easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

webre

staphylococcus

compellavissesque

peaker

nebula

councilwomen

recirculates

unrescued

bellii

laudanum

reheat

sublimes

horia

asbestosis

nongipsy

refresher

domiciliated

messes


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: pereoque
cipher variations:
qfsfprvf rgtgqswg shuhrtxh tivisuyi ujwjtvzj
vkxkuwak wlylvxbl xmzmwycm ynanxzdn zoboyaeo
apcpzbfp bqdqacgq crerbdhr dsfsceis etgtdfjt
fuhuegku gvivfhlv hwjwgimw ixkxhjnx jylyikoy
kzmzjlpz lanakmqa mboblnrb ncpcmosc odqdnptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: pereoque
Cipher: kvivljfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: pereoque
Cipher: ABBBA AABAA BAAAA AABAA ABBAB ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: pereoque
cipher variations:
qfsfprvfunanrxjnyvivtdxvcdqdvjldglylxpzlktgtzvntsjwjdhpjwrerfndr
azmzhtrzehuhjzfhipcplftpmxkxnlhxrgtgqswgvobosykozwjwueywderewkme
hmzmyqamluhuawoutkxkeiqkxsfsgoesbanaiusafivikagijqdqmguqnylyomiy
shuhrtxhwpcptzlpaxkxvfzxefsfxlnfinanzrbnmvivbxpvulylfjrlytgthpft
cbobjvtbgjwjlbhjkrernhvrozmzpnjztivisuyixqdquamqbylywgayfgtgymog
joboasconwjwcyqwvmzmgksmzuhuiqgudcpckwuchkxkmciklsfsoiwspanaqoka
ujwjtvzjyrervbnrczmzxhbzghuhznphkpcpbtdpoxkxdzrxwnanhltnavivjrhv
edqdlxvdilylndjlmtgtpjxtqbobrplbvkxkuwakzsfswcosdanayicahiviaoqi
lqdqcueqpylyeasyxoboimuobwjwksiwferemywejmzmoekmnuhuqkyurcpcsqmc
wlylvxblatgtxdptebobzjdbijwjbprjmrerdvfrqzmzfbtzypcpjnvpcxkxltjx
gfsfnzxfknanpflnovivrlzvsdqdtrndxmzmwycmbuhuyequfcpcakecjkxkcqsk
nsfsewgsranagcuazqdqkowqdylymukyhgtgoaygloboqgmopwjwsmawtereusoe
ynanxzdncvivzfrvgdqdblfdklyldrtlotgtfxhtsbobhdvbarerlpxrezmznvlz
ihuhpbzhmpcprhnpqxkxtnbxufsfvtpfzoboyaeodwjwagswherecmgelmzmesum
puhugyiutcpciewcbsfsmqysfanaowmajiviqcainqdqsioqrylyuocyvgtgwuqg
apcpzbfpexkxbhtxifsfdnhfmnanftvnqvivhzjvudqdjfxdctgtnrztgbobpxnb
kjwjrdbjorertjprszmzvpdzwhuhxvrhbqdqacgqfylyciuyjgtgeoignoboguwo
rwjwiakwverekgyeduhuosauhcpcqyoclkxkseckpsfsukqstanawqeaxiviywsi
crerbdhrgzmzdjvzkhuhfpjhopcphvxpsxkxjblxwfsflhzfevivptbvidqdrzpd
mlyltfdlqtgtvlrtubobxrfbyjwjzxtjdsfsceishanaekwalivigqkipqdqiwyq
tylykcmyxgtgmiagfwjwqucwjeresaqenmzmugemruhuwmsuvcpcysgczkxkayuk
etgtdfjtibobflxbmjwjhrljqrerjxzruzmzldnzyhuhnjbhgxkxrvdxkfsftbrf
onanvhfnsvivxntvwdqdzthdalylbzvlfuhuegkujcpcgmycnkxkismkrsfskyas
vanameoaziviokcihylysweylgtgucsgpobowigotwjwyouwxereauiebmzmcawm
gvivfhlvkdqdhnzdolyljtnlstgtlzbtwbobnfpbajwjpldjizmztxfzmhuhvdth
qpcpxjhpuxkxzpvxyfsfbvjfcnandbxnhwjwgimwlereioaepmzmkuomtuhumacu
xcpcogqcbkxkqmekjanauyganiviweuirqdqykiqvylyaqwyzgtgcwkgdoboecyo
ixkxhjnxmfsfjpbfqnanlvpnuvivnbdvydqdphrdclylrnflkbobvzhbojwjxfvj
srerzljrwzmzbrxzahuhdxlhepcpfdzpjylyikoyngtgkqcgrobomwqovwjwocew
zereqisedmzmsogmlcpcwaicpkxkygwktsfsamksxanacsyabivieymifqdqgeaq
kzmzjlpzohuhlrdhspcpnxrpwxkxpdfxafsfrjtfenantphnmdqdxbjdqlylzhxl
utgtbnltybobdtzbcjwjfznjgrerhfbrlanakmqapivimseitqdqoysqxylyqegy
bgtgskugfobouqionereyckermzmaiymvuhucomuzcpceuacdkxkgaokhsfsigcs
mboblnrbqjwjntfjurerpztryzmzrfhzchuhtlvhgpcpvrjpofsfzdlfsnanbjzn
wvivdpnvadqdfvbdelylhbplitgtjhdtncpcmoscrkxkougkvsfsqauszanasgia
diviumwihqdqwskqpgtgaemgtobockaoxwjweqowberegwcefmzmicqmjuhukieu
odqdnptdslylpvhlwtgtrbvtabobthjbejwjvnxjirerxtlrqhuhbfnhupcpdlbp
yxkxfrpxcfsfhxdfgnanjdrnkvivljfvpereoquetmzmqwimxuhuscwubcpcuikc
fkxkwoykjsfsyumsrivicgoivqdqemcqzylygsqydgtgiyeghobokesolwjwmkgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: pereoque
Cipher: crerbdhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: pereoque
Cipher: 5351245143145451

Extended Methods:
Method #1

Plaintext: pereoque
method variations:
ukwktvzkzpbpyaepeugudfkukzmzilpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
p e r e o q u e 
5 5 2 5 4 1 5 5 
3 1 4 1 3 4 4 1 
They are then read out in rows:
5525415531413441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: pereoque
Cipher: zwdzcdsd

Read more ...
Method #3

Plaintext: pereoque
method variations:
xfyqcyyv fyqcyyvx yqcyyvxf
qcyyvxfy cyyvxfyq yyvxfyqc
yvxfyqcy vxfyqcyy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: pereoque

