiueul pertqtiuelu pertqtiuule pertqtiuuel pertqtiulue pertqtiuleu pertqtiuelu pertqtiueul pertqtieuul pertqtieulu
pertqtieuul pertqtieulu pertqtieluu pertqtieluu pertqtliuue pertqtliueu pertqtliuue pertqtliueu pertqtlieuu pertqtlieuu
pertqtluiue pertqtluieu pertqtluuie pertqtluuei pertqtlueui pertqtlueiu pertqtluuie pertqtluuei pertqtluiue pertqtluieu
pertqtlueiu pertqtlueui pertqtleuui pertqtleuiu pertqtleuui pertqtleuiu pertqtleiuu pertqtleiuu pertqtuliue pertqtulieu
pertqtuluie pertqtuluei pertqtuleui pertqtuleiu pertqtuilue pertqtuileu pertqtuiule pertqtuiuel pertqtuieul pertqtuielu
pertqtuuile pertqtuuiel pertqtuulie pertqtuulei pertqtuueli pertqtuueil pertqtueiul pertqtueilu pertqtueuil pertqtueuli
pertqtuelui pertqtueliu pertqtuluie pertqtuluei pertqtuliue pertqtulieu pertqtuleiu pertqtuleui pertqtuulie pertqtuulei
pertqtuuile pertqtuuiel pertqtuueil pertqtuueli pertqtuiule pertqtuiuel pertqtuilue pertqtuileu pertqtuielu pertqtuieul
pertqtueuil pertqtueuli pertqtueiul pertqtueilu pertqtueliu pertqtuelui pertqteluui pertqteluiu pertqteluui pertqteluiu
pertqteliuu pertqteliuu pertqteului pertqteuliu pertqteuuli pertqteuuil pertqteuiul pertqteuilu pertqteuuli pertqteuuil
pertqteului pertqteuliu pertqteuilu pertqteuiul pertqteiuul pertqteiulu pertqteiuul pertqteiulu pertqteiluu pertqteiluu
pertquitlue pertquitleu pertquitule pertquituel pertquiteul pertquitelu pertquiltue pertquilteu pertquilute pertquiluet
pertquileut pertquiletu pertquiulte pertquiulet pertquiutle pertquiutel pertquiuetl pertquiuelt pertquielut pertquieltu
pertquieult pertquieutl pertquietul pertquietlu pertqutilue pertqutileu pertqutiule pertqutiuel pertqutieul pertqutielu
pertqutliue pertqutlieu pertqutluie pertqutluei pertqutleui pertqutleiu pertqutulie pertqutulei pertqutuile pertqutuiel
pertqutueil pertqutueli pertqutelui pertquteliu pertquteuli pertquteuil pertquteiul pertquteilu pertqultiue pertqultieu
pertqultuie pertqultuei pertqulteui pertqulteiu pertqulitue pertquliteu pertquliute pertquliuet pertqulieut pertqulietu
pertquluite pertquluiet pertqulutie pertqulutei pertqulueti pertqulueit pertquleiut pertquleitu pertquleuit pertquleuti
pertquletui pertquletiu pertquutlie pertquutlei pertquutile pertquutiel pertquuteil pertquuteli pertquultie pertquultei
pertquulite pertquuliet pertquuleit pertquuleti pertquuilte pertquuilet pertquuitle pertquuitel pertquuietl pertquuielt
pertquuelit pertquuelti pertquueilt pertquueitl pertquuetil pertquuetli pertquetlui pertquetliu pertquetuli pertquetuil
pertquetiul pertquetilu pertqueltui pertqueltiu pertqueluti pertqueluit pertqueliut pertquelitu pertqueulti pertqueulit
pertqueutli pertqueutil pertqueuitl pertqueuilt pertqueilut pertqueiltu pertqueiult pertqueiutl pertqueitul pertqueitlu
pertquitule pertquituel pertquitlue pertquitleu pertquitelu pertquiteul pertquiutle pertquiutel pertquiulte pertquiulet
