easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

unwaiting

dextrorsely

unnamed

watase

vulnerem

diggin

taver

balamurali

cobbins

steatomatous

yeara

cotys

reradiates

ostest

liard

zexiang

occidentalism

sibilate


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: papabot
cipher variations:
qbqbcpu rcrcdqv sdsderw tetefsx ufufgty
vgvghuz whwhiva xixijwb yjyjkxc zkzklyd
alalmze bmbmnaf cncnobg dodopch epepqdi
fqfqrej grgrsfk hshstgl itituhm jujuvin
kvkvwjo lwlwxkp mxmxylq nynyzmr ozozans

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: papabot
Cipher: kzkzylg

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: papabot
Cipher: ABBBA AAAAA ABBBA AAAAA AAAAB ABBAB BAABA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: papabot
cipher variations:
qbqbcpuububergybybgtscbcbivegbgbkxqkbkbmzcsbsbqdawbwbsfm
ababuhyebebwjkibibylwmbmbanircrcdqvvcvcfshzczchutdcdcjwf
hchclyrlclcnadtctcrebxcxctgnbcbcvizfcfcxkljcjczmxncncboj
sdsderwwdwdgtiadadivuededkxgididmzsmdmdobeududsfcydyduho
cdcdwjagdgdylmkdkdanyododcpktetefsxxexehujbebejwvfefelyh
jejenatnenepcfvevetgdzezevipdedexkbhehezmnlelebozpepedql
ufufgtyyfyfivkcfcfkxwgfgfmzikfkfobuofofqdgwfwfuheafafwjq
efefylcififanomfmfcpaqfqfermvgvghuzzgzgjwldgdglyxhghgnaj
lglgpcvpgpgrehxgxgvifbgbgxkrfgfgzmdjgjgbopngngdqbrgrgfsn
whwhivaahahkxmehehmzyihihobkmhmhqdwqhqhsfiyhyhwjgchchyls
ghghanekhkhcpqohohercshshgtoxixijwbbibilynfifinazjijipcl
ninirexriritgjzizixkhdidizmthihiboflilidqrpipifsdtitihup
yjyjkxccjcjmzogjgjobakjkjqdmojojsfysjsjuhkajajyliejejanu
ijijcpgmjmjersqjqjgteujujivqzkzklyddkdknaphkhkpcblklkren
pkpktgztktkvilbkbkzmjfkfkbovjkjkdqhnknkfstrkrkhufvkvkjwr
alalmzeelelobqililqdcmlmlsfoqlqluhaululwjmclclankglglcpw
klkleriololgtuslslivgwlwlkxsbmbmnaffmfmpcrjmjmrednmnmtgp
rmrmvibvmvmxkndmdmbolhmhmdqxlmlmfsjpmpmhuvtmtmjwhxmxmlyt
cncnobggngnqdsknknsfeononuhqsnsnwjcwnwnyloenencpmininery
mnmngtkqnqnivwununkxiynynmzudodopchhohoretlolotgfpopovir
totoxkdxoxozmpfofodqnjojofsznonohulrorojwxvovolyjzozonav
epepqdiipipsfumpmpuhgqpqpwjsupupyleypypanqgpgperokpkpgta
opopivmspspkxywpwpmzkapapobwfqfqrejjqjqtgvnqnqvihrqrqxkt
vqvqzmfzqzqborhqhqfsplqlqhubpqpqjwntqtqlyzxqxqnalbqbqpcx
grgrsfkkrkruhwororwjisrsryluwrwrangararcpsirirgtqmrmrivc
qrqrkxoururmzayryrobmcrcrqdyhshstgllslsvixpspsxkjtstszmv
xsxsbohbsbsdqtjsjshurnsnsjwdrsrslypvsvsnabzszspcndsdsrez
itituhmmtmtwjyqtqtylkututanwytytcpictcteruktktivsototkxe
ststmzqwtwtobcatatqdoetetsfajujuvinnunuxkzruruzmlvuvubox
zuzudqjdudufsvlulujwtpupulyftutunarxuxupcdbuburepfufutgb
kvkvwjoovovylasvsvanmwvwvcpyavaverkevevgtwmvmvkxuqvqvmzg
uvuvobsyvyvqdecvcvsfqgvgvuhclwlwxkppwpwzmbtwtwbonxwxwdqz
bwbwfslfwfwhuxnwnwlyvrwrwnahvwvwpctzwzwrefdwdwtgrhwhwvid
mxmxylqqxqxancuxuxcpoyxyxeracxcxgtmgxgxivyoxoxmzwsxsxobi
wxwxqduaxaxsfgexexuhsixixwjenynyzmrryrybodvyvydqpzyzyfsb
dydyhunhyhyjwzpypynaxtytypcjxyxyrevbybytghfyfyvitjyjyxkf
ozozansszszcpewzwzerqazazgtcezezivoizizkxaqzqzobyuzuzqdk
yzyzsfwczczuhigzgzwjukzkzylgpapabottatadqfxaxafsrbabahud
fafajwpjajalybrarapczvavarelzazatgxdadavijhahaxkvlalazmh

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: papabot
Cipher: cncnobg

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: papabot
Cipher: 53115311214344

Extended Methods:
Method #1

Plaintext: papabot
method variations:
ufufgtyzlzlmydeqeqrdikvkvwio

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
p a p a b o t 
5 1 5 1 2 4 4 
3 1 3 1 1 3 4 
They are then read out in rows:
51512443131134
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: papabot
Cipher: eerolas

Read more ...
Method #3

Plaintext: papabot
method variations:
cvcfqsy vcfqsyc cfqsycv
fqsycvc qsycvcf sycvcfq
ycvcfqs