first 5040 cipher variations(40320 total)
pereoque pereoqeu pereouqe pereoueq pereoeuq pereoequ pereqoue pereqoeu perequoe perequeo pereqeuo
pereqeou pereuqoe pereuqeo pereuoqe pereuoeq pereueoq pereueqo pereequo pereeqou pereeuqo pereeuoq
pereeouq pereeoqu peroeque peroeqeu peroeuqe peroeueq peroeeuq peroeequ peroqeue peroqeeu peroquee
peroquee peroqeue peroqeeu perouqee perouqee peroueqe peroueeq peroueeq peroueqe peroeque peroeqeu
peroeuqe peroeueq peroeeuq peroeequ perqoeue perqoeeu perqouee perqouee perqoeue perqoeeu perqeoue
perqeoeu perqeuoe perqeueo perqeeuo perqeeou perqueoe perqueeo perquoee perquoee perqueoe perqueeo
perqeeuo perqeeou perqeueo perqeuoe perqeoue perqeoeu peruoqee peruoqee peruoeqe peruoeeq peruoeeq
peruoeqe peruqoee peruqoee peruqeoe peruqeeo peruqeeo peruqeoe perueqoe perueqeo perueoqe perueoeq
perueeoq perueeqo perueqeo perueqoe perueeqo perueeoq perueoeq perueoqe pereoque pereoqeu pereouqe
pereoueq pereoeuq pereoequ pereqoue pereqoeu perequoe perequeo pereqeuo pereqeou pereuqoe pereuqeo
pereuoqe pereuoeq pereueoq pereueqo pereequo pereeqou pereeuqo pereeuoq pereeouq pereeoqu peeroque
peeroqeu peerouqe peeroueq peeroeuq peeroequ peerqoue peerqoeu peerquoe peerqueo peerqeuo peerqeou
peeruqoe peeruqeo peeruoqe peeruoeq peerueoq peerueqo peerequo peereqou peereuqo peereuoq peereouq
peereoqu peeorque peeorqeu peeoruqe peeorueq peeoreuq peeorequ peeoqrue peeoqreu peeoqure peeoquer
peeoqeur peeoqeru peeouqre peeouqer peeourqe peeoureq peeouerq peeoueqr peeoequr peeoeqru peeoeuqr
peeoeurq peeoeruq peeoerqu peeqorue peeqoreu peeqoure peeqouer peeqoeur peeqoeru peeqroue peeqroeu
peeqruoe peeqrueo peeqreuo peeqreou peequroe peequreo peequore peequoer peequeor peequero peeqeruo
peeqerou peeqeuro peeqeuor peeqeour peeqeoru peeuoqre peeuoqer peeuorqe peeuoreq peeuoerq peeuoeqr
peeuqore peeuqoer peeuqroe peeuqreo peeuqero peeuqeor peeurqoe peeurqeo peeuroqe peeuroeq peeureoq
peeureqo peeueqro peeueqor peeuerqo peeueroq peeueorq peeueoqr peeeoqur peeeoqru peeeouqr peeeourq
peeeoruq peeeorqu peeeqour peeeqoru peeequor peeequro peeeqruo peeeqrou peeeuqor peeeuqro peeeuoqr
peeeuorq peeeuroq peeeurqo peeerquo peeerqou peeeruqo peeeruoq peeerouq peeeroqu peoerque peoerqeu
peoeruqe peoerueq peoereuq peoerequ peoeqrue peoeqreu peoequre peoequer peoeqeur peoeqeru peoeuqre
peoeuqer peoeurqe peoeureq peoeuerq peoeueqr peoeequr peoeeqru peoeeuqr peoeeurq peoeeruq peoeerqu
peoreque peoreqeu peoreuqe peoreueq peoreeuq peoreequ peorqeue peorqeeu peorquee peorquee peorqeue
peorqeeu peoruqee peoruqee peorueqe peorueeq peorueeq peorueqe peoreque peoreqeu peoreuqe peoreueq
peoreeuq peoreequ peoqreue peoqreeu peoqruee peoqruee peoqreue peoqreeu peoqerue peoqereu peoqeure
peoqeuer peoqeeur peoqeeru peoquere peoqueer peoquree peoquree peoquere peoqueer peoqeeur peoqeeru
peoqeuer peoqeure peoqerue peoqereu peourqee peourqee peoureqe peoureeq peoureeq peoureqe peouqree
peouqree peouqere peouqeer peouqeer peouqere peoueqre peoueqer peouerqe peouereq peoueerq peoueeqr
peoueqer peoueqre peoueeqr peoueerq peouereq peouerqe peoerque peoerqeu peoeruqe peoerueq peoereuq
peoerequ peoeqrue peoeqreu peoequre peoequer peoeqeur peoeqeru peoeuqre peoeuqer peoeurqe peoeureq
peoeuerq peoeueqr peoeequr peoeeqru peoeeuqr peoeeurq peoeeruq peoeerqu peqeorue peqeoreu peqeoure
peqeouer peqeoeur peqeoeru peqeroue peqeroeu peqeruoe peqerueo peqereuo peqereou peqeuroe peqeureo
peqeuore peqeuoer peqeueor peqeuero peqeeruo peqeerou peqeeuro peqeeuor peqeeour peqeeoru peqoerue
peqoereu peqoeure peqoeuer peqoeeur peqoeeru peqoreue peqoreeu peqoruee peqoruee peqoreue peqoreeu
peqouree peqouree peqouere peqoueer peqoueer peqouere peqoerue peqoereu peqoeure peqoeuer peqoeeur
peqoeeru peqroeue peqroeeu peqrouee peqrouee peqroeue peqroeeu peqreoue peqreoeu peqreuoe peqreueo
peqreeuo peqreeou peqrueoe peqrueeo peqruoee peqruoee peqrueoe peqrueeo peqreeuo peqreeou peqreueo
peqreuoe peqreoue peqreoeu pequoree pequoree pequoere pequoeer pequoeer pequoere pequroee pequroee
pequreoe pequreeo pequreeo pequreoe pequeroe pequereo pequeore pequeoer pequeeor pequeero pequereo
pequeroe pequeero pequeeor pequeoer pequeore peqeorue peqeoreu peqeoure peqeouer peqeoeur peqeoeru
peqeroue peqeroeu peqeruoe peqerueo peqereuo peqereou peqeuroe peqeureo peqeuore peqeuoer peqeueor
peqeuero peqeeruo peqeerou peqeeuro peqeeuor peqeeour peqeeoru peueoqre peueoqer peueorqe peueoreq
peueoerq peueoeqr peueqore peueqoer peueqroe peueqreo peueqero peueqeor peuerqoe peuerqeo peueroqe
peueroeq peuereoq peuereqo peueeqro peueeqor peueerqo peueeroq peueeorq peueeoqr peuoeqre peuoeqer
peuoerqe peuoereq peuoeerq peuoeeqr peuoqere peuoqeer peuoqree peuoqree peuoqere peuoqeer peuorqee
peuorqee peuoreqe peuoreeq peuoreeq peuoreqe peuoeqre peuoeqer peuoerqe peuoereq peuoeerq peuoeeqr
peuqoere peuqoeer peuqoree peuqoree peuqoere peuqoeer peuqeore peuqeoer peuqeroe peuqereo peuqeero
peuqeeor peuqreoe peuqreeo peuqroee peuqroee peuqreoe peuqreeo peuqeero peuqeeor peuqereo peuqeroe
peuqeore peuqeoer peuroqee peuroqee peuroeqe peuroeeq peuroeeq peuroeqe peurqoee peurqoee peurqeoe
peurqeeo peurqeeo peurqeoe peureqoe peureqeo peureoqe peureoeq peureeoq peureeqo peureqeo peureqoe
peureeqo peureeoq peureoeq peureoqe peueoqre peueoqer peueorqe peueoreq peueoerq peueoeqr peueqore
peueqoer peueqroe peueqreo peueqero peueqeor peuerqoe peuerqeo peueroqe peueroeq peuereoq peuereqo
peueeqro peueeqor peueerqo peueeroq peueeorq peueeoqr peeeoqur peeeoqru peeeouqr peeeourq peeeoruq
peeeorqu peeeqour peeeqoru peeequor peeequro peeeqruo peeeqrou peeeuqor peeeuqro peeeuoqr peeeuorq
peeeuroq peeeurqo peeerquo peeerqou peeeruqo peeeruoq peeerouq peeeroqu peeoequr peeoeqru peeoeuqr
peeoeurq peeoeruq peeoerqu peeoqeur peeoqeru peeoquer peeoqure peeoqrue peeoqreu peeouqer peeouqre
peeoueqr peeouerq peeoureq peeourqe peeorque peeorqeu peeoruqe peeorueq peeoreuq peeorequ peeqoeur
peeqoeru peeqouer peeqoure peeqorue peeqoreu peeqeour peeqeoru peeqeuor peeqeuro peeqeruo peeqerou
peequeor peequero peequoer peequore peequroe peequreo peeqreuo peeqreou peeqrueo peeqruoe peeqroue
peeqroeu peeuoqer peeuoqre peeuoeqr peeuoerq peeuoreq peeuorqe peeuqoer peeuqore peeuqeor peeuqero
peeuqreo peeuqroe peeueqor peeueqro peeueoqr peeueorq peeueroq peeuerqo peeurqeo peeurqoe peeureqo
peeureoq peeuroeq peeuroqe peeroque peeroqeu peerouqe peeroueq peeroeuq peeroequ peerqoue peerqoeu
peerquoe peerqueo peerqeuo peerqeou peeruqoe peeruqeo peeruoqe peeruoeq peerueoq peerueqo peerequo