pertquiuelt pertquiuetl pertquilute pertquiluet pertquiltue pertquilteu pertquiletu pertquileut pertquieult pertquieutl
pertquielut pertquieltu pertquietlu pertquietul pertqutiule pertqutiuel pertqutilue pertqutileu pertqutielu pertqutieul
pertqutuile pertqutuiel pertqutulie pertqutulei pertqutueli pertqutueil pertqutluie pertqutluei pertqutliue pertqutlieu
pertqutleiu pertqutleui pertquteuli pertquteuil pertqutelui pertquteliu pertquteilu pertquteiul pertquutile pertquutiel
pertquutlie pertquutlei pertquuteli pertquuteil pertquuitle pertquuitel pertquuilte pertquuilet pertquuielt pertquuietl
pertquulite pertquuliet pertquultie pertquultei pertquuleti pertquuleit pertquueilt pertquueitl pertquuelit pertquuelti
pertquuetli pertquuetil pertqultuie pertqultuei pertqultiue pertqultieu pertqulteiu pertqulteui pertqulutie pertqulutei
pertquluite pertquluiet pertqulueit pertqulueti pertquliute pertquliuet pertqulitue pertquliteu pertqulietu pertqulieut
pertquleuit pertquleuti pertquleiut pertquleitu pertquletiu pertquletui pertquetuli pertquetuil pertquetlui pertquetliu
pertquetilu pertquetiul pertqueutli pertqueutil pertqueulti pertqueulit pertqueuilt pertqueuitl pertqueluti pertqueluit
pertqueltui pertqueltiu pertquelitu pertqueliut pertqueiult pertqueiutl pertqueilut pertqueiltu pertqueitlu pertqueitul
pertqeituul pertqeitulu pertqeituul pertqeitulu pertqeitluu pertqeitluu pertqeiutul pertqeiutlu pertqeiuutl pertqeiuult
pertqeiulut pertqeiultu pertqeiuutl pertqeiuult pertqeiutul pertqeiutlu pertqeiultu pertqeiulut pertqeiluut pertqeilutu
pertqeiluut pertqeilutu pertqeiltuu pertqeiltuu pertqetiuul pertqetiulu pertqetiuul pertqetiulu pertqetiluu pertqetiluu
pertqetuiul pertqetuilu pertqetuuil pertqetuuli pertqetului pertqetuliu pertqetuuil pertqetuuli pertqetuiul pertqetuilu
pertqetuliu pertqetului pertqetluui pertqetluiu pertqetluui pertqetluiu pertqetliuu pertqetliuu pertqeutiul pertqeutilu
pertqeutuil pertqeutuli pertqeutlui pertqeutliu pertqeuitul pertqeuitlu pertqeuiutl pertqeuiult pertqeuilut pertqeuiltu
pertqeuuitl pertqeuuilt pertqeuutil pertqeuutli pertqeuulti pertqeuulit pertqeuliut pertqeulitu pertqeuluit pertqeuluti
pertqeultui pertqeultiu pertqeutuil pertqeutuli pertqeutiul pertqeutilu pertqeutliu pertqeutlui pertqeuutil pertqeuutli
pertqeuuitl pertqeuuilt pertqeuulit pertqeuulti pertqeuiutl pertqeuiult pertqeuitul pertqeuitlu pertqeuiltu pertqeuilut
pertqeuluit pertqeuluti pertqeuliut pertqeulitu pertqeultiu pertqeultui pertqeltuui pertqeltuiu pertqeltuui pertqeltuiu
pertqeltiuu pertqeltiuu pertqelutui pertqelutiu pertqeluuti pertqeluuit pertqeluiut pertqeluitu pertqeluuti pertqeluuit
pertqelutui pertqelutiu pertqeluitu pertqeluiut pertqeliuut pertqeliutu pertqeliuut pertqeliutu pertqelituu pertqelituu
pertulitque pertulitqeu pertulituqe pertulitueq pertuliteuq pertulitequ pertuliqtue pertuliqteu pertuliqute pertuliquet