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: papabot

all 5040 cipher variations:
papabot papabto papaobt papaotb papatob papatbo papbaot papbato papboat papbota papbtoa
papbtao papobat papobta papoabt papoatb papotab papotba paptboa paptbao paptoba paptoab
paptaob paptabo paapbot paapbto paapobt paapotb paaptob paaptbo paabpot paabpto paabopt
paabotp paabtop paabtpo paaobpt paaobtp paaopbt paaoptb paaotpb paaotbp paatbop paatbpo
paatobp paatopb paatpob paatpbo pabapot pabapto pabaopt pabaotp pabatop pabatpo pabpaot
pabpato pabpoat pabpota pabptoa pabptao pabopat pabopta paboapt paboatp pabotap pabotpa
pabtpoa pabtpao pabtopa pabtoap pabtaop pabtapo paoabpt paoabtp paoapbt paoaptb paoatpb
paoatbp paobapt paobatp paobpat paobpta paobtpa paobtap paopbat paopbta paopabt paopatb
paoptab paoptba paotbpa paotbap paotpba paotpab paotapb paotabp patabop patabpo pataobp
pataopb patapob patapbo patbaop patbapo patboap patbopa patbpoa patbpao patobap patobpa
patoabp patoapb patopab patopba patpboa patpbao patpoba patpoab patpaob patpabo ppaabot
ppaabto ppaaobt ppaaotb ppaatob ppaatbo ppabaot ppabato ppaboat ppabota ppabtoa ppabtao
ppaobat ppaobta ppaoabt ppaoatb ppaotab ppaotba ppatboa ppatbao ppatoba ppatoab ppataob
ppatabo ppaabot ppaabto ppaaobt ppaaotb ppaatob ppaatbo ppabaot ppabato ppaboat ppabota
ppabtoa ppabtao ppaobat ppaobta ppaoabt ppaoatb ppaotab ppaotba ppatboa ppatbao ppatoba
ppatoab ppataob ppatabo ppbaaot ppbaato ppbaoat ppbaota ppbatoa ppbatao ppbaaot ppbaato
ppbaoat ppbaota ppbatoa ppbatao ppboaat ppboata ppboaat ppboata ppbotaa ppbotaa ppbtaoa
ppbtaao ppbtoaa ppbtoaa ppbtaoa ppbtaao ppoabat ppoabta ppoaabt ppoaatb ppoatab ppoatba
ppobaat ppobata ppobaat ppobata ppobtaa ppobtaa ppoabat ppoabta ppoaabt ppoaatb ppoatab
ppoatba ppotbaa ppotbaa ppotaba ppotaab ppotaab ppotaba pptaboa pptabao pptaoba pptaoab
pptaaob pptaabo pptbaoa pptbaao pptboaa pptboaa pptbaoa pptbaao pptobaa pptobaa pptoaba
pptoaab pptoaab pptoaba pptaboa pptabao pptaoba pptaoab pptaaob pptaabo papabot papabto
papaobt papaotb papatob papatbo papbaot papbato papboat papbota papbtoa papbtao papobat
papobta papoabt papoatb papotab papotba paptboa paptbao paptoba paptoab paptaob paptabo
paapbot paapbto paapobt paapotb paaptob paaptbo paabpot paabpto paabopt paabotp paabtop
paabtpo paaobpt paaobtp paaopbt paaoptb paaotpb paaotbp paatbop paatbpo paatobp paatopb
paatpob paatpbo pabapot pabapto pabaopt pabaotp pabatop pabatpo pabpaot pabpato pabpoat
pabpota pabptoa pabptao pabopat pabopta paboapt paboatp pabotap pabotpa pabtpoa pabtpao
pabtopa pabtoap pabtaop pabtapo paoabpt paoabtp paoapbt paoaptb paoatpb paoatbp paobapt
paobatp paobpat paobpta paobtpa paobtap paopbat paopbta paopabt paopatb paoptab paoptba
paotbpa paotbap paotpba paotpab paotapb paotabp patabop patabpo pataobp pataopb patapob
patapbo patbaop patbapo patboap patbopa patbpoa patbpao patobap patobpa patoabp patoapb
patopab patopba patpboa patpbao patpoba patpoab patpaob patpabo pbpaaot pbpaato pbpaoat
pbpaota pbpatoa pbpatao pbpaaot pbpaato pbpaoat pbpaota pbpatoa pbpatao pbpoaat pbpoata
pbpoaat pbpoata pbpotaa pbpotaa pbptaoa pbptaao pbptoaa pbptoaa pbptaoa pbptaao pbapaot
pbapato pbapoat pbapota pbaptoa pbaptao pbaapot pbaapto pbaaopt pbaaotp pbaatop pbaatpo
pbaoapt pbaoatp pbaopat pbaopta pbaotpa pbaotap pbataop pbatapo pbatoap pbatopa pbatpoa
pbatpao pbaapot pbaapto pbaaopt pbaaotp pbaatop pbaatpo pbapaot pbapato pbapoat pbapota
pbaptoa pbaptao pbaopat pbaopta pbaoapt pbaoatp pbaotap pbaotpa pbatpoa pbatpao pbatopa
pbatoap pbataop pbatapo pboaapt pboaatp pboapat pboapta pboatpa pboatap pboaapt pboaatp
pboapat pboapta pboatpa pboatap pbopaat pbopata pbopaat pbopata pboptaa pboptaa pbotapa
pbotaap pbotpaa pbotpaa pbotapa pbotaap pbtaaop pbtaapo pbtaoap pbtaopa pbtapoa pbtapao
pbtaaop pbtaapo pbtaoap pbtaopa pbtapoa pbtapao pbtoaap pbtoapa pbtoaap pbtoapa pbtopaa
pbtopaa pbtpaoa pbtpaao pbtpoaa pbtpoaa pbtpaoa pbtpaao popabat popabta popaabt popaatb
popatab popatba popbaat popbata popbaat popbata popbtaa popbtaa popabat popabta popaabt
popaatb popatab popatba poptbaa poptbaa poptaba poptaab poptaab poptaba poapbat poapbta
poapabt poapatb poaptab poaptba poabpat poabpta poabapt poabatp poabtap poabtpa poaabpt
poaabtp poaapbt poaaptb poaatpb poaatbp poatbap poatbpa poatabp poatapb poatpab poatpba
pobapat pobapta pobaapt pobaatp pobatap pobatpa pobpaat pobpata pobpaat pobpata pobptaa
pobptaa pobapat pobapta pobaapt pobaatp pobatap pobatpa pobtpaa pobtpaa pobtapa pobtaap
pobtaap pobtapa poaabpt poaabtp poaapbt poaaptb poaatpb poaatbp poabapt poabatp poabpat
poabpta poabtpa poabtap poapbat poapbta poapabt poapatb poaptab poaptba poatbpa poatbap
poatpba poatpab poatapb poatabp potabap potabpa potaabp potaapb potapab potapba potbaap
potbapa potbaap potbapa potbpaa potbpaa potabap potabpa potaabp potaapb potapab potapba
potpbaa potpbaa potpaba potpaab potpaab potpaba ptpaboa ptpabao ptpaoba ptpaoab ptpaaob
ptpaabo ptpbaoa ptpbaao ptpboaa ptpboaa ptpbaoa ptpbaao ptpobaa ptpobaa ptpoaba ptpoaab
ptpoaab ptpoaba ptpaboa ptpabao ptpaoba ptpaoab ptpaaob ptpaabo ptapboa ptapbao ptapoba
ptapoab ptapaob ptapabo ptabpoa ptabpao ptabopa ptaboap ptabaop ptabapo ptaobpa ptaobap
ptaopba ptaopab ptaoapb ptaoabp ptaabop ptaabpo ptaaobp ptaaopb ptaapob ptaapbo ptbapoa
ptbapao ptbaopa ptbaoap ptbaaop ptbaapo ptbpaoa ptbpaao ptbpoaa ptbpoaa ptbpaoa ptbpaao
ptbopaa ptbopaa ptboapa ptboaap ptboaap ptboapa ptbapoa ptbapao ptbaopa ptbaoap ptbaaop
ptbaapo ptoabpa ptoabap ptoapba ptoapab ptoaapb ptoaabp ptobapa ptobaap ptobpaa ptobpaa
ptobapa ptobaap ptopbaa ptopbaa ptopaba ptopaab ptopaab ptopaba ptoabpa ptoabap ptoapba
ptoapab ptoaapb ptoaabp ptaabop ptaabpo ptaaobp ptaaopb ptaapob ptaapbo ptabaop ptabapo
ptaboap ptabopa ptabpoa ptabpao ptaobap ptaobpa ptaoabp ptaoapb ptaopab ptaopba ptapboa