peereqou peereuqo peereuoq peereouq peereoqu preeoque preeoqeu preeouqe preeoueq preeoeuq preeoequ
preeqoue preeqoeu preequoe preequeo preeqeuo preeqeou preeuqoe preeuqeo preeuoqe preeuoeq preeueoq
preeueqo preeequo preeeqou preeeuqo preeeuoq preeeouq preeeoqu preoeque preoeqeu preoeuqe preoeueq
preoeeuq preoeequ preoqeue preoqeeu preoquee preoquee preoqeue preoqeeu preouqee preouqee preoueqe
preoueeq preoueeq preoueqe preoeque preoeqeu preoeuqe preoeueq preoeeuq preoeequ preqoeue preqoeeu
preqouee preqouee preqoeue preqoeeu preqeoue preqeoeu preqeuoe preqeueo preqeeuo preqeeou prequeoe
prequeeo prequoee prequoee prequeoe prequeeo preqeeuo preqeeou preqeueo preqeuoe preqeoue preqeoeu
preuoqee preuoqee preuoeqe preuoeeq preuoeeq preuoeqe preuqoee preuqoee preuqeoe preuqeeo preuqeeo
preuqeoe preueqoe preueqeo preueoqe preueoeq preueeoq preueeqo preueqeo preueqoe preueeqo preueeoq
preueoeq preueoqe preeoque preeoqeu preeouqe preeoueq preeoeuq preeoequ preeqoue preeqoeu preequoe
preequeo preeqeuo preeqeou preeuqoe preeuqeo preeuoqe preeuoeq preeueoq preeueqo preeequo preeeqou
preeeuqo preeeuoq preeeouq preeeoqu preeoque preeoqeu preeouqe preeoueq preeoeuq preeoequ preeqoue
preeqoeu preequoe preequeo preeqeuo preeqeou preeuqoe preeuqeo preeuoqe preeuoeq preeueoq preeueqo
preeequo preeeqou preeeuqo preeeuoq preeeouq preeeoqu preoeque preoeqeu preoeuqe preoeueq preoeeuq
preoeequ preoqeue preoqeeu preoquee preoquee preoqeue preoqeeu preouqee preouqee preoueqe preoueeq
preoueeq preoueqe preoeque preoeqeu preoeuqe preoeueq preoeeuq preoeequ preqoeue preqoeeu preqouee
preqouee preqoeue preqoeeu preqeoue preqeoeu preqeuoe preqeueo preqeeuo preqeeou prequeoe prequeeo
prequoee prequoee prequeoe prequeeo preqeeuo preqeeou preqeueo preqeuoe preqeoue preqeoeu preuoqee
preuoqee preuoeqe preuoeeq preuoeeq preuoeqe preuqoee preuqoee preuqeoe preuqeeo preuqeeo preuqeoe
preueqoe preueqeo preueoqe preueoeq preueeoq preueeqo preueqeo preueqoe preueeqo preueeoq preueoeq
preueoqe preeoque preeoqeu preeouqe preeoueq preeoeuq preeoequ preeqoue preeqoeu preequoe preequeo
preeqeuo preeqeou preeuqoe preeuqeo preeuoqe preeuoeq preeueoq preeueqo preeequo preeeqou preeeuqo
preeeuoq preeeouq preeeoqu proeeque proeeqeu proeeuqe proeeueq proeeeuq proeeequ proeqeue proeqeeu
proequee proequee proeqeue proeqeeu proeuqee proeuqee proeueqe proeueeq proeueeq proeueqe proeeque
proeeqeu proeeuqe proeeueq proeeeuq proeeequ proeeque proeeqeu proeeuqe proeeueq proeeeuq proeeequ
proeqeue proeqeeu proequee proequee proeqeue proeqeeu proeuqee proeuqee proeueqe proeueeq proeueeq
proeueqe proeeque proeeqeu proeeuqe proeeueq proeeeuq proeeequ proqeeue proqeeeu proqeuee proqeuee
proqeeue proqeeeu proqeeue proqeeeu proqeuee proqeuee proqeeue proqeeeu proqueee proqueee proqueee
proqueee proqueee proqueee proqeeue proqeeeu proqeuee proqeuee proqeeue proqeeeu proueqee proueqee
proueeqe proueeeq proueeeq proueeqe prouqeee prouqeee prouqeee prouqeee prouqeee prouqeee proueqee
proueqee proueeqe proueeeq proueeeq proueeqe proueqee proueqee proueeqe proueeeq proueeeq proueeqe
proeeque proeeqeu proeeuqe proeeueq proeeeuq proeeequ proeqeue proeqeeu proequee proequee proeqeue
proeqeeu proeuqee proeuqee proeueqe proeueeq proeueeq proeueqe proeeque proeeqeu proeeuqe proeeueq
proeeeuq proeeequ prqeoeue prqeoeeu prqeouee prqeouee prqeoeue prqeoeeu prqeeoue prqeeoeu prqeeuoe
prqeeueo prqeeeuo prqeeeou prqeueoe prqeueeo prqeuoee prqeuoee prqeueoe prqeueeo prqeeeuo prqeeeou
prqeeueo prqeeuoe prqeeoue prqeeoeu prqoeeue prqoeeeu prqoeuee prqoeuee prqoeeue prqoeeeu prqoeeue
prqoeeeu prqoeuee prqoeuee prqoeeue prqoeeeu prqoueee prqoueee prqoueee prqoueee prqoueee prqoueee
prqoeeue prqoeeeu prqoeuee prqoeuee prqoeeue prqoeeeu prqeoeue prqeoeeu prqeouee prqeouee prqeoeue
prqeoeeu prqeeoue prqeeoeu prqeeuoe prqeeueo prqeeeuo prqeeeou prqeueoe prqeueeo prqeuoee prqeuoee
prqeueoe prqeueeo prqeeeuo prqeeeou prqeeueo prqeeuoe prqeeoue prqeeoeu prquoeee prquoeee prquoeee
prquoeee prquoeee prquoeee prqueoee prqueoee prqueeoe prqueeeo prqueeeo prqueeoe prqueeoe prqueeeo
prqueoee prqueoee prqueeoe prqueeeo prqueeeo prqueeoe prqueeeo prqueeoe prqueoee prqueoee prqeoeue
prqeoeeu prqeouee prqeouee prqeoeue prqeoeeu prqeeoue prqeeoeu prqeeuoe prqeeueo prqeeeuo prqeeeou
prqeueoe prqeueeo prqeuoee prqeuoee prqeueoe prqeueeo prqeeeuo prqeeeou prqeeueo prqeeuoe prqeeoue
prqeeoeu prueoqee prueoqee prueoeqe prueoeeq prueoeeq prueoeqe prueqoee prueqoee prueqeoe prueqeeo
prueqeeo prueqeoe prueeqoe prueeqeo prueeoqe prueeoeq prueeeoq prueeeqo prueeqeo prueeqoe prueeeqo
prueeeoq prueeoeq prueeoqe pruoeqee pruoeqee pruoeeqe pruoeeeq pruoeeeq pruoeeqe pruoqeee pruoqeee
pruoqeee pruoqeee pruoqeee pruoqeee pruoeqee pruoeqee pruoeeqe pruoeeeq pruoeeeq pruoeeqe pruoeqee
pruoeqee pruoeeqe pruoeeeq pruoeeeq pruoeeqe pruqoeee pruqoeee pruqoeee pruqoeee pruqoeee pruqoeee
pruqeoee pruqeoee pruqeeoe pruqeeeo pruqeeeo pruqeeoe pruqeeoe pruqeeeo pruqeoee pruqeoee pruqeeoe
pruqeeeo pruqeeeo pruqeeoe pruqeeeo pruqeeoe pruqeoee pruqeoee prueoqee prueoqee prueoeqe prueoeeq
prueoeeq prueoeqe prueqoee prueqoee prueqeoe prueqeeo prueqeeo prueqeoe prueeqoe prueeqeo prueeoqe
prueeoeq prueeeoq prueeeqo prueeqeo prueeqoe prueeeqo prueeeoq prueeoeq prueeoqe prueoqee prueoqee
prueoeqe prueoeeq prueoeeq prueoeqe prueqoee prueqoee prueqeoe prueqeeo prueqeeo prueqeoe prueeqoe
prueeqeo prueeoqe prueeoeq prueeeoq prueeeqo prueeqeo prueeqoe prueeeqo prueeeoq prueeoeq prueeoqe
preeoque preeoqeu preeouqe preeoueq preeoeuq preeoequ preeqoue preeqoeu preequoe preequeo preeqeuo
preeqeou preeuqoe preeuqeo preeuoqe preeuoeq preeueoq preeueqo preeequo preeeqou preeeuqo preeeuoq
preeeouq preeeoqu preoeque preoeqeu preoeuqe preoeueq preoeeuq preoeequ preoqeue preoqeeu preoquee
preoquee preoqeue preoqeeu preouqee preouqee preoueqe preoueeq preoueeq preoueqe preoeque preoeqeu
preoeuqe preoeueq preoeeuq preoeequ preqoeue preqoeeu preqouee preqouee preqoeue preqoeeu preqeoue
preqeoeu preqeuoe preqeueo preqeeuo preqeeou prequeoe prequeeo prequoee prequoee prequeoe prequeeo
preqeeuo preqeeou preqeueo preqeuoe preqeoue preqeoeu preuoqee preuoqee preuoeqe preuoeeq preuoeeq
preuoeqe preuqoee preuqoee preuqeoe preuqeeo preuqeeo preuqeoe preueqoe preueqeo preueoqe preueoeq
preueeoq preueeqo preueqeo preueqoe preueeqo preueeoq preueoeq preueoqe preeoque preeoqeu preeouqe
preeoueq preeoeuq preeoequ preeqoue preeqoeu preequoe preequeo preeqeuo preeqeou preeuqoe preeuqeo
preeuoqe preeuoeq preeueoq preeueqo preeequo preeeqou preeeuqo preeeuoq preeeouq preeeoqu pereoque