pertuliqeut pertuliqetu pertuliuqte pertuliuqet pertuliutqe pertuliuteq pertuliuetq pertuliueqt pertuliequt pertulieqtu
pertulieuqt pertulieutq pertulietuq pertulietqu pertultique pertultiqeu pertultiuqe pertultiueq pertultieuq pertultiequ
pertultqiue pertultqieu pertultquie pertultquei pertultqeui pertultqeiu pertultuqie pertultuqei pertultuiqe pertultuieq
pertultueiq pertultueqi pertultequi pertulteqiu pertulteuqi pertulteuiq pertulteiuq pertulteiqu pertulqtiue pertulqtieu
pertulqtuie pertulqtuei pertulqteui pertulqteiu pertulqitue pertulqiteu pertulqiute pertulqiuet pertulqieut pertulqietu
pertulquite pertulquiet pertulqutie pertulqutei pertulqueti pertulqueit pertulqeiut pertulqeitu pertulqeuit pertulqeuti
pertulqetui pertulqetiu pertulutqie pertulutqei pertulutiqe pertulutieq pertuluteiq pertuluteqi pertuluqtie pertuluqtei
pertuluqite pertuluqiet pertuluqeit pertuluqeti pertuluiqte pertuluiqet pertuluitqe pertuluiteq pertuluietq pertuluieqt
pertulueqit pertulueqti pertulueiqt pertulueitq pertuluetiq pertuluetqi pertuletqui pertuletqiu pertuletuqi pertuletuiq
pertuletiuq pertuletiqu pertuleqtui pertuleqtiu pertulequti pertulequit pertuleqiut pertuleqitu pertuleuqti pertuleuqit
pertuleutqi pertuleutiq pertuleuitq pertuleuiqt pertuleiqut pertuleiqtu pertuleiuqt pertuleiutq pertuleituq pertuleitqu
pertuiltque pertuiltqeu pertuiltuqe pertuiltueq pertuilteuq pertuiltequ pertuilqtue pertuilqteu pertuilqute pertuilquet
pertuilqeut pertuilqetu pertuiluqte pertuiluqet pertuilutqe pertuiluteq pertuiluetq pertuilueqt pertuilequt pertuileqtu
pertuileuqt pertuileutq pertuiletuq pertuiletqu pertuitlque pertuitlqeu pertuitluqe pertuitlueq pertuitleuq pertuitlequ
pertuitqlue pertuitqleu pertuitqule pertuitquel pertuitqeul pertuitqelu pertuituqle pertuituqel pertuitulqe pertuituleq
pertuituelq pertuitueql pertuitequl pertuiteqlu pertuiteuql pertuiteulq pertuiteluq pertuitelqu pertuiqtlue pertuiqtleu
pertuiqtule pertuiqtuel pertuiqteul pertuiqtelu pertuiqltue pertuiqlteu pertuiqlute pertuiqluet pertuiqleut pertuiqletu
pertuiqulte pertuiqulet pertuiqutle pertuiqutel pertuiquetl pertuiquelt pertuiqelut pertuiqeltu pertuiqeult pertuiqeutl
pertuiqetul pertuiqetlu pertuiutqle pertuiutqel pertuiutlqe pertuiutleq pertuiutelq pertuiuteql pertuiuqtle pertuiuqtel
pertuiuqlte pertuiuqlet pertuiuqelt pertuiuqetl pertuiulqte pertuiulqet pertuiultqe pertuiulteq pertuiuletq pertuiuleqt
pertuiueqlt pertuiueqtl pertuiuelqt pertuiueltq pertuiuetlq pertuiuetql pertuietqul pertuietqlu pertuietuql pertuietulq
pertuietluq pertuietlqu pertuieqtul pertuieqtlu pertuiequtl pertuieqult pertuieqlut pertuieqltu pertuieuqtl pertuieuqlt
pertuieutql pertuieutlq pertuieultq pertuieulqt pertuielqut pertuielqtu pertuieluqt pertuielutq pertuieltuq pertuieltqu
pertutilque pertutilqeu pertutiluqe pertutilueq pertutileuq pertutilequ pertutiqlue pertutiqleu pertutiqule pertutiquel