ptapbao ptapoba ptapoab ptapaob ptapabo appabot appabto appaobt appaotb appatob appatbo
appbaot appbato appboat appbota appbtoa appbtao appobat appobta appoabt appoatb appotab
appotba apptboa apptbao apptoba apptoab apptaob apptabo apapbot apapbto apapobt apapotb
apaptob apaptbo apabpot apabpto apabopt apabotp apabtop apabtpo apaobpt apaobtp apaopbt
apaoptb apaotpb apaotbp apatbop apatbpo apatobp apatopb apatpob apatpbo apbapot apbapto
apbaopt apbaotp apbatop apbatpo apbpaot apbpato apbpoat apbpota apbptoa apbptao apbopat
apbopta apboapt apboatp apbotap apbotpa apbtpoa apbtpao apbtopa apbtoap apbtaop apbtapo
apoabpt apoabtp apoapbt apoaptb apoatpb apoatbp apobapt apobatp apobpat apobpta apobtpa
apobtap apopbat apopbta apopabt apopatb apoptab apoptba apotbpa apotbap apotpba apotpab
apotapb apotabp aptabop aptabpo aptaobp aptaopb aptapob aptapbo aptbaop aptbapo aptboap
aptbopa aptbpoa aptbpao aptobap aptobpa aptoabp aptoapb aptopab aptopba aptpboa aptpbao
aptpoba aptpoab aptpaob aptpabo appabot appabto appaobt appaotb appatob appatbo appbaot
appbato appboat appbota appbtoa appbtao appobat appobta appoabt appoatb appotab appotba
apptboa apptbao apptoba apptoab apptaob apptabo apapbot apapbto apapobt apapotb apaptob
apaptbo apabpot apabpto apabopt apabotp apabtop apabtpo apaobpt apaobtp apaopbt apaoptb
apaotpb apaotbp apatbop apatbpo apatobp apatopb apatpob apatpbo apbapot apbapto apbaopt
apbaotp apbatop apbatpo apbpaot apbpato apbpoat apbpota apbptoa apbptao apbopat apbopta
apboapt apboatp apbotap apbotpa apbtpoa apbtpao apbtopa apbtoap apbtaop apbtapo apoabpt
apoabtp apoapbt apoaptb apoatpb apoatbp apobapt apobatp apobpat apobpta apobtpa apobtap
apopbat apopbta apopabt apopatb apoptab apoptba apotbpa apotbap apotpba apotpab apotapb
apotabp aptabop aptabpo aptaobp aptaopb aptapob aptapbo aptbaop aptbapo aptboap aptbopa
aptbpoa aptbpao aptobap aptobpa aptoabp aptoapb aptopab aptopba aptpboa aptpbao aptpoba
aptpoab aptpaob aptpabo aappbot aappbto aappobt aappotb aapptob aapptbo aapbpot aapbpto
aapbopt aapbotp aapbtop aapbtpo aapobpt aapobtp aapopbt aapoptb aapotpb aapotbp aaptbop
aaptbpo aaptobp aaptopb aaptpob aaptpbo aappbot aappbto aappobt aappotb aapptob aapptbo
aapbpot aapbpto aapbopt aapbotp aapbtop aapbtpo aapobpt aapobtp aapopbt aapoptb aapotpb
aapotbp aaptbop aaptbpo aaptobp aaptopb aaptpob aaptpbo aabppot aabppto aabpopt aabpotp
aabptop aabptpo aabppot aabppto aabpopt aabpotp aabptop aabptpo aaboppt aaboptp aaboppt
aaboptp aabotpp aabotpp aabtpop aabtppo aabtopp aabtopp aabtpop aabtppo aaopbpt aaopbtp
aaoppbt aaopptb aaoptpb aaoptbp aaobppt aaobptp aaobppt aaobptp aaobtpp aaobtpp aaopbpt
aaopbtp aaoppbt aaopptb aaoptpb aaoptbp aaotbpp aaotbpp aaotpbp aaotppb aaotppb aaotpbp
aatpbop aatpbpo aatpobp aatpopb aatppob aatppbo aatbpop aatbppo aatbopp aatbopp aatbpop
aatbppo aatobpp aatobpp aatopbp aatoppb aatoppb aatopbp aatpbop aatpbpo aatpobp aatpopb
aatppob aatppbo abpapot abpapto abpaopt abpaotp abpatop abpatpo abppaot abppato abppoat
abppota abpptoa abpptao abpopat abpopta abpoapt abpoatp abpotap abpotpa abptpoa abptpao
abptopa abptoap abptaop abptapo abappot abappto abapopt abapotp abaptop abaptpo abappot
abappto abapopt abapotp abaptop abaptpo abaoppt abaoptp abaoppt abaoptp abaotpp abaotpp
abatpop abatppo abatopp abatopp abatpop abatppo abpapot abpapto abpaopt abpaotp abpatop
abpatpo abppaot abppato abppoat abppota abpptoa abpptao abpopat abpopta abpoapt abpoatp
abpotap abpotpa abptpoa abptpao abptopa abptoap abptaop abptapo aboappt aboaptp aboappt
aboaptp aboatpp aboatpp abopapt abopatp aboppat aboppta aboptpa aboptap aboppat aboppta
abopapt abopatp aboptap aboptpa abotppa abotpap abotppa abotpap abotapp abotapp abtapop
abtappo abtaopp abtaopp abtapop abtappo abtpaop abtpapo abtpoap abtpopa abtppoa abtppao
abtopap abtoppa abtoapp abtoapp abtopap abtoppa abtppoa abtppao abtpopa abtpoap abtpaop
abtpapo aopabpt aopabtp aopapbt aopaptb aopatpb aopatbp aopbapt aopbatp aopbpat aopbpta
aopbtpa aopbtap aoppbat aoppbta aoppabt aoppatb aopptab aopptba aoptbpa aoptbap aoptpba
aoptpab aoptapb aoptabp aoapbpt aoapbtp aoappbt aoapptb aoaptpb aoaptbp aoabppt aoabptp
aoabppt aoabptp aoabtpp aoabtpp aoapbpt aoapbtp aoappbt aoapptb aoaptpb aoaptbp aoatbpp
aoatbpp aoatpbp aoatppb aoatppb aoatpbp aobappt aobaptp aobappt aobaptp aobatpp aobatpp
aobpapt aobpatp aobppat aobppta aobptpa aobptap aobppat aobppta aobpapt aobpatp aobptap
aobptpa aobtppa aobtpap aobtppa aobtpap aobtapp aobtapp aopabpt aopabtp aopapbt aopaptb
aopatpb aopatbp aopbapt aopbatp aopbpat aopbpta aopbtpa aopbtap aoppbat aoppbta aoppabt
aoppatb aopptab aopptba aoptbpa aoptbap aoptpba aoptpab aoptapb aoptabp aotabpp aotabpp
aotapbp aotappb aotappb aotapbp aotbapp aotbapp aotbpap aotbppa aotbppa aotbpap aotpbap
aotpbpa aotpabp aotpapb aotppab aotppba aotpbpa aotpbap aotppba aotppab aotpapb aotpabp
atpabop atpabpo atpaobp atpaopb atpapob atpapbo atpbaop atpbapo atpboap atpbopa atpbpoa
atpbpao atpobap atpobpa atpoabp atpoapb atpopab atpopba atppboa atppbao atppoba atppoab
atppaob atppabo atapbop atapbpo atapobp atapopb atappob atappbo atabpop atabppo atabopp
atabopp atabpop atabppo ataobpp ataobpp ataopbp ataoppb ataoppb ataopbp atapbop atapbpo
atapobp atapopb atappob atappbo atbapop atbappo atbaopp atbaopp atbapop atbappo atbpaop
atbpapo atbpoap atbpopa atbppoa atbppao atbopap atboppa atboapp atboapp atbopap atboppa
atbppoa atbppao atbpopa atbpoap atbpaop atbpapo atoabpp atoabpp atoapbp atoappb atoappb
atoapbp atobapp atobapp atobpap atobppa atobppa atobpap atopbap atopbpa atopabp atopapb
atoppab atoppba atopbpa atopbap atoppba atoppab atopapb atopabp atpabop atpabpo atpaobp
atpaopb atpapob atpapbo atpbaop atpbapo atpboap atpbopa atpbpoa atpbpao atpobap atpobpa