pereoqeu pereouqe pereoueq pereoeuq pereoequ pereqoue pereqoeu perequoe perequeo pereqeuo pereqeou
pereuqoe pereuqeo pereuoqe pereuoeq pereueoq pereueqo pereequo pereeqou pereeuqo pereeuoq pereeouq
pereeoqu peroeque peroeqeu peroeuqe peroeueq peroeeuq peroeequ peroqeue peroqeeu peroquee peroquee
peroqeue peroqeeu perouqee perouqee peroueqe peroueeq peroueeq peroueqe peroeque peroeqeu peroeuqe
peroeueq peroeeuq peroeequ perqoeue perqoeeu perqouee perqouee perqoeue perqoeeu perqeoue perqeoeu
perqeuoe perqeueo perqeeuo perqeeou perqueoe perqueeo perquoee perquoee perqueoe perqueeo perqeeuo
perqeeou perqeueo perqeuoe perqeoue perqeoeu peruoqee peruoqee peruoeqe peruoeeq peruoeeq peruoeqe
peruqoee peruqoee peruqeoe peruqeeo peruqeeo peruqeoe perueqoe perueqeo perueoqe perueoeq perueeoq
perueeqo perueqeo perueqoe perueeqo perueeoq perueoeq perueoqe pereoque pereoqeu pereouqe pereoueq
pereoeuq pereoequ pereqoue pereqoeu perequoe perequeo pereqeuo pereqeou pereuqoe pereuqeo pereuoqe
pereuoeq pereueoq pereueqo pereequo pereeqou pereeuqo pereeuoq pereeouq pereeoqu peeroque peeroqeu
peerouqe peeroueq peeroeuq peeroequ peerqoue peerqoeu peerquoe peerqueo peerqeuo peerqeou peeruqoe
peeruqeo peeruoqe peeruoeq peerueoq peerueqo peerequo peereqou peereuqo peereuoq peereouq peereoqu
peeorque peeorqeu peeoruqe peeorueq peeoreuq peeorequ peeoqrue peeoqreu peeoqure peeoquer peeoqeur
peeoqeru peeouqre peeouqer peeourqe peeoureq peeouerq peeoueqr peeoequr peeoeqru peeoeuqr peeoeurq
peeoeruq peeoerqu peeqorue peeqoreu peeqoure peeqouer peeqoeur peeqoeru peeqroue peeqroeu peeqruoe
peeqrueo peeqreuo peeqreou peequroe peequreo peequore peequoer peequeor peequero peeqeruo peeqerou
peeqeuro peeqeuor peeqeour peeqeoru peeuoqre peeuoqer peeuorqe peeuoreq peeuoerq peeuoeqr peeuqore
peeuqoer peeuqroe peeuqreo peeuqero peeuqeor peeurqoe peeurqeo peeuroqe peeuroeq peeureoq peeureqo
peeueqro peeueqor peeuerqo peeueroq peeueorq peeueoqr peeeoqur peeeoqru peeeouqr peeeourq peeeoruq
peeeorqu peeeqour peeeqoru peeequor peeequro peeeqruo peeeqrou peeeuqor peeeuqro peeeuoqr peeeuorq
peeeuroq peeeurqo peeerquo peeerqou peeeruqo peeeruoq peeerouq peeeroqu peoerque peoerqeu peoeruqe
peoerueq peoereuq peoerequ peoeqrue peoeqreu peoequre peoequer peoeqeur peoeqeru peoeuqre peoeuqer
peoeurqe peoeureq peoeuerq peoeueqr peoeequr peoeeqru peoeeuqr peoeeurq peoeeruq peoeerqu peoreque
peoreqeu peoreuqe peoreueq peoreeuq peoreequ peorqeue peorqeeu peorquee peorquee peorqeue peorqeeu
peoruqee peoruqee peorueqe peorueeq peorueeq peorueqe peoreque peoreqeu peoreuqe peoreueq peoreeuq
peoreequ peoqreue peoqreeu peoqruee peoqruee peoqreue peoqreeu peoqerue peoqereu peoqeure peoqeuer
peoqeeur peoqeeru peoquere peoqueer peoquree peoquree peoquere peoqueer peoqeeur peoqeeru peoqeuer
peoqeure peoqerue peoqereu peourqee peourqee peoureqe peoureeq peoureeq peoureqe peouqree peouqree
peouqere peouqeer peouqeer peouqere peoueqre peoueqer peouerqe peouereq peoueerq peoueeqr peoueqer
peoueqre peoueeqr peoueerq peouereq peouerqe peoerque peoerqeu peoeruqe peoerueq peoereuq peoerequ
peoeqrue peoeqreu peoequre peoequer peoeqeur peoeqeru peoeuqre peoeuqer peoeurqe peoeureq peoeuerq
peoeueqr peoeequr peoeeqru peoeeuqr peoeeurq peoeeruq peoeerqu peqeorue peqeoreu peqeoure peqeouer
peqeoeur peqeoeru peqeroue peqeroeu peqeruoe peqerueo peqereuo peqereou peqeuroe peqeureo peqeuore
peqeuoer peqeueor peqeuero peqeeruo peqeerou peqeeuro peqeeuor peqeeour peqeeoru peqoerue peqoereu
peqoeure peqoeuer peqoeeur peqoeeru peqoreue peqoreeu peqoruee peqoruee peqoreue peqoreeu peqouree
peqouree peqouere peqoueer peqoueer peqouere peqoerue peqoereu peqoeure peqoeuer peqoeeur peqoeeru
peqroeue peqroeeu peqrouee peqrouee peqroeue peqroeeu peqreoue peqreoeu peqreuoe peqreueo peqreeuo
peqreeou peqrueoe peqrueeo peqruoee peqruoee peqrueoe peqrueeo peqreeuo peqreeou peqreueo peqreuoe
peqreoue peqreoeu pequoree pequoree pequoere pequoeer pequoeer pequoere pequroee pequroee pequreoe
pequreeo pequreeo pequreoe pequeroe pequereo pequeore pequeoer pequeeor pequeero pequereo pequeroe
pequeero pequeeor pequeoer pequeore peqeorue peqeoreu peqeoure peqeouer peqeoeur peqeoeru peqeroue
peqeroeu peqeruoe peqerueo peqereuo peqereou peqeuroe peqeureo peqeuore peqeuoer peqeueor peqeuero
peqeeruo peqeerou peqeeuro peqeeuor peqeeour peqeeoru peueoqre peueoqer peueorqe peueoreq peueoerq
peueoeqr peueqore peueqoer peueqroe peueqreo peueqero peueqeor peuerqoe peuerqeo peueroqe peueroeq
peuereoq peuereqo peueeqro peueeqor peueerqo peueeroq peueeorq peueeoqr peuoeqre peuoeqer peuoerqe
peuoereq peuoeerq peuoeeqr peuoqere peuoqeer peuoqree peuoqree peuoqere peuoqeer peuorqee peuorqee
peuoreqe peuoreeq peuoreeq peuoreqe peuoeqre peuoeqer peuoerqe peuoereq peuoeerq peuoeeqr peuqoere
peuqoeer peuqoree peuqoree peuqoere peuqoeer peuqeore peuqeoer peuqeroe peuqereo peuqeero peuqeeor
peuqreoe peuqreeo peuqroee peuqroee peuqreoe peuqreeo peuqeero peuqeeor peuqereo peuqeroe peuqeore
peuqeoer peuroqee peuroqee peuroeqe peuroeeq peuroeeq peuroeqe peurqoee peurqoee peurqeoe peurqeeo
peurqeeo peurqeoe peureqoe peureqeo peureoqe peureoeq peureeoq peureeqo peureqeo peureqoe peureeqo
peureeoq peureoeq peureoqe peueoqre peueoqer peueorqe peueoreq peueoerq peueoeqr peueqore peueqoer
peueqroe peueqreo peueqero peueqeor peuerqoe peuerqeo peueroqe peueroeq peuereoq peuereqo peueeqro
peueeqor peueerqo peueeroq peueeorq peueeoqr peeeoqur peeeoqru peeeouqr peeeourq peeeoruq peeeorqu
peeeqour peeeqoru peeequor peeequro peeeqruo peeeqrou peeeuqor peeeuqro peeeuoqr peeeuorq peeeuroq
peeeurqo peeerquo peeerqou peeeruqo peeeruoq peeerouq peeeroqu peeoequr peeoeqru peeoeuqr peeoeurq
peeoeruq peeoerqu peeoqeur peeoqeru peeoquer peeoqure peeoqrue peeoqreu peeouqer peeouqre peeoueqr
peeouerq peeoureq peeourqe peeorque peeorqeu peeoruqe peeorueq peeoreuq peeorequ peeqoeur peeqoeru
peeqouer peeqoure peeqorue peeqoreu peeqeour peeqeoru peeqeuor peeqeuro peeqeruo peeqerou peequeor
peequero peequoer peequore peequroe peequreo peeqreuo peeqreou peeqrueo peeqruoe peeqroue peeqroeu
peeuoqer peeuoqre peeuoeqr peeuoerq peeuoreq peeuorqe peeuqoer peeuqore peeuqeor peeuqero peeuqreo
peeuqroe peeueqor peeueqro peeueoqr peeueorq peeueroq peeuerqo peeurqeo peeurqoe peeureqo peeureoq
peeuroeq peeuroqe peeroque peeroqeu peerouqe peeroueq peeroeuq peeroequ peerqoue peerqoeu peerquoe
peerqueo peerqeuo peerqeou peeruqoe peeruqeo peeruoqe peeruoeq peerueoq peerueqo peerequo peereqou
