easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

beatee

stubbiest

leckkill

dupree

nonillustration

summoque

incendimus

aglaspis

acquitment

potentibusque

inagglutinability

uidimus

preteriteness

carvership

commeatu

buarque

circumpacific

fameful


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: overholt
cipher variations:
pwfsipmu qxgtjqnv ryhukrow szivlspx tajwmtqy
ubkxnurz vclyovsa wdmzpwtb xenaqxuc yfobryvd
zgpcszwe ahqdtaxf bireubyg cjsfvczh dktgwdai
eluhxebj fmviyfck gnwjzgdl hoxkahem ipylbifn
jqzmcjgo krandkhp lsboeliq mtcpfmjr nudqgnks

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: overholt
Cipher: levislog

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: overholt
Cipher: ABBAB BBBAB AABAA BAAAA AABBB ABBAB ABABA BAABA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: overholt
cipher variations:
pwfsipmurmnawrigtcviktesvsdqyvaexilymxwqzytgazscdejwcdkafureqfgm
hkzmehcyjahusjyklqpcgluwngxkunqiqxgtjqnvsnobxsjhudwjluftwterzwbf
yjmznyxrazuhbatdefkxdelbgvsfrghnilanfidzkbivtkzlmrqdhmvxohylvorj
ryhukrowtopcytkivexkmvguxufsaxcgzknaozysbavicbuefglyefmchwtgshio
jmbogjealcjwulamnsreinwypizmwpskszivlspxupqdzuljwfylnwhvyvgtbydh
alobpaztcbwjdcvfghmzfgndixuhtijpkncphkfbmdkxvmbnotsfjoxzqjanxqtl
tajwmtqyvqreavmkxgzmoxiwzwhuczeibmpcqbaudcxkedwghinaghoejyviujkq
lodqilgcnelywncoputgkpyarkboyrumubkxnurzwrsfbwnlyhanpyjxaxivdafj
cnqdrcbvedylfexhijobhipfkzwjvklrmperjmhdofmzxodpqvuhlqzbslcpzsvn
vclyovsaxstgcxomziboqzkybyjwebgkdoresdcwfezmgfyijkpcijqglaxkwlms
nqfskniepgnaypeqrwvimractmdqatwowdmzpwtbytuhdypnajcpralzczkxfchl
epsftedxgfanhgzjklqdjkrhmbylxmntorgtlojfqhobzqfrsxwjnsbdunerbuxp
xenaqxuczuviezqobkdqsbmadalygdimfqtgufeyhgboihaklmreklsinczmynou
pshumpkgripcargstyxkotcevofscvyqyfobryvdavwjfarpclertcnbebmzhejn
gruhvgfzihcpjiblmnsflmtjodanzopvqtivnqlhsjqdbshtuzylpudfwpgtdwzr
zgpcszwebwxkgbsqdmfsudocfcnaifkohsviwhgajidqkjcmnotgmnukpeboapqw
rujwormitkrectiuvazmqvegxqhuexasahqdtaxfcxylhctrengtvepdgdobjglp
itwjxihbkjerlkdnopuhnovlqfcpbqrxsvkxpsnjulsfdujvwbanrwfhyrivfybt
bireubygdyzmidusfohuwfqehepckhmqjuxkyjiclkfsmleopqviopwmrgdqcrsy
twlyqtokvmtgevkwxcbosxgizsjwgzcucjsfvczhezanjevtgpivxgrfifqdlinr
kvylzkjdmlgtnmfpqrwjpqxnsherdstzuxmzruplwnuhfwlxydcptyhjatkxhadv
dktgwdaifabokfwuhqjwyhsgjgremjoslwzmalkenmhuongqrsxkqryotifsetua
vynasvqmxovigxmyzedquzikbulyibeweluhxebjgbcplgxvirkxzithkhsfnkpt
mxanbmlfonivpohrstylrszpujgtfuvbwzobtwrnypwjhynzafervajlcvmzjcfx
fmviyfckhcdqmhywjslyajuilitgolqunybocnmgpojwqpistuzmstaqvkhugvwc
xapcuxsozqxkizoabgfswbkmdwnakdgygnwjzgdlidernizxktmzbkvjmjuhpmrv
ozcpdonhqpkxrqjtuvantubrwlivhwxdybqdvytparyljapbchgtxclnexoblehz
hoxkahemjefsojaylunaclwknkviqnswpadqepoirqlysrkuvwbouvcsxmjwixye
zcrewzuqbszmkbqcdihuydmofypcmfiaipylbifnkfgtpkbzmvobdmxlolwjrotx
qberfqpjsrmztslvwxcpvwdtynkxjyzfadsfxavrctanlcrdejivzenpgzqdngjb
jqzmcjgolghuqlcanwpcenympmxkspuyrcfsgrqktsnautmwxydqwxeuzolykzag
betgybwsdubomdsefkjwafoqhareohkckrandkhpmhivrmdboxqdfoznqnyltqvz
sdgthsrlutobvunxyzerxyfvapmzlabhcfuhzcxtevcpnetfglkxbgpribsfpild
lsboeliqnijwsnecpyregpaorozmurwatehuitsmvupcwvoyzafsyzgwbqnambci
dgviadyufwdqofughmlychqsjctgqjmemtcpfmjrojkxtofdqzsfhqbpspanvsxb
ufivjutnwvqdxwpzabgtzahxcrobncdjehwjbezvgxerpgvhinmzdirtkduhrknf
nudqgnkspklyupgeratgircqtqbowtycvgjwkvuoxwreyxqabchuabiydspcodek
fixkcfawhyfsqhwijonaejsulevislogoverholtqlmzvqhfsbuhjsdrurcpxuzd
whkxlwvpyxsfzyrbcdivbcjzetqdpeflgjyldgbxizgtrixjkpobfktvmfwjtmph