atpoabp atpoapb atpopab atpopba atppboa atppbao atppoba atppoab atppaob atppabo papabot
papabto papaobt papaotb papatob papatbo papbaot papbato papboat papbota papbtoa papbtao
papobat papobta papoabt papoatb papotab papotba paptboa paptbao paptoba paptoab paptaob
paptabo paapbot paapbto paapobt paapotb paaptob paaptbo paabpot paabpto paabopt paabotp
paabtop paabtpo paaobpt paaobtp paaopbt paaoptb paaotpb paaotbp paatbop paatbpo paatobp
paatopb paatpob paatpbo pabapot pabapto pabaopt pabaotp pabatop pabatpo pabpaot pabpato
pabpoat pabpota pabptoa pabptao pabopat pabopta paboapt paboatp pabotap pabotpa pabtpoa
pabtpao pabtopa pabtoap pabtaop pabtapo paoabpt paoabtp paoapbt paoaptb paoatpb paoatbp
paobapt paobatp paobpat paobpta paobtpa paobtap paopbat paopbta paopabt paopatb paoptab
paoptba paotbpa paotbap paotpba paotpab paotapb paotabp patabop patabpo pataobp pataopb
patapob patapbo patbaop patbapo patboap patbopa patbpoa patbpao patobap patobpa patoabp
patoapb patopab patopba patpboa patpbao patpoba patpoab patpaob patpabo ppaabot ppaabto
ppaaobt ppaaotb ppaatob ppaatbo ppabaot ppabato ppaboat ppabota ppabtoa ppabtao ppaobat
ppaobta ppaoabt ppaoatb ppaotab ppaotba ppatboa ppatbao ppatoba ppatoab ppataob ppatabo
ppaabot ppaabto ppaaobt ppaaotb ppaatob ppaatbo ppabaot ppabato ppaboat ppabota ppabtoa
ppabtao ppaobat ppaobta ppaoabt ppaoatb ppaotab ppaotba ppatboa ppatbao ppatoba ppatoab
ppataob ppatabo ppbaaot ppbaato ppbaoat ppbaota ppbatoa ppbatao ppbaaot ppbaato ppbaoat
ppbaota ppbatoa ppbatao ppboaat ppboata ppboaat ppboata ppbotaa ppbotaa ppbtaoa ppbtaao
ppbtoaa ppbtoaa ppbtaoa ppbtaao ppoabat ppoabta ppoaabt ppoaatb ppoatab ppoatba ppobaat
ppobata ppobaat ppobata ppobtaa ppobtaa ppoabat ppoabta ppoaabt ppoaatb ppoatab ppoatba
ppotbaa ppotbaa ppotaba ppotaab ppotaab ppotaba pptaboa pptabao pptaoba pptaoab pptaaob
pptaabo pptbaoa pptbaao pptboaa pptboaa pptbaoa pptbaao pptobaa pptobaa pptoaba pptoaab
pptoaab pptoaba pptaboa pptabao pptaoba pptaoab pptaaob pptaabo papabot papabto papaobt
papaotb papatob papatbo papbaot papbato papboat papbota papbtoa papbtao papobat papobta
papoabt papoatb papotab papotba paptboa paptbao paptoba paptoab paptaob paptabo paapbot
paapbto paapobt paapotb paaptob paaptbo paabpot paabpto paabopt paabotp paabtop paabtpo
paaobpt paaobtp paaopbt paaoptb paaotpb paaotbp paatbop paatbpo paatobp paatopb paatpob
paatpbo pabapot pabapto pabaopt pabaotp pabatop pabatpo pabpaot pabpato pabpoat pabpota
pabptoa pabptao pabopat pabopta paboapt paboatp pabotap pabotpa pabtpoa pabtpao pabtopa
pabtoap pabtaop pabtapo paoabpt paoabtp paoapbt paoaptb paoatpb paoatbp paobapt paobatp
paobpat paobpta paobtpa paobtap paopbat paopbta paopabt paopatb paoptab paoptba paotbpa
paotbap paotpba paotpab paotapb paotabp patabop patabpo pataobp pataopb patapob patapbo
patbaop patbapo patboap patbopa patbpoa patbpao patobap patobpa patoabp patoapb patopab
patopba patpboa patpbao patpoba patpoab patpaob patpabo pbpaaot pbpaato pbpaoat pbpaota
pbpatoa pbpatao pbpaaot pbpaato pbpaoat pbpaota pbpatoa pbpatao pbpoaat pbpoata pbpoaat
pbpoata pbpotaa pbpotaa pbptaoa pbptaao pbptoaa pbptoaa pbptaoa pbptaao pbapaot pbapato
pbapoat pbapota pbaptoa pbaptao pbaapot pbaapto pbaaopt pbaaotp pbaatop pbaatpo pbaoapt
pbaoatp pbaopat pbaopta pbaotpa pbaotap pbataop pbatapo pbatoap pbatopa pbatpoa pbatpao
pbaapot pbaapto pbaaopt pbaaotp pbaatop pbaatpo pbapaot pbapato pbapoat pbapota pbaptoa
pbaptao pbaopat pbaopta pbaoapt pbaoatp pbaotap pbaotpa pbatpoa pbatpao pbatopa pbatoap
pbataop pbatapo pboaapt pboaatp pboapat pboapta pboatpa pboatap pboaapt pboaatp pboapat
pboapta pboatpa pboatap pbopaat pbopata pbopaat pbopata pboptaa pboptaa pbotapa pbotaap
pbotpaa pbotpaa pbotapa pbotaap pbtaaop pbtaapo pbtaoap pbtaopa pbtapoa pbtapao pbtaaop
pbtaapo pbtaoap pbtaopa pbtapoa pbtapao pbtoaap pbtoapa pbtoaap pbtoapa pbtopaa pbtopaa
pbtpaoa pbtpaao pbtpoaa pbtpoaa pbtpaoa pbtpaao popabat popabta popaabt popaatb popatab
popatba popbaat popbata popbaat popbata popbtaa popbtaa popabat popabta popaabt popaatb
popatab popatba poptbaa poptbaa poptaba poptaab poptaab poptaba poapbat poapbta poapabt
poapatb poaptab poaptba poabpat poabpta poabapt poabatp poabtap poabtpa poaabpt poaabtp
poaapbt poaaptb poaatpb poaatbp poatbap poatbpa poatabp poatapb poatpab poatpba pobapat
pobapta pobaapt pobaatp pobatap pobatpa pobpaat pobpata pobpaat pobpata pobptaa pobptaa
pobapat pobapta pobaapt pobaatp pobatap pobatpa pobtpaa pobtpaa pobtapa pobtaap pobtaap
pobtapa poaabpt poaabtp poaapbt poaaptb poaatpb poaatbp poabapt poabatp poabpat poabpta
poabtpa poabtap poapbat poapbta poapabt poapatb poaptab poaptba poatbpa poatbap poatpba
poatpab poatapb poatabp potabap potabpa potaabp potaapb potapab potapba potbaap potbapa
potbaap potbapa potbpaa potbpaa potabap potabpa potaabp potaapb potapab potapba potpbaa
potpbaa potpaba potpaab potpaab potpaba ptpaboa ptpabao ptpaoba ptpaoab ptpaaob ptpaabo
ptpbaoa ptpbaao ptpboaa ptpboaa ptpbaoa ptpbaao ptpobaa ptpobaa ptpoaba ptpoaab ptpoaab
ptpoaba ptpaboa ptpabao ptpaoba ptpaoab ptpaaob ptpaabo ptapboa ptapbao ptapoba ptapoab
ptapaob ptapabo ptabpoa ptabpao ptabopa ptaboap ptabaop ptabapo ptaobpa ptaobap ptaopba
ptaopab ptaoapb ptaoabp ptaabop ptaabpo ptaaobp ptaaopb ptaapob ptaapbo ptbapoa ptbapao
ptbaopa ptbaoap ptbaaop ptbaapo ptbpaoa ptbpaao ptbpoaa ptbpoaa ptbpaoa ptbpaao ptbopaa
ptbopaa ptboapa ptboaap ptboaap ptboapa ptbapoa ptbapao ptbaopa ptbaoap ptbaaop ptbaapo
ptoabpa ptoabap ptoapba ptoapab ptoaapb ptoaabp ptobapa ptobaap ptobpaa ptobpaa ptobapa
ptobaap ptopbaa ptopbaa ptopaba ptopaab ptopaab ptopaba ptoabpa ptoabap ptoapba ptoapab
ptoaapb ptoaabp ptaabop ptaabpo ptaaobp ptaaopb ptaapob ptaapbo ptabaop ptabapo ptaboap
ptabopa ptabpoa ptabpao ptaobap ptaobpa ptaoabp ptaoapb ptaopab ptaopba ptapboa ptapbao