peereuqo peereuoq peereouq peereoqu poreeque poreeqeu poreeuqe poreeueq poreeeuq poreeequ poreqeue
poreqeeu porequee porequee poreqeue poreqeeu poreuqee poreuqee poreueqe poreueeq poreueeq poreueqe
poreeque poreeqeu poreeuqe poreeueq poreeeuq poreeequ poreeque poreeqeu poreeuqe poreeueq poreeeuq
poreeequ poreqeue poreqeeu porequee porequee poreqeue poreqeeu poreuqee poreuqee poreueqe poreueeq
poreueeq poreueqe poreeque poreeqeu poreeuqe poreeueq poreeeuq poreeequ porqeeue porqeeeu porqeuee
porqeuee porqeeue porqeeeu porqeeue porqeeeu porqeuee porqeuee porqeeue porqeeeu porqueee porqueee
porqueee porqueee porqueee porqueee porqeeue porqeeeu porqeuee porqeuee porqeeue porqeeeu porueqee
porueqee porueeqe porueeeq porueeeq porueeqe poruqeee poruqeee poruqeee poruqeee poruqeee poruqeee
porueqee porueqee porueeqe porueeeq porueeeq porueeqe porueqee porueqee porueeqe porueeeq porueeeq
porueeqe poreeque poreeqeu poreeuqe poreeueq poreeeuq poreeequ poreqeue poreqeeu porequee porequee
poreqeue poreqeeu poreuqee poreuqee poreueqe poreueeq poreueeq poreueqe poreeque poreeqeu poreeuqe
poreeueq poreeeuq poreeequ poereque poereqeu poereuqe poereueq poereeuq poereequ poerqeue poerqeeu
poerquee poerquee poerqeue poerqeeu poeruqee poeruqee poerueqe poerueeq poerueeq poerueqe poereque
poereqeu poereuqe poereueq poereeuq poereequ poeerque poeerqeu poeeruqe poeerueq poeereuq poeerequ
poeeqrue poeeqreu poeequre poeequer poeeqeur poeeqeru poeeuqre poeeuqer poeeurqe poeeureq poeeuerq
poeeueqr poeeequr poeeeqru poeeeuqr poeeeurq poeeeruq poeeerqu poeqerue poeqereu poeqeure poeqeuer
poeqeeur poeqeeru poeqreue poeqreeu poeqruee poeqruee poeqreue poeqreeu poequree poequree poequere
poequeer poequeer poequere poeqerue poeqereu poeqeure poeqeuer poeqeeur poeqeeru poeueqre poeueqer
poeuerqe poeuereq poeueerq poeueeqr poeuqere poeuqeer poeuqree poeuqree poeuqere poeuqeer poeurqee
poeurqee poeureqe poeureeq poeureeq poeureqe poeueqre poeueqer poeuerqe poeuereq poeueerq poeueeqr
poeeequr poeeeqru poeeeuqr poeeeurq poeeeruq poeeerqu poeeqeur poeeqeru poeequer poeequre poeeqrue
poeeqreu poeeuqer poeeuqre poeeueqr poeeuerq poeeureq poeeurqe poeerque poeerqeu poeeruqe poeerueq
poeereuq poeerequ poeerque poeerqeu poeeruqe poeerueq poeereuq poeerequ poeeqrue poeeqreu poeequre
poeequer poeeqeur poeeqeru poeeuqre poeeuqer poeeurqe poeeureq poeeuerq poeeueqr poeeequr poeeeqru
poeeeuqr poeeeurq poeeeruq poeeerqu poereque poereqeu poereuqe poereueq poereeuq poereequ poerqeue
poerqeeu poerquee poerquee poerqeue poerqeeu poeruqee poeruqee poerueqe poerueeq poerueeq poerueqe
poereque poereqeu poereuqe poereueq poereeuq poereequ poeqreue poeqreeu poeqruee poeqruee poeqreue
poeqreeu poeqerue poeqereu poeqeure poeqeuer poeqeeur poeqeeru poequere poequeer poequree poequree
poequere poequeer poeqeeur poeqeeru poeqeuer poeqeure poeqerue poeqereu poeurqee poeurqee poeureqe
poeureeq poeureeq poeureqe poeuqree poeuqree poeuqere poeuqeer poeuqeer poeuqere poeueqre poeueqer
poeuerqe poeuereq poeueerq poeueeqr poeueqer poeueqre poeueeqr poeueerq poeuereq poeuerqe poeerque
poeerqeu poeeruqe poeerueq poeereuq poeerequ poeeqrue poeeqreu poeequre poeequer poeeqeur poeeqeru
poeeuqre poeeuqer poeeurqe poeeureq poeeuerq poeeueqr poeeequr poeeeqru poeeeuqr poeeeurq poeeeruq
poeeerqu poqeerue poqeereu poqeeure poqeeuer poqeeeur poqeeeru poqereue poqereeu poqeruee poqeruee
poqereue poqereeu poqeuree poqeuree poqeuere poqeueer poqeueer poqeuere poqeerue poqeereu poqeeure
poqeeuer poqeeeur poqeeeru poqeerue poqeereu poqeeure poqeeuer poqeeeur poqeeeru poqereue poqereeu
poqeruee poqeruee poqereue poqereeu poqeuree poqeuree poqeuere poqeueer poqeueer poqeuere poqeerue
poqeereu poqeeure poqeeuer poqeeeur poqeeeru poqreeue poqreeeu poqreuee poqreuee poqreeue poqreeeu
poqreeue poqreeeu poqreuee poqreuee poqreeue poqreeeu poqrueee poqrueee poqrueee poqrueee poqrueee
poqrueee poqreeue poqreeeu poqreuee poqreuee poqreeue poqreeeu poqueree poqueree poqueere poqueeer
poqueeer poqueere poqureee poqureee poqureee poqureee poqureee poqureee poqueree poqueree poqueere
poqueeer poqueeer poqueere poqueree poqueree poqueere poqueeer poqueeer poqueere poqeerue poqeereu
poqeeure poqeeuer poqeeeur poqeeeru poqereue poqereeu poqeruee poqeruee poqereue poqereeu poqeuree
poqeuree poqeuere poqeueer poqeueer poqeuere poqeerue poqeereu poqeeure poqeeuer poqeeeur poqeeeru
poueeqre poueeqer poueerqe poueereq poueeerq poueeeqr poueqere poueqeer poueqree poueqree poueqere
poueqeer pouerqee pouerqee pouereqe pouereeq pouereeq pouereqe poueeqre poueeqer poueerqe poueereq
poueeerq poueeeqr poueeqre poueeqer poueerqe poueereq poueeerq poueeeqr poueqere poueqeer poueqree
poueqree poueqere poueqeer pouerqee pouerqee pouereqe pouereeq pouereeq pouereqe poueeqre poueeqer
poueerqe poueereq poueeerq poueeeqr pouqeere pouqeeer pouqeree pouqeree pouqeere pouqeeer pouqeere
pouqeeer pouqeree pouqeree pouqeere pouqeeer pouqreee pouqreee pouqreee pouqreee pouqreee pouqreee
pouqeere pouqeeer pouqeree pouqeree pouqeere pouqeeer poureqee poureqee poureeqe poureeeq poureeeq
poureeqe pourqeee pourqeee pourqeee pourqeee pourqeee pourqeee poureqee poureqee poureeqe poureeeq
poureeeq poureeqe poureqee poureqee poureeqe poureeeq poureeeq poureeqe poueeqre poueeqer poueerqe
poueereq poueeerq poueeeqr poueqere poueqeer poueqree poueqree poueqere poueqeer pouerqee pouerqee
pouereqe pouereeq pouereeq pouereqe poueeqre poueeqer poueerqe poueereq poueeerq poueeeqr poeeequr
poeeeqru poeeeuqr poeeeurq poeeeruq poeeerqu poeeqeur poeeqeru poeequer poeequre poeeqrue poeeqreu
poeeuqer poeeuqre poeeueqr poeeuerq poeeureq poeeurqe poeerque poeerqeu poeeruqe poeerueq poeereuq
poeerequ poeeequr poeeeqru poeeeuqr poeeeurq poeeeruq poeeerqu poeeqeur poeeqeru poeequer poeequre
poeeqrue poeeqreu poeeuqer poeeuqre poeeueqr poeeuerq poeeureq poeeurqe poeerque poeerqeu poeeruqe
poeerueq poeereuq poeerequ poeqeeur poeqeeru poeqeuer poeqeure poeqerue poeqereu poeqeeur poeqeeru
poeqeuer poeqeure poeqerue poeqereu poequeer poequere poequeer poequere poequree poequree poeqreue
poeqreeu poeqruee poeqruee poeqreue poeqreeu poeueqer poeueqre poeueeqr poeueerq poeuereq poeuerqe
poeuqeer poeuqere poeuqeer poeuqere poeuqree poeuqree poeueqer poeueqre poeueeqr poeueerq poeuereq
poeuerqe poeurqee poeurqee poeureqe poeureeq poeureeq poeureqe poereque poereqeu poereuqe poereueq
poereeuq poereequ poerqeue poerqeeu poerquee poerquee poerqeue poerqeeu poeruqee poeruqee poerueqe
poerueeq poerueeq poerueqe poereque poereqeu poereuqe poereueq poereeuq poereequ pqreoeue pqreoeeu