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: overholt
Cipher: bireubyg

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: overholt
Cipher: 4315512432431344

Extended Methods:
Method #1

Plaintext: overholt
method variations:
takwntqyyfpbsyvddlugxdaiiqzmcifo

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
o v e r h o l t 
4 1 5 2 3 4 1 4 
3 5 1 4 2 3 3 4 
They are then read out in rows:
4152341435142334
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: overholt
Cipher: dksqxqms

Read more ...
Method #3

Plaintext: overholt
method variations:
czforcst zforcstc forcstcz
orcstczf rcstczfo cstczfor
stczforc tczforcs

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: overholt

first 5040 cipher variations(40320 total)
overholt overhotl overhlot overhlto overhtlo overhtol overohlt overohtl overolht overolth overotlh
overothl overloht overloth overlhot overlhto overltho overltoh overtolh overtohl overtloh overtlho
overthlo overthol ovehrolt ovehrotl ovehrlot ovehrlto ovehrtlo ovehrtol ovehorlt ovehortl oveholrt
oveholtr ovehotlr ovehotrl ovehlort ovehlotr ovehlrot ovehlrto ovehltro ovehltor ovehtolr ovehtorl
ovehtlor ovehtlro ovehtrlo ovehtrol oveohrlt oveohrtl oveohlrt oveohltr oveohtlr oveohtrl oveorhlt
oveorhtl oveorlht oveorlth oveortlh oveorthl oveolrht oveolrth oveolhrt oveolhtr oveolthr oveoltrh
oveotrlh oveotrhl oveotlrh oveotlhr oveothlr oveothrl ovelhort ovelhotr ovelhrot ovelhrto ovelhtro
ovelhtor ovelohrt ovelohtr ovelorht ovelorth ovelotrh ovelothr ovelroht ovelroth ovelrhot ovelrhto
ovelrtho ovelrtoh oveltorh oveltohr oveltroh oveltrho ovelthro ovelthor ovetholr ovethorl ovethlor
ovethlro ovethrlo ovethrol ovetohlr ovetohrl ovetolhr ovetolrh ovetorlh ovetorhl ovetlohr ovetlorh
ovetlhor ovetlhro ovetlrho ovetlroh ovetrolh ovetrohl ovetrloh ovetrlho ovetrhlo ovetrhol ovreholt
ovrehotl ovrehlot ovrehlto ovrehtlo ovrehtol ovreohlt ovreohtl ovreolht ovreolth ovreotlh ovreothl
ovreloht ovreloth ovrelhot ovrelhto ovreltho ovreltoh ovretolh ovretohl ovretloh ovretlho ovrethlo
ovrethol ovrheolt ovrheotl ovrhelot ovrhelto ovrhetlo ovrhetol ovrhoelt ovrhoetl ovrholet ovrholte
ovrhotle ovrhotel ovrhloet ovrhlote ovrhleot ovrhleto ovrhlteo ovrhltoe ovrhtole ovrhtoel ovrhtloe