ptapoba ptapoab ptapaob ptapabo aappbot aappbto aappobt aappotb aapptob aapptbo aapbpot
aapbpto aapbopt aapbotp aapbtop aapbtpo aapobpt aapobtp aapopbt aapoptb aapotpb aapotbp
aaptbop aaptbpo aaptobp aaptopb aaptpob aaptpbo aappbot aappbto aappobt aappotb aapptob
aapptbo aapbpot aapbpto aapbopt aapbotp aapbtop aapbtpo aapobpt aapobtp aapopbt aapoptb
aapotpb aapotbp aaptbop aaptbpo aaptobp aaptopb aaptpob aaptpbo aabppot aabppto aabpopt
aabpotp aabptop aabptpo aabppot aabppto aabpopt aabpotp aabptop aabptpo aaboppt aaboptp
aaboppt aaboptp aabotpp aabotpp aabtpop aabtppo aabtopp aabtopp aabtpop aabtppo aaopbpt
aaopbtp aaoppbt aaopptb aaoptpb aaoptbp aaobppt aaobptp aaobppt aaobptp aaobtpp aaobtpp
aaopbpt aaopbtp aaoppbt aaopptb aaoptpb aaoptbp aaotbpp aaotbpp aaotpbp aaotppb aaotppb
aaotpbp aatpbop aatpbpo aatpobp aatpopb aatppob aatppbo aatbpop aatbppo aatbopp aatbopp
aatbpop aatbppo aatobpp aatobpp aatopbp aatoppb aatoppb aatopbp aatpbop aatpbpo aatpobp
aatpopb aatppob aatppbo apapbot apapbto apapobt apapotb apaptob apaptbo apabpot apabpto
apabopt apabotp apabtop apabtpo apaobpt apaobtp apaopbt apaoptb apaotpb apaotbp apatbop
apatbpo apatobp apatopb apatpob apatpbo appabot appabto appaobt appaotb appatob appatbo
appbaot appbato appboat appbota appbtoa appbtao appobat appobta appoabt appoatb appotab
appotba apptboa apptbao apptoba apptoab apptaob apptabo apbpaot apbpato apbpoat apbpota
apbptoa apbptao apbapot apbapto apbaopt apbaotp apbatop apbatpo apboapt apboatp apbopat
apbopta apbotpa apbotap apbtaop apbtapo apbtoap apbtopa apbtpoa apbtpao apopbat apopbta
apopabt apopatb apoptab apoptba apobpat apobpta apobapt apobatp apobtap apobtpa apoabpt
apoabtp apoapbt apoaptb apoatpb apoatbp apotbap apotbpa apotabp apotapb apotpab apotpba
aptpboa aptpbao aptpoba aptpoab aptpaob aptpabo aptbpoa aptbpao aptbopa aptboap aptbaop
aptbapo aptobpa aptobap aptopba aptopab aptoapb aptoabp aptabop aptabpo aptaobp aptaopb
aptapob aptapbo appabot appabto appaobt appaotb appatob appatbo appbaot appbato appboat
appbota appbtoa appbtao appobat appobta appoabt appoatb appotab appotba apptboa apptbao
apptoba apptoab apptaob apptabo apapbot apapbto apapobt apapotb apaptob apaptbo apabpot
apabpto apabopt apabotp apabtop apabtpo apaobpt apaobtp apaopbt apaoptb apaotpb apaotbp
apatbop apatbpo apatobp apatopb apatpob apatpbo apbapot apbapto apbaopt apbaotp apbatop
apbatpo apbpaot apbpato apbpoat apbpota apbptoa apbptao apbopat apbopta apboapt apboatp
apbotap apbotpa apbtpoa apbtpao apbtopa apbtoap apbtaop apbtapo apoabpt apoabtp apoapbt
apoaptb apoatpb apoatbp apobapt apobatp apobpat apobpta apobtpa apobtap apopbat apopbta
apopabt apopatb apoptab apoptba apotbpa apotbap apotpba apotpab apotapb apotabp aptabop
aptabpo aptaobp aptaopb aptapob aptapbo aptbaop aptbapo aptboap aptbopa aptbpoa aptbpao
aptobap aptobpa aptoabp aptoapb aptopab aptopba aptpboa aptpbao aptpoba aptpoab aptpaob
aptpabo abppaot abppato abppoat abppota abpptoa abpptao abpapot abpapto abpaopt abpaotp
abpatop abpatpo abpoapt abpoatp abpopat abpopta abpotpa abpotap abptaop abptapo abptoap
abptopa abptpoa abptpao abppaot abppato abppoat abppota abpptoa abpptao abpapot abpapto
abpaopt abpaotp abpatop abpatpo abpoapt abpoatp abpopat abpopta abpotpa abpotap abptaop
abptapo abptoap abptopa abptpoa abptpao abappot abappto abapopt abapotp abaptop abaptpo
abappot abappto abapopt abapotp abaptop abaptpo abaoppt abaoptp abaoppt abaoptp abaotpp
abaotpp abatpop abatppo abatopp abatopp abatpop abatppo abopapt abopatp aboppat aboppta
aboptpa aboptap aboappt aboaptp aboappt aboaptp aboatpp aboatpp abopapt abopatp aboppat
aboppta aboptpa aboptap abotapp abotapp abotpap abotppa abotppa abotpap abtpaop abtpapo
abtpoap abtpopa abtppoa abtppao abtapop abtappo abtaopp abtaopp abtapop abtappo abtoapp
abtoapp abtopap abtoppa abtoppa abtopap abtpaop abtpapo abtpoap abtpopa abtppoa abtppao
aoppbat aoppbta aoppabt aoppatb aopptab aopptba aopbpat aopbpta aopbapt aopbatp aopbtap
aopbtpa aopabpt aopabtp aopapbt aopaptb aopatpb aopatbp aoptbap aoptbpa aoptabp aoptapb
aoptpab aoptpba aoppbat aoppbta aoppabt aoppatb aopptab aopptba aopbpat aopbpta aopbapt
aopbatp aopbtap aopbtpa aopabpt aopabtp aopapbt aopaptb aopatpb aopatbp aoptbap aoptbpa
aoptabp aoptapb aoptpab aoptpba aobppat aobppta aobpapt aobpatp aobptap aobptpa aobppat
aobppta aobpapt aobpatp aobptap aobptpa aobappt aobaptp aobappt aobaptp aobatpp aobatpp
aobtpap aobtppa aobtapp aobtapp aobtpap aobtppa aoapbpt aoapbtp aoappbt aoapptb aoaptpb
aoaptbp aoabppt aoabptp aoabppt aoabptp aoabtpp aoabtpp aoapbpt aoapbtp aoappbt aoapptb
aoaptpb aoaptbp aoatbpp aoatbpp aoatpbp aoatppb aoatppb aoatpbp aotpbap aotpbpa aotpabp
aotpapb aotppab aotppba aotbpap aotbppa aotbapp aotbapp aotbpap aotbppa aotabpp aotabpp
aotapbp aotappb aotappb aotapbp aotpbap aotpbpa aotpabp aotpapb aotppab aotppba atppboa
atppbao atppoba atppoab atppaob atppabo atpbpoa atpbpao atpbopa atpboap atpbaop atpbapo
atpobpa atpobap atpopba atpopab atpoapb atpoabp atpabop atpabpo atpaobp atpaopb atpapob
atpapbo atppboa atppbao atppoba atppoab atppaob atppabo atpbpoa atpbpao atpbopa atpboap
atpbaop atpbapo atpobpa atpobap atpopba atpopab atpoapb atpoabp atpabop atpabpo atpaobp
atpaopb atpapob atpapbo atbppoa atbppao atbpopa atbpoap atbpaop atbpapo atbppoa atbppao
atbpopa atbpoap atbpaop atbpapo atboppa atbopap atboppa atbopap atboapp atboapp atbapop
atbappo atbaopp atbaopp atbapop atbappo atopbpa atopbap atoppba atoppab atopapb atopabp
atobppa atobpap atobppa atobpap atobapp atobapp atopbpa atopbap atoppba atoppab atopapb
atopabp atoabpp atoabpp atoapbp atoappb atoappb atoapbp atapbop atapbpo atapobp atapopb
atappob atappbo atabpop atabppo atabopp atabopp atabpop atabppo ataobpp ataobpp ataopbp
ataoppb ataoppb ataopbp atapbop atapbpo atapobp atapopb atappob atappbo bapapot bapapto