pertutiqeul pertutiqelu pertutiuqle pertutiuqel pertutiulqe pertutiuleq pertutiuelq pertutiueql pertutiequl pertutieqlu
pertutieuql pertutieulq pertutieluq pertutielqu pertutlique pertutliqeu pertutliuqe pertutliueq pertutlieuq pertutliequ
pertutlqiue pertutlqieu pertutlquie pertutlquei pertutlqeui pertutlqeiu pertutluqie pertutluqei pertutluiqe pertutluieq
pertutlueiq pertutlueqi pertutlequi pertutleqiu pertutleuqi pertutleuiq pertutleiuq pertutleiqu pertutqliue pertutqlieu
pertutqluie pertutqluei pertutqleui pertutqleiu pertutqilue pertutqileu pertutqiule pertutqiuel pertutqieul pertutqielu
pertutquile pertutquiel pertutqulie pertutqulei pertutqueli pertutqueil pertutqeiul pertutqeilu pertutqeuil pertutqeuli
pertutqelui pertutqeliu pertutulqie pertutulqei pertutuliqe pertutulieq pertutuleiq pertutuleqi pertutuqlie pertutuqlei
pertutuqile pertutuqiel pertutuqeil pertutuqeli pertutuiqle pertutuiqel pertutuilqe pertutuileq pertutuielq pertutuieql
pertutueqil pertutueqli pertutueiql pertutueilq pertutueliq pertutuelqi pertutelqui pertutelqiu pertuteluqi pertuteluiq
pertuteliuq pertuteliqu pertuteqlui pertuteqliu pertutequli pertutequil pertuteqiul pertuteqilu pertuteuqli pertuteuqil
pertuteulqi pertuteuliq pertuteuilq pertuteuiql pertuteiqul pertuteiqlu pertuteiuql pertuteiulq pertuteiluq pertuteilqu
pertuqitlue pertuqitleu pertuqitule pertuqituel pertuqiteul pertuqitelu pertuqiltue pertuqilteu pertuqilute pertuqiluet
pertuqileut pertuqiletu pertuqiulte pertuqiulet pertuqiutle pertuqiutel pertuqiuetl pertuqiuelt pertuqielut pertuqieltu
pertuqieult pertuqieutl pertuqietul pertuqietlu pertuqtilue pertuqtileu pertuqtiule pertuqtiuel pertuqtieul pertuqtielu
pertuqtliue pertuqtlieu pertuqtluie pertuqtluei pertuqtleui pertuqtleiu pertuqtulie pertuqtulei pertuqtuile pertuqtuiel
pertuqtueil pertuqtueli pertuqtelui pertuqteliu pertuqteuli pertuqteuil pertuqteiul pertuqteilu pertuqltiue pertuqltieu
pertuqltuie pertuqltuei pertuqlteui pertuqlteiu pertuqlitue pertuqliteu pertuqliute pertuqliuet pertuqlieut pertuqlietu
pertuqluite pertuqluiet pertuqlutie pertuqlutei pertuqlueti pertuqlueit pertuqleiut pertuqleitu pertuqleuit pertuqleuti
pertuqletui pertuqletiu pertuqutlie pertuqutlei pertuqutile pertuqutiel pertuquteil pertuquteli pertuqultie pertuqultei
pertuqulite pertuquliet pertuquleit pertuquleti pertuquilte pertuquilet pertuquitle pertuquitel pertuquietl pertuquielt
pertuquelit pertuquelti pertuqueilt pertuqueitl pertuquetil pertuquetli pertuqetlui pertuqetliu pertuqetuli pertuqetuil
pertuqetiul pertuqetilu pertuqeltui pertuqeltiu pertuqeluti pertuqeluit pertuqeliut pertuqelitu pertuqeulti pertuqeulit
pertuqeutli pertuqeutil pertuqeuitl pertuqeuilt pertuqeilut pertuqeiltu pertuqeiult pertuqeiutl pertuqeitul pertuqeitlu
pertuuitqle pertuuitqel pertuuitlqe pertuuitleq pertuuitelq pertuuiteql pertuuiqtle pertuuiqtel pertuuiqlte pertuuiqlet