ovrhtleo ovrhtelo ovrhteol ovrohelt ovrohetl ovrohlet ovrohlte ovrohtle ovrohtel ovroehlt ovroehtl
ovroelht ovroelth ovroetlh ovroethl ovroleht ovroleth ovrolhet ovrolhte ovrolthe ovrolteh ovrotelh
ovrotehl ovrotleh ovrotlhe ovrothle ovrothel ovrlhoet ovrlhote ovrlheot ovrlheto ovrlhteo ovrlhtoe
ovrlohet ovrlohte ovrloeht ovrloeth ovrloteh ovrlothe ovrleoht ovrleoth ovrlehot ovrlehto ovrletho
ovrletoh ovrltoeh ovrltohe ovrlteoh ovrlteho ovrltheo ovrlthoe ovrthole ovrthoel ovrthloe ovrthleo
ovrthelo ovrtheol ovrtohle ovrtohel ovrtolhe ovrtoleh ovrtoelh ovrtoehl ovrtlohe ovrtloeh ovrtlhoe
ovrtlheo ovrtleho ovrtleoh ovrteolh ovrteohl ovrteloh ovrtelho ovrtehlo ovrtehol ovhreolt ovhreotl
ovhrelot ovhrelto ovhretlo ovhretol ovhroelt ovhroetl ovhrolet ovhrolte ovhrotle ovhrotel ovhrloet
ovhrlote ovhrleot ovhrleto ovhrlteo ovhrltoe ovhrtole ovhrtoel ovhrtloe ovhrtleo ovhrtelo ovhrteol
ovherolt ovherotl ovherlot ovherlto ovhertlo ovhertol ovheorlt ovheortl ovheolrt ovheoltr ovheotlr
ovheotrl ovhelort ovhelotr ovhelrot ovhelrto ovheltro ovheltor ovhetolr ovhetorl ovhetlor ovhetlro
ovhetrlo ovhetrol ovhoerlt ovhoertl ovhoelrt ovhoeltr ovhoetlr ovhoetrl ovhorelt ovhoretl ovhorlet
ovhorlte ovhortle ovhortel ovholret ovholrte ovholert ovholetr ovholter ovholtre ovhotrle ovhotrel
ovhotlre ovhotler ovhotelr ovhoterl ovhleort ovhleotr ovhlerot ovhlerto ovhletro ovhletor ovhloert
ovhloetr ovhloret ovhlorte ovhlotre ovhloter ovhlroet ovhlrote ovhlreot ovhlreto ovhlrteo ovhlrtoe
ovhltore ovhltoer ovhltroe ovhltreo ovhltero ovhlteor ovhteolr ovhteorl ovhtelor ovhtelro ovhterlo
ovhterol ovhtoelr ovhtoerl ovhtoler ovhtolre ovhtorle ovhtorel ovhtloer ovhtlore ovhtleor ovhtlero
ovhtlreo ovhtlroe ovhtrole ovhtroel ovhtrloe ovhtrleo ovhtrelo ovhtreol ovorhelt ovorhetl ovorhlet
ovorhlte ovorhtle ovorhtel ovorehlt ovorehtl ovorelht ovorelth ovoretlh ovorethl ovorleht ovorleth
ovorlhet ovorlhte ovorlthe ovorlteh ovortelh ovortehl ovortleh ovortlhe ovorthle ovorthel ovohrelt
ovohretl ovohrlet ovohrlte ovohrtle ovohrtel ovoherlt ovohertl ovohelrt ovoheltr ovohetlr ovohetrl
ovohlert ovohletr ovohlret ovohlrte ovohltre ovohlter ovohtelr ovohterl ovohtler ovohtlre ovohtrle