bapaopt bapaotp bapatop bapatpo bappaot bappato bappoat bappota bapptoa bapptao bapopat
bapopta bapoapt bapoatp bapotap bapotpa baptpoa baptpao baptopa baptoap baptaop baptapo
baappot baappto baapopt baapotp baaptop baaptpo baappot baappto baapopt baapotp baaptop
baaptpo baaoppt baaoptp baaoppt baaoptp baaotpp baaotpp baatpop baatppo baatopp baatopp
baatpop baatppo bapapot bapapto bapaopt bapaotp bapatop bapatpo bappaot bappato bappoat
bappota bapptoa bapptao bapopat bapopta bapoapt bapoatp bapotap bapotpa baptpoa baptpao
baptopa baptoap baptaop baptapo baoappt baoaptp baoappt baoaptp baoatpp baoatpp baopapt
baopatp baoppat baoppta baoptpa baoptap baoppat baoppta baopapt baopatp baoptap baoptpa
baotppa baotpap baotppa baotpap baotapp baotapp batapop batappo bataopp bataopp batapop
batappo batpaop batpapo batpoap batpopa batppoa batppao batopap batoppa batoapp batoapp
batopap batoppa batppoa batppao batpopa batpoap batpaop batpapo bpaapot bpaapto bpaaopt
bpaaotp bpaatop bpaatpo bpapaot bpapato bpapoat bpapota bpaptoa bpaptao bpaopat bpaopta
bpaoapt bpaoatp bpaotap bpaotpa bpatpoa bpatpao bpatopa bpatoap bpataop bpatapo bpaapot
bpaapto bpaaopt bpaaotp bpaatop bpaatpo bpapaot bpapato bpapoat bpapota bpaptoa bpaptao
bpaopat bpaopta bpaoapt bpaoatp bpaotap bpaotpa bpatpoa bpatpao bpatopa bpatoap bpataop
bpatapo bppaaot bppaato bppaoat bppaota bppatoa bppatao bppaaot bppaato bppaoat bppaota
bppatoa bppatao bppoaat bppoata bppoaat bppoata bppotaa bppotaa bpptaoa bpptaao bpptoaa
bpptoaa bpptaoa bpptaao bpoapat bpoapta bpoaapt bpoaatp bpoatap bpoatpa bpopaat bpopata
bpopaat bpopata bpoptaa bpoptaa bpoapat bpoapta bpoaapt bpoaatp bpoatap bpoatpa bpotpaa
bpotpaa bpotapa bpotaap bpotaap bpotapa bptapoa bptapao bptaopa bptaoap bptaaop bptaapo
bptpaoa bptpaao bptpoaa bptpoaa bptpaoa bptpaao bptopaa bptopaa bptoapa bptoaap bptoaap
bptoapa bptapoa bptapao bptaopa bptaoap bptaaop bptaapo bapapot bapapto bapaopt bapaotp
bapatop bapatpo bappaot bappato bappoat bappota bapptoa bapptao bapopat bapopta bapoapt
bapoatp bapotap bapotpa baptpoa baptpao baptopa baptoap baptaop baptapo baappot baappto
baapopt baapotp baaptop baaptpo baappot baappto baapopt baapotp baaptop baaptpo baaoppt
baaoptp baaoppt baaoptp baaotpp baaotpp baatpop baatppo baatopp baatopp baatpop baatppo
bapapot bapapto bapaopt bapaotp bapatop bapatpo bappaot bappato bappoat bappota bapptoa
bapptao bapopat bapopta bapoapt bapoatp bapotap bapotpa baptpoa baptpao baptopa baptoap
baptaop baptapo baoappt baoaptp baoappt baoaptp baoatpp baoatpp baopapt baopatp baoppat
baoppta baoptpa baoptap baoppat baoppta baopapt baopatp baoptap baoptpa baotppa baotpap
baotppa baotpap baotapp baotapp batapop batappo bataopp bataopp batapop batappo batpaop
batpapo batpoap batpopa batppoa batppao batopap batoppa batoapp batoapp batopap batoppa
batppoa batppao batpopa batpoap batpaop batpapo bppaaot bppaato bppaoat bppaota bppatoa
bppatao bppaaot bppaato bppaoat bppaota bppatoa bppatao bppoaat bppoata bppoaat bppoata
bppotaa bppotaa bpptaoa bpptaao bpptoaa bpptoaa bpptaoa bpptaao bpapaot bpapato bpapoat
bpapota bpaptoa bpaptao bpaapot bpaapto bpaaopt bpaaotp bpaatop bpaatpo bpaoapt bpaoatp
bpaopat bpaopta bpaotpa bpaotap bpataop bpatapo bpatoap bpatopa bpatpoa bpatpao bpaapot
bpaapto bpaaopt bpaaotp bpaatop bpaatpo bpapaot bpapato bpapoat bpapota bpaptoa bpaptao
bpaopat bpaopta bpaoapt bpaoatp bpaotap bpaotpa bpatpoa bpatpao bpatopa bpatoap bpataop
bpatapo bpoaapt bpoaatp bpoapat bpoapta bpoatpa bpoatap bpoaapt bpoaatp bpoapat bpoapta
bpoatpa bpoatap bpopaat bpopata bpopaat bpopata bpoptaa bpoptaa bpotapa bpotaap bpotpaa
bpotpaa bpotapa bpotaap bptaaop bptaapo bptaoap bptaopa bptapoa bptapao bptaaop bptaapo
bptaoap bptaopa bptapoa bptapao bptoaap bptoapa bptoaap bptoapa bptopaa bptopaa bptpaoa
bptpaao bptpoaa bptpoaa bptpaoa bptpaao bopapat bopapta bopaapt bopaatp bopatap bopatpa
boppaat boppata boppaat boppata bopptaa bopptaa bopapat bopapta bopaapt bopaatp bopatap
bopatpa boptpaa boptpaa boptapa boptaap boptaap boptapa boappat boappta boapapt boapatp
boaptap boaptpa boappat boappta boapapt boapatp boaptap boaptpa boaappt boaaptp boaappt
boaaptp boaatpp boaatpp boatpap boatppa boatapp boatapp boatpap boatppa bopapat bopapta
bopaapt bopaatp bopatap bopatpa boppaat boppata boppaat boppata bopptaa bopptaa bopapat
bopapta bopaapt bopaatp bopatap bopatpa boptpaa boptpaa boptapa boptaap boptaap boptapa
boaappt boaaptp boaappt boaaptp boaatpp boaatpp boapapt boapatp boappat boappta boaptpa
boaptap boappat boappta boapapt boapatp boaptap boaptpa boatppa boatpap boatppa boatpap
boatapp boatapp botapap botappa botaapp botaapp botapap botappa botpaap botpapa botpaap
botpapa botppaa botppaa botapap botappa botaapp botaapp botapap botappa botppaa botppaa
botpapa botpaap botpaap botpapa btpapoa btpapao btpaopa btpaoap btpaaop btpaapo btppaoa
btppaao btppoaa btppoaa btppaoa btppaao btpopaa btpopaa btpoapa btpoaap btpoaap btpoapa
btpapoa btpapao btpaopa btpaoap btpaaop btpaapo btappoa btappao btapopa btapoap btapaop
btapapo btappoa btappao btapopa btapoap btapaop btapapo btaoppa btaopap btaoppa btaopap
btaoapp btaoapp btaapop btaappo btaaopp btaaopp btaapop btaappo btpapoa btpapao btpaopa
btpaoap btpaaop btpaapo btppaoa btppaao btppoaa btppoaa btppaoa btppaao btpopaa btpopaa
btpoapa btpoaap btpoaap btpoapa btpapoa btpapao btpaopa btpaoap btpaaop btpaapo btoappa
btoapap btoappa btoapap btoaapp btoaapp btopapa btopaap btoppaa btoppaa btopapa btopaap
btoppaa btoppaa btopapa btopaap btopaap btopapa btoappa btoapap btoappa btoapap btoaapp
btoaapp btaapop btaappo btaaopp btaaopp btaapop btaappo btapaop btapapo btapoap btapopa
btappoa btappao btaopap btaoppa btaoapp btaoapp btaopap btaoppa btappoa btappao btapopa