pertuuiqelt pertuuiqetl pertuuilqte pertuuilqet pertuuiltqe pertuuilteq pertuuiletq pertuuileqt pertuuieqlt pertuuieqtl
pertuuielqt pertuuieltq pertuuietlq pertuuietql pertuutiqle pertuutiqel pertuutilqe pertuutileq pertuutielq pertuutieql
pertuutqile pertuutqiel pertuutqlie pertuutqlei pertuutqeli pertuutqeil pertuutlqie pertuutlqei pertuutliqe pertuutlieq
pertuutleiq pertuutleqi pertuuteqli pertuuteqil pertuutelqi pertuuteliq pertuuteilq pertuuteiql pertuuqtile pertuuqtiel
pertuuqtlie pertuuqtlei pertuuqteli pertuuqteil pertuuqitle pertuuqitel pertuuqilte pertuuqilet pertuuqielt pertuuqietl
pertuuqlite pertuuqliet pertuuqltie pertuuqltei pertuuqleti pertuuqleit pertuuqeilt pertuuqeitl pertuuqelit pertuuqelti
pertuuqetli pertuuqetil pertuultqie pertuultqei pertuultiqe pertuultieq pertuulteiq pertuulteqi pertuulqtie pertuulqtei
pertuulqite pertuulqiet pertuulqeit pertuulqeti pertuuliqte pertuuliqet pertuulitqe pertuuliteq pertuulietq pertuulieqt
pertuuleqit pertuuleqti pertuuleiqt pertuuleitq pertuuletiq pertuuletqi pertuuetqli pertuuetqil pertuuetlqi pertuuetliq
pertuuetilq pertuuetiql pertuueqtli pertuueqtil pertuueqlti pertuueqlit pertuueqilt pertuueqitl pertuuelqti pertuuelqit
pertuueltqi pertuueltiq pertuuelitq pertuueliqt pertuueiqlt pertuueiqtl pertuueilqt pertuueiltq pertuueitlq pertuueitql
pertueitqul pertueitqlu pertueituql pertueitulq pertueitluq pertueitlqu pertueiqtul pertueiqtlu pertueiqutl pertueiqult
pertueiqlut pertueiqltu pertueiuqtl pertueiuqlt pertueiutql pertueiutlq pertueiultq pertueiulqt pertueilqut pertueilqtu
pertueiluqt pertueilutq pertueiltuq pertueiltqu pertuetiqul pertuetiqlu pertuetiuql pertuetiulq pertuetiluq pertuetilqu
pertuetqiul pertuetqilu pertuetquil pertuetquli pertuetqlui pertuetqliu pertuetuqil pertuetuqli pertuetuiql pertuetuilq
pertuetuliq pertuetulqi pertuetlqui pertuetlqiu pertuetluqi pertuetluiq pertuetliuq pertuetliqu pertueqtiul pertueqtilu
pertueqtuil pertueqtuli pertueqtlui pertueqtliu pertueqitul pertueqitlu pertueqiutl pertueqiult pertueqilut pertueqiltu
pertuequitl pertuequilt pertuequtil pertuequtli pertuequlti pertuequlit pertueqliut pertueqlitu pertueqluit pertueqluti
pertueqltui pertueqltiu pertueutqil pertueutqli pertueutiql pertueutilq pertueutliq pertueutlqi pertueuqtil pertueuqtli
pertueuqitl pertueuqilt pertueuqlit pertueuqlti pertueuiqtl pertueuiqlt pertueuitql pertueuitlq pertueuiltq pertueuilqt
pertueulqit pertueulqti pertueuliqt pertueulitq pertueultiq pertueultqi pertueltqui pertueltqiu pertueltuqi pertueltuiq
pertueltiuq pertueltiqu pertuelqtui pertuelqtiu pertuelquti pertuelquit pertuelqiut pertuelqitu pertueluqti pertueluqit
pertuelutqi pertuelutiq pertueluitq pertueluiqt pertueliqut pertueliqtu pertueliuqt pertueliutq pertuelituq pertuelitqu
pertelitquu pertelitquu pertelituqu pertelituuq pertelituuq pertelituqu perteliqtuu perteliqtuu perteliqutu perteliquut