ovohtrel ovoehrlt ovoehrtl ovoehlrt ovoehltr ovoehtlr ovoehtrl ovoerhlt ovoerhtl ovoerlht ovoerlth
ovoertlh ovoerthl ovoelrht ovoelrth ovoelhrt ovoelhtr ovoelthr ovoeltrh ovoetrlh ovoetrhl ovoetlrh
ovoetlhr ovoethlr ovoethrl ovolhert ovolhetr ovolhret ovolhrte ovolhtre ovolhter ovolehrt ovolehtr
ovolerht ovolerth ovoletrh ovolethr ovolreht ovolreth ovolrhet ovolrhte ovolrthe ovolrteh ovolterh
ovoltehr ovoltreh ovoltrhe ovolthre ovolther ovothelr ovotherl ovothler ovothlre ovothrle ovothrel
ovotehlr ovotehrl ovotelhr ovotelrh ovoterlh ovoterhl ovotlehr ovotlerh ovotlher ovotlhre ovotlrhe
ovotlreh ovotrelh ovotrehl ovotrleh ovotrlhe ovotrhle ovotrhel ovlrhoet ovlrhote ovlrheot ovlrheto
ovlrhteo ovlrhtoe ovlrohet ovlrohte ovlroeht ovlroeth ovlroteh ovlrothe ovlreoht ovlreoth ovlrehot
ovlrehto ovlretho ovlretoh ovlrtoeh ovlrtohe ovlrteoh ovlrteho ovlrtheo ovlrthoe ovlhroet ovlhrote
ovlhreot ovlhreto ovlhrteo ovlhrtoe ovlhoret ovlhorte ovlhoert ovlhoetr ovlhoter ovlhotre ovlheort
ovlheotr ovlherot ovlherto ovlhetro ovlhetor ovlhtoer ovlhtore ovlhteor ovlhtero ovlhtreo ovlhtroe
ovlohret ovlohrte ovlohert ovlohetr ovlohter ovlohtre ovlorhet ovlorhte ovloreht ovloreth ovlorteh
ovlorthe ovloerht ovloerth ovloehrt ovloehtr ovloethr ovloetrh ovlotreh ovlotrhe ovloterh ovlotehr
ovlother ovlothre ovlehort ovlehotr ovlehrot ovlehrto ovlehtro ovlehtor ovleohrt ovleohtr ovleorht
ovleorth ovleotrh ovleothr ovleroht ovleroth ovlerhot ovlerhto ovlertho ovlertoh ovletorh ovletohr
ovletroh ovletrho ovlethro ovlethor ovlthoer ovlthore ovltheor ovlthero ovlthreo ovlthroe ovltoher
ovltohre ovltoehr ovltoerh ovltoreh ovltorhe ovlteohr ovlteorh ovltehor ovltehro ovlterho ovlteroh
ovltroeh ovltrohe ovltreoh ovltreho ovltrheo ovltrhoe ovtrhole ovtrhoel ovtrhloe ovtrhleo ovtrhelo
ovtrheol ovtrohle ovtrohel ovtrolhe ovtroleh ovtroelh ovtroehl ovtrlohe ovtrloeh ovtrlhoe ovtrlheo
ovtrleho ovtrleoh ovtreolh ovtreohl ovtreloh ovtrelho ovtrehlo ovtrehol ovthrole ovthroel ovthrloe
ovthrleo ovthrelo ovthreol ovthorle ovthorel ovtholre ovtholer ovthoelr ovthoerl ovthlore ovthloer
ovthlroe ovthlreo ovthlero ovthleor ovtheolr ovtheorl ovthelor ovthelro ovtherlo ovtherol ovtohrle