pqreouee pqreouee pqreoeue pqreoeeu pqreeoue pqreeoeu pqreeuoe pqreeueo pqreeeuo pqreeeou pqreueoe
pqreueeo pqreuoee pqreuoee pqreueoe pqreueeo pqreeeuo pqreeeou pqreeueo pqreeuoe pqreeoue pqreeoeu
pqroeeue pqroeeeu pqroeuee pqroeuee pqroeeue pqroeeeu pqroeeue pqroeeeu pqroeuee pqroeuee pqroeeue
pqroeeeu pqroueee pqroueee pqroueee pqroueee pqroueee pqroueee pqroeeue pqroeeeu pqroeuee pqroeuee
pqroeeue pqroeeeu pqreoeue pqreoeeu pqreouee pqreouee pqreoeue pqreoeeu pqreeoue pqreeoeu pqreeuoe
pqreeueo pqreeeuo pqreeeou pqreueoe pqreueeo pqreuoee pqreuoee pqreueoe pqreueeo pqreeeuo pqreeeou
pqreeueo pqreeuoe pqreeoue pqreeoeu pqruoeee pqruoeee pqruoeee pqruoeee pqruoeee pqruoeee pqrueoee
pqrueoee pqrueeoe pqrueeeo pqrueeeo pqrueeoe pqrueeoe pqrueeeo pqrueoee pqrueoee pqrueeoe pqrueeeo
pqrueeeo pqrueeoe pqrueeeo pqrueeoe pqrueoee pqrueoee pqreoeue pqreoeeu pqreouee pqreouee pqreoeue
pqreoeeu pqreeoue pqreeoeu pqreeuoe pqreeueo pqreeeuo pqreeeou pqreueoe pqreueeo pqreuoee pqreuoee
pqreueoe pqreueeo pqreeeuo pqreeeou pqreeueo pqreeuoe pqreeoue pqreeoeu pqeroeue pqeroeeu pqerouee
pqerouee pqeroeue pqeroeeu pqereoue pqereoeu pqereuoe pqereueo pqereeuo pqereeou pqerueoe pqerueeo
pqeruoee pqeruoee pqerueoe pqerueeo pqereeuo pqereeou pqereueo pqereuoe pqereoue pqereoeu pqeoreue
pqeoreeu pqeoruee pqeoruee pqeoreue pqeoreeu pqeoerue pqeoereu pqeoeure pqeoeuer pqeoeeur pqeoeeru
pqeouere pqeoueer pqeouree pqeouree pqeouere pqeoueer pqeoeeur pqeoeeru pqeoeuer pqeoeure pqeoerue
pqeoereu pqeeorue pqeeoreu pqeeoure pqeeouer pqeeoeur pqeeoeru pqeeroue pqeeroeu pqeeruoe pqeerueo
pqeereuo pqeereou pqeeuroe pqeeureo pqeeuore pqeeuoer pqeeueor pqeeuero pqeeeruo pqeeerou pqeeeuro
pqeeeuor pqeeeour pqeeeoru pqeuoere pqeuoeer pqeuoree pqeuoree pqeuoere pqeuoeer pqeueore pqeueoer
pqeueroe pqeuereo pqeueero pqeueeor pqeureoe pqeureeo pqeuroee pqeuroee pqeureoe pqeureeo pqeueero
pqeueeor pqeuereo pqeueroe pqeueore pqeueoer pqeeoeur pqeeoeru pqeeouer pqeeoure pqeeorue pqeeoreu
pqeeeour pqeeeoru pqeeeuor pqeeeuro pqeeeruo pqeeerou pqeeueor pqeeuero pqeeuoer pqeeuore pqeeuroe
pqeeureo pqeereuo pqeereou pqeerueo pqeeruoe pqeeroue pqeeroeu pqoereue pqoereeu pqoeruee pqoeruee
pqoereue pqoereeu pqoeerue pqoeereu pqoeeure pqoeeuer pqoeeeur pqoeeeru pqoeuere pqoeueer pqoeuree
pqoeuree pqoeuere pqoeueer pqoeeeur pqoeeeru pqoeeuer pqoeeure pqoeerue pqoeereu pqoreeue pqoreeeu
pqoreuee pqoreuee pqoreeue pqoreeeu pqoreeue pqoreeeu pqoreuee pqoreuee pqoreeue pqoreeeu pqorueee
pqorueee pqorueee pqorueee pqorueee pqorueee pqoreeue pqoreeeu pqoreuee pqoreuee pqoreeue pqoreeeu
pqoereue pqoereeu pqoeruee pqoeruee pqoereue pqoereeu pqoeerue pqoeereu pqoeeure pqoeeuer pqoeeeur
pqoeeeru pqoeuere pqoeueer pqoeuree pqoeuree pqoeuere pqoeueer pqoeeeur pqoeeeru pqoeeuer pqoeeure
pqoeerue pqoeereu pqoureee pqoureee pqoureee pqoureee pqoureee pqoureee pqoueree pqoueree pqoueere
pqoueeer pqoueeer pqoueere pqoueere pqoueeer pqoueree pqoueree pqoueere pqoueeer pqoueeer pqoueere
pqoueeer pqoueere pqoueree pqoueree pqoereue pqoereeu pqoeruee pqoeruee pqoereue pqoereeu pqoeerue
pqoeereu pqoeeure pqoeeuer pqoeeeur pqoeeeru pqoeuere pqoeueer pqoeuree pqoeuree pqoeuere pqoeueer
pqoeeeur pqoeeeru pqoeeuer pqoeeure pqoeerue pqoeereu pqeeorue pqeeoreu pqeeoure pqeeouer pqeeoeur
pqeeoeru pqeeroue pqeeroeu pqeeruoe pqeerueo pqeereuo pqeereou pqeeuroe pqeeureo pqeeuore pqeeuoer
pqeeueor pqeeuero pqeeeruo pqeeerou pqeeeuro pqeeeuor pqeeeour pqeeeoru pqeoerue pqeoereu pqeoeure
pqeoeuer pqeoeeur pqeoeeru pqeoreue pqeoreeu pqeoruee pqeoruee pqeoreue pqeoreeu pqeouree pqeouree
pqeouere pqeoueer pqeoueer pqeouere pqeoerue pqeoereu pqeoeure pqeoeuer pqeoeeur pqeoeeru pqeroeue
pqeroeeu pqerouee pqerouee pqeroeue pqeroeeu pqereoue pqereoeu pqereuoe pqereueo pqereeuo pqereeou
pqerueoe pqerueeo pqeruoee pqeruoee pqerueoe pqerueeo pqereeuo pqereeou pqereueo pqereuoe pqereoue
pqereoeu pqeuoree pqeuoree pqeuoere pqeuoeer pqeuoeer pqeuoere pqeuroee pqeuroee pqeureoe pqeureeo
pqeureeo pqeureoe pqeueroe pqeuereo pqeueore pqeueoer pqeueeor pqeueero pqeuereo pqeueroe pqeueero
pqeueeor pqeueoer pqeueore pqeeorue pqeeoreu pqeeoure pqeeouer pqeeoeur pqeeoeru pqeeroue pqeeroeu
pqeeruoe pqeerueo pqeereuo pqeereou pqeeuroe pqeeureo pqeeuore pqeeuoer pqeeueor pqeeuero pqeeeruo
pqeeerou pqeeeuro pqeeeuor pqeeeour pqeeeoru pqueoere pqueoeer pqueoree pqueoree pqueoere pqueoeer
pqueeore pqueeoer pqueeroe pqueereo pqueeero pqueeeor pquereoe pquereeo pqueroee pqueroee pquereoe
pquereeo pqueeero pqueeeor pqueereo pqueeroe pqueeore pqueeoer pquoeere pquoeeer pquoeree pquoeree
pquoeere pquoeeer pquoeere pquoeeer pquoeree pquoeree pquoeere pquoeeer pquoreee pquoreee pquoreee
pquoreee pquoreee pquoreee pquoeere pquoeeer pquoeree pquoeree pquoeere pquoeeer pqueoere pqueoeer
pqueoree pqueoree pqueoere pqueoeer pqueeore pqueeoer pqueeroe pqueereo pqueeero pqueeeor pquereoe
pquereeo pqueroee pqueroee pquereoe pquereeo pqueeero pqueeeor pqueereo pqueeroe pqueeore pqueeoer
pquroeee pquroeee pquroeee pquroeee pquroeee pquroeee pqureoee pqureoee pqureeoe pqureeeo pqureeeo
pqureeoe pqureeoe pqureeeo pqureoee pqureoee pqureeoe pqureeeo pqureeeo pqureeoe pqureeeo pqureeoe
pqureoee pqureoee pqueoere pqueoeer pqueoree pqueoree pqueoere pqueoeer pqueeore pqueeoer pqueeroe
pqueereo pqueeero pqueeeor pquereoe pquereeo pqueroee pqueroee pquereoe pquereeo pqueeero pqueeeor
pqueereo pqueeroe pqueeore pqueeoer pqeeoeur pqeeoeru pqeeouer pqeeoure pqeeorue pqeeoreu pqeeeour
pqeeeoru pqeeeuor pqeeeuro pqeeeruo pqeeerou pqeeueor pqeeuero pqeeuoer pqeeuore pqeeuroe pqeeureo
pqeereuo pqeereou pqeerueo pqeeruoe pqeeroue pqeeroeu pqeoeeur pqeoeeru pqeoeuer pqeoeure pqeoerue
pqeoereu pqeoeeur pqeoeeru pqeoeuer pqeoeure pqeoerue pqeoereu pqeoueer pqeouere pqeoueer pqeouere
pqeouree pqeouree pqeoreue pqeoreeu pqeoruee pqeoruee pqeoreue pqeoreeu pqeeoeur pqeeoeru pqeeouer
pqeeoure pqeeorue pqeeoreu pqeeeour pqeeeoru pqeeeuor pqeeeuro pqeeeruo pqeeerou pqeeueor pqeeuero
pqeeuoer pqeeuore pqeeuroe pqeeureo pqeereuo pqeereou pqeerueo pqeeruoe pqeeroue pqeeroeu pqeuoeer
pqeuoere pqeuoeer pqeuoere pqeuoree pqeuoree pqeueoer pqeueore pqeueeor pqeueero pqeuereo pqeueroe
pqeueeor pqeueero pqeueoer pqeueore pqeueroe pqeuereo pqeureeo pqeureoe pqeureeo pqeureoe pqeuroee
pqeuroee pqeroeue pqeroeeu pqerouee pqerouee pqeroeue pqeroeeu pqereoue pqereoeu pqereuoe pqereueo
pqereeuo pqereeou pqerueoe pqerueeo pqeruoee pqeruoee pqerueoe pqerueeo pqereeuo pqereeou pqereueo
pqereuoe pqereoue pqereoeu pureoqee pureoqee pureoeqe pureoeeq pureoeeq pureoeqe pureqoee pureqoee