perteliquut perteliqutu perteliuqtu perteliuqut perteliutqu perteliutuq perteliuutq perteliuuqt perteliuqut perteliuqtu
perteliuuqt perteliuutq perteliutuq perteliutqu perteltiquu perteltiquu perteltiuqu perteltiuuq perteltiuuq perteltiuqu
perteltqiuu perteltqiuu perteltquiu perteltquui perteltquui perteltquiu perteltuqiu perteltuqui perteltuiqu perteltuiuq
perteltuuiq perteltuuqi perteltuqui perteltuqiu perteltuuqi perteltuuiq perteltuiuq perteltuiqu pertelqtiuu pertelqtiuu
pertelqtuiu pertelqtuui pertelqtuui pertelqtuiu pertelqituu pertelqituu pertelqiutu pertelqiuut pertelqiuut pertelqiutu
pertelquitu pertelquiut pertelqutiu pertelqutui pertelquuti pertelquuit pertelquiut pertelquitu pertelquuit pertelquuti
pertelqutui pertelqutiu pertelutqiu pertelutqui pertelutiqu pertelutiuq pertelutuiq pertelutuqi perteluqtiu perteluqtui
perteluqitu perteluqiut perteluquit perteluquti perteluiqtu perteluiqut perteluitqu perteluituq perteluiutq perteluiuqt
perteluuqit perteluuqti perteluuiqt perteluuitq perteluutiq perteluutqi pertelutqui pertelutqiu pertelutuqi pertelutuiq
pertelutiuq pertelutiqu perteluqtui perteluqtiu perteluquti perteluquit perteluqiut perteluqitu perteluuqti perteluuqit
perteluutqi perteluutiq perteluuitq perteluuiqt perteluiqut perteluiqtu perteluiuqt perteluiutq perteluituq perteluitqu
perteiltquu perteiltquu perteiltuqu perteiltuuq perteiltuuq perteiltuqu perteilqtuu perteilqtuu perteilqutu perteilquut
perteilquut perteilqutu perteiluqtu perteiluqut perteilutqu perteilutuq perteiluutq perteiluuqt perteiluqut perteiluqtu
perteiluuqt perteiluutq perteilutuq perteilutqu perteitlquu perteitlquu perteitluqu perteitluuq perteitluuq perteitluqu
perteitqluu perteitqluu perteitqulu perteitquul perteitquul perteitqulu perteituqlu perteituqul perteitulqu perteituluq
perteituulq perteituuql perteituqul perteituqlu perteituuql perteituulq perteituluq perteitulqu perteiqtluu perteiqtluu
perteiqtulu perteiqtuul perteiqtuul perteiqtulu perteiqltuu perteiqltuu perteiqlutu perteiqluut perteiqluut perteiqlutu
perteiqultu perteiqulut perteiqutlu perteiqutul perteiquutl perteiquult perteiqulut perteiqultu perteiquult perteiquutl
perteiqutul perteiqutlu perteiutqlu perteiutqul perteiutlqu perteiutluq perteiutulq perteiutuql perteiuqtlu perteiuqtul
perteiuqltu perteiuqlut perteiuqult perteiuqutl perteiulqtu perteiulqut perteiultqu perteiultuq perteiulutq perteiuluqt
perteiuuqlt perteiuuqtl perteiuulqt perteiuultq perteiuutlq perteiuutql perteiutqul perteiutqlu perteiutuql perteiutulq
perteiutluq perteiutlqu perteiuqtul perteiuqtlu perteiuqutl perteiuqult perteiuqlut perteiuqltu perteiuuqtl perteiuuqlt
perteiuutql perteiuutlq perteiuultq perteiuulqt perteiulqut perteiulqtu perteiuluqt perteiulutq perteiultuq perteiultqu
pertetilquu pertetilquu pertetiluqu pertetiluuq pertetiluuq pertetiluqu pertetiqluu pertetiqluu pertetiqulu pertetiquul