ovtohrel ovtohlre ovtohler ovtohelr ovtoherl ovtorhle ovtorhel ovtorlhe ovtorleh ovtorelh ovtorehl
ovtolrhe ovtolreh ovtolhre ovtolher ovtolehr ovtolerh ovtoerlh ovtoerhl ovtoelrh ovtoelhr ovtoehlr
ovtoehrl ovtlhore ovtlhoer ovtlhroe ovtlhreo ovtlhero ovtlheor ovtlohre ovtloher ovtlorhe ovtloreh
ovtloerh ovtloehr ovtlrohe ovtlroeh ovtlrhoe ovtlrheo ovtlreho ovtlreoh ovtleorh ovtleohr ovtleroh
ovtlerho ovtlehro ovtlehor ovteholr ovtehorl ovtehlor ovtehlro ovtehrlo ovtehrol ovteohlr ovteohrl
ovteolhr ovteolrh ovteorlh ovteorhl ovtelohr ovtelorh ovtelhor ovtelhro ovtelrho ovtelroh ovterolh
ovterohl ovterloh ovterlho ovterhlo ovterhol oevrholt oevrhotl oevrhlot oevrhlto oevrhtlo oevrhtol
oevrohlt oevrohtl oevrolht oevrolth oevrotlh oevrothl oevrloht oevrloth oevrlhot oevrlhto oevrltho
oevrltoh oevrtolh oevrtohl oevrtloh oevrtlho oevrthlo oevrthol oevhrolt oevhrotl oevhrlot oevhrlto
oevhrtlo oevhrtol oevhorlt oevhortl oevholrt oevholtr oevhotlr oevhotrl oevhlort oevhlotr oevhlrot
oevhlrto oevhltro oevhltor oevhtolr oevhtorl oevhtlor oevhtlro oevhtrlo oevhtrol oevohrlt oevohrtl
oevohlrt oevohltr oevohtlr oevohtrl oevorhlt oevorhtl oevorlht oevorlth oevortlh oevorthl oevolrht
oevolrth oevolhrt oevolhtr oevolthr oevoltrh oevotrlh oevotrhl oevotlrh oevotlhr oevothlr oevothrl
oevlhort oevlhotr oevlhrot oevlhrto oevlhtro oevlhtor oevlohrt oevlohtr oevlorht oevlorth oevlotrh
oevlothr oevlroht oevlroth oevlrhot oevlrhto oevlrtho oevlrtoh oevltorh oevltohr oevltroh oevltrho
oevlthro oevlthor oevtholr oevthorl oevthlor oevthlro oevthrlo oevthrol oevtohlr oevtohrl oevtolhr
oevtolrh oevtorlh oevtorhl oevtlohr oevtlorh oevtlhor oevtlhro oevtlrho oevtlroh oevtrolh oevtrohl
oevtrloh oevtrlho oevtrhlo oevtrhol oervholt oervhotl oervhlot oervhlto oervhtlo oervhtol oervohlt
oervohtl oervolht oervolth oervotlh oervothl oervloht oervloth oervlhot oervlhto oervltho oervltoh
oervtolh oervtohl oervtloh oervtlho oervthlo oervthol oerhvolt oerhvotl oerhvlot oerhvlto oerhvtlo
oerhvtol oerhovlt oerhovtl oerholvt oerholtv oerhotlv oerhotvl oerhlovt oerhlotv oerhlvot oerhlvto
oerhltvo oerhltov oerhtolv oerhtovl oerhtlov oerhtlvo oerhtvlo oerhtvol oerohvlt oerohvtl oerohlvt
oerohltv oerohtlv oerohtvl oerovhlt oerovhtl oerovlht oerovlth oerovtlh oerovthl oerolvht oerolvth