pureqeoe pureqeeo pureqeeo pureqeoe pureeqoe pureeqeo pureeoqe pureeoeq pureeeoq pureeeqo pureeqeo
pureeqoe pureeeqo pureeeoq pureeoeq pureeoqe puroeqee puroeqee puroeeqe puroeeeq puroeeeq puroeeqe
puroqeee puroqeee puroqeee puroqeee puroqeee puroqeee puroeqee puroeqee puroeeqe puroeeeq puroeeeq
puroeeqe puroeqee puroeqee puroeeqe puroeeeq puroeeeq puroeeqe purqoeee purqoeee purqoeee purqoeee
purqoeee purqoeee purqeoee purqeoee purqeeoe purqeeeo purqeeeo purqeeoe purqeeoe purqeeeo purqeoee
purqeoee purqeeoe purqeeeo purqeeeo purqeeoe purqeeeo purqeeoe purqeoee purqeoee pureoqee pureoqee
pureoeqe pureoeeq pureoeeq pureoeqe pureqoee pureqoee pureqeoe pureqeeo pureqeeo pureqeoe pureeqoe
pureeqeo pureeoqe pureeoeq pureeeoq pureeeqo pureeqeo pureeqoe pureeeqo pureeeoq pureeoeq pureeoqe
pureoqee pureoqee pureoeqe pureoeeq pureoeeq pureoeqe pureqoee pureqoee pureqeoe pureqeeo pureqeeo
pureqeoe pureeqoe pureeqeo pureeoqe pureeoeq pureeeoq pureeeqo pureeqeo pureeqoe pureeeqo pureeeoq
pureeoeq pureeoqe pueroqee pueroqee pueroeqe pueroeeq pueroeeq pueroeqe puerqoee puerqoee puerqeoe
puerqeeo puerqeeo puerqeoe puereqoe puereqeo puereoqe puereoeq puereeoq puereeqo puereqeo puereqoe
puereeqo puereeoq puereoeq puereoqe pueorqee pueorqee pueoreqe pueoreeq pueoreeq pueoreqe pueoqree
pueoqree pueoqere pueoqeer pueoqeer pueoqere pueoeqre pueoeqer pueoerqe pueoereq pueoeerq pueoeeqr
pueoeqer pueoeqre pueoeeqr pueoeerq pueoereq pueoerqe pueqoree pueqoree pueqoere pueqoeer pueqoeer
pueqoere pueqroee pueqroee pueqreoe pueqreeo pueqreeo pueqreoe pueqeroe pueqereo pueqeore pueqeoer
pueqeeor pueqeero pueqereo pueqeroe pueqeero pueqeeor pueqeoer pueqeore pueeoqre pueeoqer pueeorqe
pueeoreq pueeoerq pueeoeqr pueeqore pueeqoer pueeqroe pueeqreo pueeqero pueeqeor pueerqoe pueerqeo
pueeroqe pueeroeq pueereoq pueereqo pueeeqro pueeeqor pueeerqo pueeeroq pueeeorq pueeeoqr pueeoqer
pueeoqre pueeoeqr pueeoerq pueeoreq pueeorqe pueeqoer pueeqore pueeqeor pueeqero pueeqreo pueeqroe
pueeeqor pueeeqro pueeeoqr pueeeorq pueeeroq pueeerqo pueerqeo pueerqoe pueereqo pueereoq pueeroeq
pueeroqe puoerqee puoerqee puoereqe puoereeq puoereeq puoereqe puoeqree puoeqree puoeqere puoeqeer
puoeqeer puoeqere puoeeqre puoeeqer puoeerqe puoeereq puoeeerq puoeeeqr puoeeqer puoeeqre puoeeeqr
puoeeerq puoeereq puoeerqe puoreqee puoreqee puoreeqe puoreeeq puoreeeq puoreeqe puorqeee puorqeee
puorqeee puorqeee puorqeee puorqeee puoreqee puoreqee puoreeqe puoreeeq puoreeeq puoreeqe puoreqee
puoreqee puoreeqe puoreeeq puoreeeq puoreeqe puoqreee puoqreee puoqreee puoqreee puoqreee puoqreee
puoqeree puoqeree puoqeere puoqeeer puoqeeer puoqeere puoqeere puoqeeer puoqeree puoqeree puoqeere
puoqeeer puoqeeer puoqeere puoqeeer puoqeere puoqeree puoqeree puoerqee puoerqee puoereqe puoereeq
puoereeq puoereqe puoeqree puoeqree puoeqere puoeqeer puoeqeer puoeqere puoeeqre puoeeqer puoeerqe
puoeereq puoeeerq puoeeeqr puoeeqer puoeeqre puoeeeqr puoeeerq puoeereq puoeerqe puoerqee puoerqee
puoereqe puoereeq puoereeq puoereqe puoeqree puoeqree puoeqere puoeqeer puoeqeer puoeqere puoeeqre
puoeeqer puoeerqe puoeereq puoeeerq puoeeeqr puoeeqer puoeeqre puoeeeqr puoeeerq puoeereq puoeerqe
puqeoree puqeoree puqeoere puqeoeer puqeoeer puqeoere puqeroee puqeroee puqereoe puqereeo puqereeo
puqereoe puqeeroe puqeereo puqeeore puqeeoer puqeeeor puqeeero puqeereo puqeeroe puqeeero puqeeeor
puqeeoer puqeeore puqoeree puqoeree puqoeere puqoeeer puqoeeer puqoeere puqoreee puqoreee puqoreee
puqoreee puqoreee puqoreee puqoeree puqoeree puqoeere puqoeeer puqoeeer puqoeere puqoeree puqoeree
puqoeere puqoeeer puqoeeer puqoeere puqroeee puqroeee puqroeee puqroeee puqroeee puqroeee puqreoee
puqreoee puqreeoe puqreeeo puqreeeo puqreeoe puqreeoe puqreeeo puqreoee puqreoee puqreeoe puqreeeo
puqreeeo puqreeoe puqreeeo puqreeoe puqreoee puqreoee puqeoree puqeoree puqeoere puqeoeer puqeoeer
puqeoere puqeroee puqeroee puqereoe puqereeo puqereeo puqereoe puqeeroe puqeereo puqeeore puqeeoer
puqeeeor puqeeero puqeereo puqeeroe puqeeero puqeeeor puqeeoer puqeeore puqeoree puqeoree puqeoere
puqeoeer puqeoeer puqeoere puqeroee puqeroee puqereoe puqereeo puqereeo puqereoe puqeeroe puqeereo
puqeeore puqeeoer puqeeeor puqeeero puqeereo puqeeroe puqeeero puqeeeor puqeeoer puqeeore pueeoqre
pueeoqer pueeorqe pueeoreq pueeoerq pueeoeqr pueeqore pueeqoer pueeqroe pueeqreo pueeqero pueeqeor
pueerqoe pueerqeo pueeroqe pueeroeq pueereoq pueereqo pueeeqro pueeeqor pueeerqo pueeeroq pueeeorq
pueeeoqr pueoeqre pueoeqer pueoerqe pueoereq pueoeerq pueoeeqr pueoqere pueoqeer pueoqree pueoqree
pueoqere pueoqeer pueorqee pueorqee pueoreqe pueoreeq pueoreeq pueoreqe pueoeqre pueoeqer pueoerqe
pueoereq pueoeerq pueoeeqr pueqoere pueqoeer pueqoree pueqoree pueqoere pueqoeer pueqeore pueqeoer
pueqeroe pueqereo pueqeero pueqeeor pueqreoe pueqreeo pueqroee pueqroee pueqreoe pueqreeo pueqeero
pueqeeor pueqereo pueqeroe pueqeore pueqeoer pueroqee pueroqee pueroeqe pueroeeq pueroeeq pueroeqe
puerqoee puerqoee puerqeoe puerqeeo puerqeeo puerqeoe puereqoe puereqeo puereoqe puereoeq puereeoq
puereeqo puereqeo puereqoe puereeqo puereeoq puereoeq puereoqe pueeoqre pueeoqer pueeorqe pueeoreq
pueeoerq pueeoeqr pueeqore pueeqoer pueeqroe pueeqreo pueeqero pueeqeor pueerqoe pueerqeo pueeroqe
pueeroeq pueereoq pueereqo pueeeqro pueeeqor pueeerqo pueeeroq pueeeorq pueeeoqr pueeoqer pueeoqre
pueeoeqr pueeoerq pueeoreq pueeorqe pueeqoer pueeqore pueeqeor pueeqero pueeqreo pueeqroe pueeeqor
pueeeqro pueeeoqr pueeeorq pueeeroq pueeerqo pueerqeo pueerqoe pueereqo pueereoq pueeroeq pueeroqe
pueoeqer pueoeqre pueoeeqr pueoeerq pueoereq pueoerqe pueoqeer pueoqere pueoqeer pueoqere pueoqree
pueoqree pueoeqer pueoeqre pueoeeqr pueoeerq pueoereq pueoerqe pueorqee pueorqee pueoreqe pueoreeq
pueoreeq pueoreqe pueqoeer pueqoere pueqoeer pueqoere pueqoree pueqoree pueqeoer pueqeore pueqeeor
pueqeero pueqereo pueqeroe pueqeeor pueqeero pueqeoer pueqeore pueqeroe pueqereo pueqreeo pueqreoe
pueqreeo pueqreoe pueqroee pueqroee pueeoqer pueeoqre pueeoeqr pueeoerq pueeoreq pueeorqe pueeqoer
pueeqore pueeqeor pueeqero pueeqreo pueeqroe pueeeqor pueeeqro pueeeoqr pueeeorq pueeeroq pueeerqo
pueerqeo pueerqoe pueereqo pueereoq pueeroeq pueeroqe pueroqee pueroqee pueroeqe pueroeeq pueroeeq
pueroeqe puerqoee puerqoee puerqeoe puerqeeo puerqeeo puerqeoe puereqoe puereqeo puereoqe puereoeq
puereeoq puereeqo puereqeo puereqoe puereeqo puereeoq puereoeq puereoqe pereoque pereoqeu pereouqe