pertetiquul pertetiqulu pertetiuqlu pertetiuqul pertetiulqu pertetiuluq pertetiuulq pertetiuuql pertetiuqul pertetiuqlu
pertetiuuql pertetiuulq pertetiuluq pertetiulqu pertetliquu pertetliquu pertetliuqu pertetliuuq pertetliuuq pertetliuqu
pertetlqiuu pertetlqiuu pertetlquiu pertetlquui pertetlquui pertetlquiu pertetluqiu pertetluqui pertetluiqu pertetluiuq
pertetluuiq pertetluuqi pertetluqui pertetluqiu pertetluuqi pertetluuiq pertetluiuq pertetluiqu pertetqliuu pertetqliuu
pertetqluiu pertetqluui pertetqluui pertetqluiu pertetqiluu pertetqiluu pertetqiulu pertetqiuul pertetqiuul pertetqiulu
pertetquilu pertetquiul pertetquliu pertetqului pertetquuli pertetquuil pertetquiul pertetquilu pertetquuil pertetquuli
pertetqului pertetquliu pertetulqiu pertetulqui pertetuliqu pertetuliuq pertetuluiq pertetuluqi pertetuqliu pertetuqlui
pertetuqilu pertetuqiul pertetuquil pertetuquli pertetuiqlu pertetuiqul pertetuilqu pertetuiluq pertetuiulq pertetuiuql
pertetuuqil pertetuuqli pertetuuiql pertetuuilq pertetuuliq pertetuulqi pertetulqui pertetulqiu pertetuluqi pertetuluiq
pertetuliuq pertetuliqu pertetuqlui pertetuqliu pertetuquli pertetuquil pertetuqiul pertetuqilu pertetuuqli pertetuuqil
pertetuulqi pertetuuliq pertetuuilq pertetuuiql pertetuiqul pertetuiqlu pertetuiuql pertetuiulq pertetuiluq pertetuilqu
perteqitluu perteqitluu perteqitulu perteqituul perteqituul perteqitulu perteqiltuu perteqiltuu perteqilutu perteqiluut
perteqiluut perteqilutu perteqiultu perteqiulut perteqiutlu perteqiutul perteqiuutl perteqiuult perteqiulut perteqiultu
perteqiuult perteqiuutl perteqiutul perteqiutlu perteqtiluu perteqtiluu perteqtiulu perteqtiuul perteqtiuul perteqtiulu
perteqtliuu perteqtliuu perteqtluiu perteqtluui perteqtluui perteqtluiu perteqtuliu perteqtului perteqtuilu perteqtuiul
perteqtuuil perteqtuuli perteqtului perteqtuliu perteqtuuli perteqtuuil perteqtuiul perteqtuilu perteqltiuu perteqltiuu
perteqltuiu perteqltuui perteqltuui perteqltuiu perteqlituu perteqlituu perteqliutu perteqliuut perteqliuut perteqliutu
perteqluitu perteqluiut perteqlutiu perteqlutui perteqluuti perteqluuit perteqluiut perteqluitu perteqluuit perteqluuti
perteqlutui perteqlutiu pertequtliu pertequtlui pertequtilu pertequtiul pertequtuil pertequtuli pertequltiu pertequltui
pertequlitu pertequliut pertequluit pertequluti pertequiltu pertequilut pertequitlu pertequitul pertequiutl pertequiult
pertequulit pertequulti pertequuilt pertequuitl pertequutil pertequutli pertequtlui pertequtliu pertequtuli pertequtuil
pertequtiul pertequtilu pertequltui pertequltiu pertequluti pertequluit pertequliut pertequlitu pertequulti pertequulit
pertequutli pertequutil pertequuitl pertequuilt pertequilut pertequiltu pertequiult pertequiutl pertequitul pertequitlu
perteuitqlu perteuitqul perteuitlqu perteuitluq perteuitulq perteuituql perteuiqtlu perteuiqtul perteuiqltu perteuiqlut