oerolhvt oerolhtv oerolthv oeroltvh oerotvlh oerotvhl oerotlvh oerotlhv oerothlv oerothvl oerlhovt
oerlhotv oerlhvot oerlhvto oerlhtvo oerlhtov oerlohvt oerlohtv oerlovht oerlovth oerlotvh oerlothv
oerlvoht oerlvoth oerlvhot oerlvhto oerlvtho oerlvtoh oerltovh oerltohv oerltvoh oerltvho oerlthvo
oerlthov oertholv oerthovl oerthlov oerthlvo oerthvlo oerthvol oertohlv oertohvl oertolhv oertolvh
oertovlh oertovhl oertlohv oertlovh oertlhov oertlhvo oertlvho oertlvoh oertvolh oertvohl oertvloh
oertvlho oertvhlo oertvhol oehrvolt oehrvotl oehrvlot oehrvlto oehrvtlo oehrvtol oehrovlt oehrovtl
oehrolvt oehroltv oehrotlv oehrotvl oehrlovt oehrlotv oehrlvot oehrlvto oehrltvo oehrltov oehrtolv
oehrtovl oehrtlov oehrtlvo oehrtvlo oehrtvol oehvrolt oehvrotl oehvrlot oehvrlto oehvrtlo oehvrtol
oehvorlt oehvortl oehvolrt oehvoltr oehvotlr oehvotrl oehvlort oehvlotr oehvlrot oehvlrto oehvltro
oehvltor oehvtolr oehvtorl oehvtlor oehvtlro oehvtrlo oehvtrol oehovrlt oehovrtl oehovlrt oehovltr
oehovtlr oehovtrl oehorvlt oehorvtl oehorlvt oehorltv oehortlv oehortvl oeholrvt oeholrtv oeholvrt
oeholvtr oeholtvr oeholtrv oehotrlv oehotrvl oehotlrv oehotlvr oehotvlr oehotvrl oehlvort oehlvotr
oehlvrot oehlvrto oehlvtro oehlvtor oehlovrt oehlovtr oehlorvt oehlortv oehlotrv oehlotvr oehlrovt
oehlrotv oehlrvot oehlrvto oehlrtvo oehlrtov oehltorv oehltovr oehltrov oehltrvo oehltvro oehltvor
oehtvolr oehtvorl oehtvlor oehtvlro oehtvrlo oehtvrol oehtovlr oehtovrl oehtolvr oehtolrv oehtorlv
oehtorvl oehtlovr oehtlorv oehtlvor oehtlvro oehtlrvo oehtlrov oehtrolv oehtrovl oehtrlov oehtrlvo
oehtrvlo oehtrvol oeorhvlt oeorhvtl oeorhlvt oeorhltv oeorhtlv oeorhtvl oeorvhlt oeorvhtl oeorvlht
oeorvlth oeorvtlh oeorvthl oeorlvht oeorlvth oeorlhvt oeorlhtv oeorlthv oeorltvh oeortvlh oeortvhl
oeortlvh oeortlhv oeorthlv oeorthvl oeohrvlt oeohrvtl oeohrlvt oeohrltv oeohrtlv oeohrtvl oeohvrlt
oeohvrtl oeohvlrt oeohvltr oeohvtlr oeohvtrl oeohlvrt oeohlvtr oeohlrvt oeohlrtv oeohltrv oeohltvr
oeohtvlr oeohtvrl oeohtlvr oeohtlrv oeohtrlv oeohtrvl oeovhrlt oeovhrtl oeovhlrt oeovhltr oeovhtlr
oeovhtrl oeovrhlt oeovrhtl oeovrlht oeovrlth oeovrtlh oeovrthl oeovlrht oeovlrth oeovlhrt oeovlhtr