pereoueq pereoeuq pereoequ pereqoue pereqoeu perequoe perequeo pereqeuo pereqeou pereuqoe pereuqeo
pereuoqe pereuoeq pereueoq pereueqo pereequo pereeqou pereeuqo pereeuoq pereeouq pereeoqu peroeque
peroeqeu peroeuqe peroeueq peroeeuq peroeequ peroqeue peroqeeu peroquee peroquee peroqeue peroqeeu
perouqee perouqee peroueqe peroueeq peroueeq peroueqe peroeque peroeqeu peroeuqe peroeueq peroeeuq
peroeequ perqoeue perqoeeu perqouee perqouee perqoeue perqoeeu perqeoue perqeoeu perqeuoe perqeueo
perqeeuo perqeeou perqueoe perqueeo perquoee perquoee perqueoe perqueeo perqeeuo perqeeou perqeueo
perqeuoe perqeoue perqeoeu peruoqee peruoqee peruoeqe peruoeeq peruoeeq peruoeqe peruqoee peruqoee
peruqeoe peruqeeo peruqeeo peruqeoe perueqoe perueqeo perueoqe perueoeq perueeoq perueeqo perueqeo
perueqoe perueeqo perueeoq perueoeq perueoqe pereoque pereoqeu pereouqe pereoueq pereoeuq pereoequ
pereqoue pereqoeu perequoe perequeo pereqeuo pereqeou pereuqoe pereuqeo pereuoqe pereuoeq pereueoq
pereueqo pereequo pereeqou pereeuqo pereeuoq pereeouq pereeoqu peeroque peeroqeu peerouqe peeroueq
peeroeuq peeroequ peerqoue peerqoeu peerquoe peerqueo peerqeuo peerqeou peeruqoe peeruqeo peeruoqe
peeruoeq peerueoq peerueqo peerequo peereqou peereuqo peereuoq peereouq peereoqu peeorque peeorqeu
peeoruqe peeorueq peeoreuq peeorequ peeoqrue peeoqreu peeoqure peeoquer peeoqeur peeoqeru peeouqre
peeouqer peeourqe peeoureq peeouerq peeoueqr peeoequr peeoeqru peeoeuqr peeoeurq peeoeruq peeoerqu
peeqorue peeqoreu peeqoure peeqouer peeqoeur peeqoeru peeqroue peeqroeu peeqruoe peeqrueo peeqreuo
peeqreou peequroe peequreo peequore peequoer peequeor peequero peeqeruo peeqerou peeqeuro peeqeuor
peeqeour peeqeoru peeuoqre peeuoqer peeuorqe peeuoreq peeuoerq peeuoeqr peeuqore peeuqoer peeuqroe
peeuqreo peeuqero peeuqeor peeurqoe peeurqeo peeuroqe peeuroeq peeureoq peeureqo peeueqro peeueqor
peeuerqo peeueroq peeueorq peeueoqr peeeoqur peeeoqru peeeouqr peeeourq peeeoruq peeeorqu peeeqour
peeeqoru peeequor peeequro peeeqruo peeeqrou peeeuqor peeeuqro peeeuoqr peeeuorq peeeuroq peeeurqo
peeerquo peeerqou peeeruqo peeeruoq peeerouq peeeroqu peoerque peoerqeu peoeruqe peoerueq peoereuq
peoerequ peoeqrue peoeqreu peoequre peoequer peoeqeur peoeqeru peoeuqre peoeuqer peoeurqe peoeureq
peoeuerq peoeueqr peoeequr peoeeqru peoeeuqr peoeeurq peoeeruq peoeerqu peoreque peoreqeu peoreuqe
peoreueq peoreeuq peoreequ peorqeue peorqeeu peorquee peorquee peorqeue peorqeeu peoruqee peoruqee
peorueqe peorueeq peorueeq peorueqe peoreque peoreqeu peoreuqe peoreueq peoreeuq peoreequ peoqreue
peoqreeu peoqruee peoqruee peoqreue peoqreeu peoqerue peoqereu peoqeure peoqeuer peoqeeur peoqeeru
peoquere peoqueer peoquree peoquree peoquere peoqueer peoqeeur peoqeeru peoqeuer peoqeure peoqerue
peoqereu peourqee peourqee peoureqe peoureeq peoureeq peoureqe peouqree peouqree peouqere peouqeer
peouqeer peouqere peoueqre peoueqer peouerqe peouereq peoueerq peoueeqr peoueqer peoueqre peoueeqr
peoueerq peouereq peouerqe peoerque peoerqeu peoeruqe peoerueq peoereuq peoerequ peoeqrue peoeqreu
peoequre peoequer peoeqeur peoeqeru peoeuqre peoeuqer peoeurqe peoeureq peoeuerq peoeueqr peoeequr
peoeeqru peoeeuqr peoeeurq peoeeruq peoeerqu peqeorue peqeoreu peqeoure peqeouer peqeoeur peqeoeru
peqeroue peqeroeu peqeruoe peqerueo peqereuo peqereou peqeuroe peqeureo peqeuore peqeuoer peqeueor
peqeuero peqeeruo peqeerou peqeeuro peqeeuor peqeeour peqeeoru peqoerue peqoereu peqoeure peqoeuer
peqoeeur peqoeeru peqoreue peqoreeu peqoruee peqoruee peqoreue peqoreeu peqouree peqouree peqouere
peqoueer peqoueer peqouere peqoerue peqoereu peqoeure peqoeuer peqoeeur peqoeeru peqroeue peqroeeu
peqrouee peqrouee peqroeue peqroeeu peqreoue peqreoeu peqreuoe peqreueo peqreeuo peqreeou peqrueoe
peqrueeo peqruoee peqruoee peqrueoe peqrueeo peqreeuo peqreeou peqreueo peqreuoe peqreoue peqreoeu
pequoree pequoree pequoere pequoeer pequoeer pequoere pequroee pequroee pequreoe pequreeo pequreeo
pequreoe pequeroe pequereo pequeore pequeoer pequeeor pequeero pequereo pequeroe pequeero pequeeor
pequeoer pequeore peqeorue peqeoreu peqeoure peqeouer peqeoeur peqeoeru peqeroue peqeroeu peqeruoe
peqerueo peqereuo peqereou peqeuroe peqeureo peqeuore peqeuoer peqeueor peqeuero peqeeruo peqeerou
peqeeuro peqeeuor peqeeour peqeeoru peueoqre peueoqer peueorqe peueoreq peueoerq peueoeqr peueqore
peueqoer peueqroe peueqreo peueqero peueqeor peuerqoe peuerqeo peueroqe peueroeq peuereoq peuereqo
peueeqro peueeqor peueerqo peueeroq peueeorq peueeoqr peuoeqre peuoeqer peuoerqe peuoereq peuoeerq
peuoeeqr peuoqere peuoqeer peuoqree peuoqree peuoqere peuoqeer peuorqee peuorqee peuoreqe peuoreeq
peuoreeq peuoreqe peuoeqre peuoeqer peuoerqe peuoereq peuoeerq peuoeeqr peuqoere peuqoeer peuqoree
peuqoree peuqoere peuqoeer peuqeore peuqeoer peuqeroe peuqereo peuqeero peuqeeor peuqreoe peuqreeo
peuqroee peuqroee peuqreoe peuqreeo peuqeero peuqeeor peuqereo peuqeroe peuqeore peuqeoer peuroqee
peuroqee peuroeqe peuroeeq peuroeeq peuroeqe peurqoee peurqoee peurqeoe peurqeeo peurqeeo peurqeoe
peureqoe peureqeo peureoqe peureoeq peureeoq peureeqo peureqeo peureqoe peureeqo peureeoq peureoeq
peureoqe peueoqre peueoqer peueorqe peueoreq peueoerq peueoeqr peueqore peueqoer peueqroe peueqreo
peueqero peueqeor peuerqoe peuerqeo peueroqe peueroeq peuereoq peuereqo peueeqro peueeqor peueerqo
peueeroq peueeorq peueeoqr peeeoqur peeeoqru peeeouqr peeeourq peeeoruq peeeorqu peeeqour peeeqoru
peeequor peeequro peeeqruo peeeqrou peeeuqor peeeuqro peeeuoqr peeeuorq peeeuroq peeeurqo peeerquo
peeerqou peeeruqo peeeruoq peeerouq peeeroqu peeoequr peeoeqru peeoeuqr peeoeurq peeoeruq peeoerqu
peeoqeur peeoqeru peeoquer peeoqure peeoqrue peeoqreu peeouqer peeouqre peeoueqr peeouerq peeoureq
peeourqe peeorque peeorqeu peeoruqe peeorueq peeoreuq peeorequ peeqoeur peeqoeru peeqouer peeqoure
peeqorue peeqoreu peeqeour peeqeoru peeqeuor peeqeuro peeqeruo peeqerou peequeor peequero peequoer
peequore peequroe peequreo peeqreuo peeqreou peeqrueo peeqruoe peeqroue peeqroeu peeuoqer peeuoqre
peeuoeqr peeuoerq peeuoreq peeuorqe peeuqoer peeuqore peeuqeor peeuqero peeuqreo peeuqroe peeueqor
peeueqro peeueoqr peeueorq peeueroq peeuerqo peeurqeo peeurqoe peeureqo peeureoq peeuroeq peeuroqe
peeroque peeroqeu peerouqe peeroueq peeroeuq peeroequ peerqoue peerqoeu peerquoe peerqueo peerqeuo
peerqeou peeruqoe peeruqeo peeruoqe peeruoeq peerueoq peerueqo peerequo peereqou peereuqo peereuoq
peereouq peereoqu

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us