btapoap btapaop btapapo oapabpt oapabtp oapapbt oapaptb oapatpb oapatbp oapbapt oapbatp
oapbpat oapbpta oapbtpa oapbtap oappbat oappbta oappabt oappatb oapptab oapptba oaptbpa
oaptbap oaptpba oaptpab oaptapb oaptabp oaapbpt oaapbtp oaappbt oaapptb oaaptpb oaaptbp
oaabppt oaabptp oaabppt oaabptp oaabtpp oaabtpp oaapbpt oaapbtp oaappbt oaapptb oaaptpb
oaaptbp oaatbpp oaatbpp oaatpbp oaatppb oaatppb oaatpbp oabappt oabaptp oabappt oabaptp
oabatpp oabatpp oabpapt oabpatp oabppat oabppta oabptpa oabptap oabppat oabppta oabpapt
oabpatp oabptap oabptpa oabtppa oabtpap oabtppa oabtpap oabtapp oabtapp oapabpt oapabtp
oapapbt oapaptb oapatpb oapatbp oapbapt oapbatp oapbpat oapbpta oapbtpa oapbtap oappbat
oappbta oappabt oappatb oapptab oapptba oaptbpa oaptbap oaptpba oaptpab oaptapb oaptabp
oatabpp oatabpp oatapbp oatappb oatappb oatapbp oatbapp oatbapp oatbpap oatbppa oatbppa
oatbpap oatpbap oatpbpa oatpabp oatpapb oatppab oatppba oatpbpa oatpbap oatppba oatppab
oatpapb oatpabp opaabpt opaabtp opaapbt opaaptb opaatpb opaatbp opabapt opabatp opabpat
opabpta opabtpa opabtap opapbat opapbta opapabt opapatb opaptab opaptba opatbpa opatbap
opatpba opatpab opatapb opatabp opaabpt opaabtp opaapbt opaaptb opaatpb opaatbp opabapt
opabatp opabpat opabpta opabtpa opabtap opapbat opapbta opapabt opapatb opaptab opaptba
opatbpa opatbap opatpba opatpab opatapb opatabp opbaapt opbaatp opbapat opbapta opbatpa
opbatap opbaapt opbaatp opbapat opbapta opbatpa opbatap opbpaat opbpata opbpaat opbpata
opbptaa opbptaa opbtapa opbtaap opbtpaa opbtpaa opbtapa opbtaap oppabat oppabta oppaabt
oppaatb oppatab oppatba oppbaat oppbata oppbaat oppbata oppbtaa oppbtaa oppabat oppabta
oppaabt oppaatb oppatab oppatba opptbaa opptbaa opptaba opptaab opptaab opptaba optabpa
optabap optapba optapab optaapb optaabp optbapa optbaap optbpaa optbpaa optbapa optbaap
optpbaa optpbaa optpaba optpaab optpaab optpaba optabpa optabap optapba optapab optaapb
optaabp oapabpt oapabtp oapapbt oapaptb oapatpb oapatbp oapbapt oapbatp oapbpat oapbpta
oapbtpa oapbtap oappbat oappbta oappabt oappatb oapptab oapptba oaptbpa oaptbap oaptpba
oaptpab oaptapb oaptabp oaapbpt oaapbtp oaappbt oaapptb oaaptpb oaaptbp oaabppt oaabptp
oaabppt oaabptp oaabtpp oaabtpp oaapbpt oaapbtp oaappbt oaapptb oaaptpb oaaptbp oaatbpp
oaatbpp oaatpbp oaatppb oaatppb oaatpbp oabappt oabaptp oabappt oabaptp oabatpp oabatpp
oabpapt oabpatp oabppat oabppta oabptpa oabptap oabppat oabppta oabpapt oabpatp oabptap
oabptpa oabtppa oabtpap oabtppa oabtpap oabtapp oabtapp oapabpt oapabtp oapapbt oapaptb
oapatpb oapatbp oapbapt oapbatp oapbpat oapbpta oapbtpa oapbtap oappbat oappbta oappabt
oappatb oapptab oapptba oaptbpa oaptbap oaptpba oaptpab oaptapb oaptabp oatabpp oatabpp
oatapbp oatappb oatappb oatapbp oatbapp oatbapp oatbpap oatbppa oatbppa oatbpap oatpbap
oatpbpa oatpabp oatpapb oatppab oatppba oatpbpa oatpbap oatppba oatppab oatpapb oatpabp
obpaapt obpaatp obpapat obpapta obpatpa obpatap obpaapt obpaatp obpapat obpapta obpatpa
obpatap obppaat obppata obppaat obppata obpptaa obpptaa obptapa obptaap obptpaa obptpaa
obptapa obptaap obapapt obapatp obappat obappta obaptpa obaptap obaappt obaaptp obaappt
obaaptp obaatpp obaatpp obapapt obapatp obappat obappta obaptpa obaptap obatapp obatapp
obatpap obatppa obatppa obatpap obaappt obaaptp obaappt obaaptp obaatpp obaatpp obapapt
obapatp obappat obappta obaptpa obaptap obappat obappta obapapt obapatp obaptap obaptpa
obatppa obatpap obatppa obatpap obatapp obatapp obpaapt obpaatp obpapat obpapta obpatpa
obpatap obpaapt obpaatp obpapat obpapta obpatpa obpatap obppaat obppata obppaat obppata
obpptaa obpptaa obptapa obptaap obptpaa obptpaa obptapa obptaap obtaapp obtaapp obtapap
obtappa obtappa obtapap obtaapp obtaapp obtapap obtappa obtappa obtapap obtpaap obtpapa
obtpaap obtpapa obtppaa obtppaa obtpapa obtpaap obtppaa obtppaa obtpapa obtpaap oppabat
oppabta oppaabt oppaatb oppatab oppatba oppbaat oppbata oppbaat oppbata oppbtaa oppbtaa
oppabat oppabta oppaabt oppaatb oppatab oppatba opptbaa opptbaa opptaba opptaab opptaab
opptaba opapbat opapbta opapabt opapatb opaptab opaptba opabpat opabpta opabapt opabatp
opabtap opabtpa opaabpt opaabtp opaapbt opaaptb opaatpb opaatbp opatbap opatbpa opatabp
opatapb opatpab opatpba opbapat opbapta opbaapt opbaatp opbatap opbatpa opbpaat opbpata
opbpaat opbpata opbptaa opbptaa opbapat opbapta opbaapt opbaatp opbatap opbatpa opbtpaa
opbtpaa opbtapa opbtaap opbtaap opbtapa opaabpt opaabtp opaapbt opaaptb opaatpb opaatbp
opabapt opabatp opabpat opabpta opabtpa opabtap opapbat opapbta opapabt opapatb opaptab
opaptba opatbpa opatbap opatpba opatpab opatapb opatabp optabap optabpa optaabp optaapb
optapab optapba optbaap optbapa optbaap optbapa optbpaa optbpaa optabap optabpa optaabp
optaapb optapab optapba optpbaa optpbaa optpaba optpaab optpaab optpaba otpabpa otpabap
otpapba otpapab otpaapb otpaabp otpbapa otpbaap otpbpaa otpbpaa otpbapa otpbaap otppbaa
otppbaa otppaba otppaab otppaab otppaba otpabpa otpabap otpapba otpapab otpaapb otpaabp
otapbpa otapbap otappba otappab otapapb otapabp otabppa otabpap otabppa otabpap otabapp
otabapp otapbpa otapbap otappba otappab otapapb otapabp otaabpp otaabpp otaapbp otaappb
otaappb otaapbp otbappa otbapap otbappa otbapap otbaapp otbaapp otbpapa otbpaap otbppaa
otbppaa otbpapa otbpaap otbppaa otbppaa otbpapa otbpaap otbpaap otbpapa otbappa otbapap
otbappa otbapap otbaapp otbaapp otpabpa otpabap otpapba otpapab otpaapb otpaabp otpbapa
otpbaap otpbpaa otpbpaa otpbapa otpbaap otppbaa otppbaa otppaba otppaab otppaab otppaba
otpabpa otpabap otpapba otpapab otpaapb otpaabp otaabpp otaabpp otaapbp otaappb otaappb
otaapbp otabapp otabapp otabpap otabppa otabppa otabpap otapbap otapbpa otapabp otapapb
otappab otappba otapbpa otapbap otappba otappab otapapb otapabp tapabop tapabpo tapaobp