perteuiqult perteuiqutl perteuilqtu perteuilqut perteuiltqu perteuiltuq perteuilutq perteuiluqt perteuiuqlt perteuiuqtl
perteuiulqt perteuiultq perteuiutlq perteuiutql perteutiqlu perteutiqul perteutilqu perteutiluq perteutiulq perteutiuql
perteutqilu perteutqiul perteutqliu perteutqlui perteutquli perteutquil perteutlqiu perteutlqui perteutliqu perteutliuq
perteutluiq perteutluqi perteutuqli perteutuqil perteutulqi perteutuliq perteutuilq perteutuiql perteuqtilu perteuqtiul
perteuqtliu perteuqtlui perteuqtuli perteuqtuil perteuqitlu perteuqitul perteuqiltu perteuqilut perteuqiult perteuqiutl
perteuqlitu perteuqliut perteuqltiu perteuqltui perteuqluti perteuqluit perteuquilt perteuquitl perteuqulit perteuqulti
perteuqutli perteuqutil perteultqiu perteultqui perteultiqu perteultiuq perteultuiq perteultuqi perteulqtiu perteulqtui
perteulqitu perteulqiut perteulquit perteulquti perteuliqtu perteuliqut perteulitqu perteulituq perteuliutq perteuliuqt
perteuluqit perteuluqti perteuluiqt perteuluitq perteulutiq perteulutqi perteuutqli perteuutqil perteuutlqi perteuutliq
perteuutilq perteuutiql perteuuqtli perteuuqtil perteuuqlti perteuuqlit perteuuqilt perteuuqitl perteuulqti perteuulqit
perteuultqi perteuultiq perteuulitq perteuuliqt perteuuiqlt perteuuiqtl perteuuilqt perteuuiltq perteuuitlq perteuuitql
perteuitqul perteuitqlu perteuituql perteuitulq perteuitluq perteuitlqu perteuiqtul perteuiqtlu perteuiqutl perteuiqult
perteuiqlut perteuiqltu perteuiuqtl perteuiuqlt perteuiutql perteuiutlq perteuiultq perteuiulqt perteuilqut perteuilqtu
perteuiluqt perteuilutq perteuiltuq perteuiltqu perteutiqul perteutiqlu perteutiuql perteutiulq perteutiluq perteutilqu
perteutqiul perteutqilu perteutquil perteutquli perteutqlui perteutqliu perteutuqil perteutuqli perteutuiql perteutuilq
perteutuliq perteutulqi perteutlqui perteutlqiu perteutluqi perteutluiq perteutliuq perteutliqu perteuqtiul perteuqtilu
perteuqtuil perteuqtuli perteuqtlui perteuqtliu perteuqitul perteuqitlu perteuqiutl perteuqiult perteuqilut perteuqiltu
perteuquitl perteuquilt perteuqutil perteuqutli perteuqulti perteuqulit perteuqliut perteuqlitu perteuqluit perteuqluti
perteuqltui perteuqltiu perteuutqil perteuutqli perteuutiql perteuutilq perteuutliq perteuutlqi perteuuqtil perteuuqtli
perteuuqitl perteuuqilt perteuuqlit perteuuqlti perteuuiqtl perteuuiqlt perteuuitql perteuuitlq perteuuiltq perteuuilqt
perteuulqit perteuulqti perteuuliqt perteuulitq perteuultiq perteuultqi perteultqui perteultqiu perteultuqi perteultuiq
perteultiuq perteultiqu perteulqtui perteulqtiu perteulquti perteulquit perteulqiut perteulqitu perteuluqti perteuluqit
perteulutqi perteulutiq perteuluitq perteuluiqt perteuliqut perteuliqtu perteuliuqt perteuliutq perteulituq perteulitqu

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us