tapaopb tapapob tapapbo tapbaop tapbapo tapboap tapbopa tapbpoa tapbpao tapobap tapobpa
tapoabp tapoapb tapopab tapopba tappboa tappbao tappoba tappoab tappaob tappabo taapbop
taapbpo taapobp taapopb taappob taappbo taabpop taabppo taabopp taabopp taabpop taabppo
taaobpp taaobpp taaopbp taaoppb taaoppb taaopbp taapbop taapbpo taapobp taapopb taappob
taappbo tabapop tabappo tabaopp tabaopp tabapop tabappo tabpaop tabpapo tabpoap tabpopa
tabppoa tabppao tabopap taboppa taboapp taboapp tabopap taboppa tabppoa tabppao tabpopa
tabpoap tabpaop tabpapo taoabpp taoabpp taoapbp taoappb taoappb taoapbp taobapp taobapp
taobpap taobppa taobppa taobpap taopbap taopbpa taopabp taopapb taoppab taoppba taopbpa
taopbap taoppba taoppab taopapb taopabp tapabop tapabpo tapaobp tapaopb tapapob tapapbo
tapbaop tapbapo tapboap tapbopa tapbpoa tapbpao tapobap tapobpa tapoabp tapoapb tapopab
tapopba tappboa tappbao tappoba tappoab tappaob tappabo tpaabop tpaabpo tpaaobp tpaaopb
tpaapob tpaapbo tpabaop tpabapo tpaboap tpabopa tpabpoa tpabpao tpaobap tpaobpa tpaoabp
tpaoapb tpaopab tpaopba tpapboa tpapbao tpapoba tpapoab tpapaob tpapabo tpaabop tpaabpo
tpaaobp tpaaopb tpaapob tpaapbo tpabaop tpabapo tpaboap tpabopa tpabpoa tpabpao tpaobap
tpaobpa tpaoabp tpaoapb tpaopab tpaopba tpapboa tpapbao tpapoba tpapoab tpapaob tpapabo
tpbaaop tpbaapo tpbaoap tpbaopa tpbapoa tpbapao tpbaaop tpbaapo tpbaoap tpbaopa tpbapoa
tpbapao tpboaap tpboapa tpboaap tpboapa tpbopaa tpbopaa tpbpaoa tpbpaao tpbpoaa tpbpoaa
tpbpaoa tpbpaao tpoabap tpoabpa tpoaabp tpoaapb tpoapab tpoapba tpobaap tpobapa tpobaap
tpobapa tpobpaa tpobpaa tpoabap tpoabpa tpoaabp tpoaapb tpoapab tpoapba tpopbaa tpopbaa
tpopaba tpopaab tpopaab tpopaba tppaboa tppabao tppaoba tppaoab tppaaob tppaabo tppbaoa
tppbaao tppboaa tppboaa tppbaoa tppbaao tppobaa tppobaa tppoaba tppoaab tppoaab tppoaba
tppaboa tppabao tppaoba tppaoab tppaaob tppaabo tapabop tapabpo tapaobp tapaopb tapapob
tapapbo tapbaop tapbapo tapboap tapbopa tapbpoa tapbpao tapobap tapobpa tapoabp tapoapb
tapopab tapopba tappboa tappbao tappoba tappoab tappaob tappabo taapbop taapbpo taapobp
taapopb taappob taappbo taabpop taabppo taabopp taabopp taabpop taabppo taaobpp taaobpp
taaopbp taaoppb taaoppb taaopbp taapbop taapbpo taapobp taapopb taappob taappbo tabapop
tabappo tabaopp tabaopp tabapop tabappo tabpaop tabpapo tabpoap tabpopa tabppoa tabppao
tabopap taboppa taboapp taboapp tabopap taboppa tabppoa tabppao tabpopa tabpoap tabpaop
tabpapo taoabpp taoabpp taoapbp taoappb taoappb taoapbp taobapp taobapp taobpap taobppa
taobppa taobpap taopbap taopbpa taopabp taopapb taoppab taoppba taopbpa taopbap taoppba
taoppab taopapb taopabp tapabop tapabpo tapaobp tapaopb tapapob tapapbo tapbaop tapbapo
tapboap tapbopa tapbpoa tapbpao tapobap tapobpa tapoabp tapoapb tapopab tapopba tappboa
tappbao tappoba tappoab tappaob tappabo tbpaaop tbpaapo tbpaoap tbpaopa tbpapoa tbpapao
tbpaaop tbpaapo tbpaoap tbpaopa tbpapoa tbpapao tbpoaap tbpoapa tbpoaap tbpoapa tbpopaa
tbpopaa tbppaoa tbppaao tbppoaa tbppoaa tbppaoa tbppaao tbapaop tbapapo tbapoap tbapopa
tbappoa tbappao tbaapop tbaappo tbaaopp tbaaopp tbaapop tbaappo tbaoapp tbaoapp tbaopap
tbaoppa tbaoppa tbaopap tbapaop tbapapo tbapoap tbapopa tbappoa tbappao tbaapop tbaappo
tbaaopp tbaaopp tbaapop tbaappo tbapaop tbapapo tbapoap tbapopa tbappoa tbappao tbaopap
tbaoppa tbaoapp tbaoapp tbaopap tbaoppa tbappoa tbappao tbapopa tbapoap tbapaop tbapapo
tboaapp tboaapp tboapap tboappa tboappa tboapap tboaapp tboaapp tboapap tboappa tboappa
tboapap tbopaap tbopapa tbopaap tbopapa tboppaa tboppaa tbopapa tbopaap tboppaa tboppaa
tbopapa tbopaap tbpaaop tbpaapo tbpaoap tbpaopa tbpapoa tbpapao tbpaaop tbpaapo tbpaoap
tbpaopa tbpapoa tbpapao tbpoaap tbpoapa tbpoaap tbpoapa tbpopaa tbpopaa tbppaoa tbppaao
tbppoaa tbppoaa tbppaoa tbppaao topabap topabpa topaabp topaapb topapab topapba topbaap
topbapa topbaap topbapa topbpaa topbpaa topabap topabpa topaabp topaapb topapab topapba
toppbaa toppbaa toppaba toppaab toppaab toppaba toapbap toapbpa toapabp toapapb toappab
toappba toabpap toabppa toabapp toabapp toabpap toabppa toaabpp toaabpp toaapbp toaappb
toaappb toaapbp toapbap toapbpa toapabp toapapb toappab toappba tobapap tobappa tobaapp
tobaapp tobapap tobappa tobpaap tobpapa tobpaap tobpapa tobppaa tobppaa tobapap tobappa
tobaapp tobaapp tobapap tobappa tobppaa tobppaa tobpapa tobpaap tobpaap tobpapa toaabpp
toaabpp toaapbp toaappb toaappb toaapbp toabapp toabapp toabpap toabppa toabppa toabpap
toapbap toapbpa toapabp toapapb toappab toappba toapbpa toapbap toappba toappab toapapb
toapabp topabap topabpa topaabp topaapb topapab topapba topbaap topbapa topbaap topbapa
topbpaa topbpaa topabap topabpa topaabp topaapb topapab topapba toppbaa toppbaa toppaba
toppaab toppaab toppaba tppaboa tppabao tppaoba tppaoab tppaaob tppaabo tppbaoa tppbaao
tppboaa tppboaa tppbaoa tppbaao tppobaa tppobaa tppoaba tppoaab tppoaab tppoaba tppaboa
tppabao tppaoba tppaoab tppaaob tppaabo tpapboa tpapbao tpapoba tpapoab tpapaob tpapabo
tpabpoa tpabpao tpabopa tpaboap tpabaop tpabapo tpaobpa tpaobap tpaopba tpaopab tpaoapb
tpaoabp tpaabop tpaabpo tpaaobp tpaaopb tpaapob tpaapbo tpbapoa tpbapao tpbaopa tpbaoap
tpbaaop tpbaapo tpbpaoa tpbpaao tpbpoaa tpbpoaa tpbpaoa tpbpaao tpbopaa tpbopaa tpboapa
tpboaap tpboaap tpboapa tpbapoa tpbapao tpbaopa tpbaoap tpbaaop tpbaapo tpoabpa tpoabap
tpoapba tpoapab tpoaapb tpoaabp tpobapa tpobaap tpobpaa tpobpaa tpobapa tpobaap tpopbaa
tpopbaa tpopaba tpopaab tpopaab tpopaba tpoabpa tpoabap tpoapba tpoapab tpoaapb tpoaabp
tpaabop tpaabpo tpaaobp tpaaopb tpaapob tpaapbo tpabaop tpabapo tpaboap tpabopa tpabpoa
tpabpao tpaobap tpaobpa tpaoabp tpaoapb tpaopab tpaopba tpapboa tpapbao tpapoba tpapoab
tpapaob tpapabo

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us