oeovlthr oeovltrh oeovtrlh oeovtrhl oeovtlrh oeovtlhr oeovthlr oeovthrl oeolhvrt oeolhvtr oeolhrvt
oeolhrtv oeolhtrv oeolhtvr oeolvhrt oeolvhtr oeolvrht oeolvrth oeolvtrh oeolvthr oeolrvht oeolrvth
oeolrhvt oeolrhtv oeolrthv oeolrtvh oeoltvrh oeoltvhr oeoltrvh oeoltrhv oeolthrv oeolthvr oeothvlr
oeothvrl oeothlvr oeothlrv oeothrlv oeothrvl oeotvhlr oeotvhrl oeotvlhr oeotvlrh oeotvrlh oeotvrhl
oeotlvhr oeotlvrh oeotlhvr oeotlhrv oeotlrhv oeotlrvh oeotrvlh oeotrvhl oeotrlvh oeotrlhv oeotrhlv
oeotrhvl oelrhovt oelrhotv oelrhvot oelrhvto oelrhtvo oelrhtov oelrohvt oelrohtv oelrovht oelrovth
oelrotvh oelrothv oelrvoht oelrvoth oelrvhot oelrvhto oelrvtho oelrvtoh oelrtovh oelrtohv oelrtvoh
oelrtvho oelrthvo oelrthov oelhrovt oelhrotv oelhrvot oelhrvto oelhrtvo oelhrtov oelhorvt oelhortv
oelhovrt oelhovtr oelhotvr oelhotrv oelhvort oelhvotr oelhvrot oelhvrto oelhvtro oelhvtor oelhtovr
oelhtorv oelhtvor oelhtvro oelhtrvo oelhtrov oelohrvt oelohrtv oelohvrt oelohvtr oelohtvr oelohtrv
oelorhvt oelorhtv oelorvht oelorvth oelortvh oelorthv oelovrht oelovrth oelovhrt oelovhtr oelovthr
oelovtrh oelotrvh oelotrhv oelotvrh oelotvhr oelothvr oelothrv oelvhort oelvhotr oelvhrot oelvhrto
oelvhtro oelvhtor oelvohrt oelvohtr oelvorht oelvorth oelvotrh oelvothr oelvroht oelvroth oelvrhot
oelvrhto oelvrtho oelvrtoh oelvtorh oelvtohr oelvtroh oelvtrho oelvthro oelvthor oelthovr oelthorv
oelthvor oelthvro oelthrvo oelthrov oeltohvr oeltohrv oeltovhr oeltovrh oeltorvh oeltorhv oeltvohr
oeltvorh oeltvhor oeltvhro oeltvrho oeltvroh oeltrovh oeltrohv oeltrvoh oeltrvho oeltrhvo oeltrhov
oetrholv oetrhovl oetrhlov oetrhlvo oetrhvlo oetrhvol oetrohlv oetrohvl oetrolhv oetrolvh oetrovlh
oetrovhl oetrlohv oetrlovh oetrlhov oetrlhvo oetrlvho oetrlvoh oetrvolh oetrvohl oetrvloh oetrvlho
oetrvhlo oetrvhol oethrolv oethrovl oethrlov oethrlvo oethrvlo oethrvol oethorlv oethorvl oetholrv
oetholvr oethovlr oethovrl oethlorv oethlovr oethlrov oethlrvo oethlvro oethlvor oethvolr oethvorl
oethvlor oethvlro oethvrlo oethvrol oetohrlv oetohrvl oetohlrv oetohlvr oetohvlr oetohvrl oetorhlv
oetorhvl oetorlhv oetorlvh oetorvlh oetorvhl oetolrhv oetolrvh oetolhrv oetolhvr oetolvhr oetolvrh
oetovrlh oetovrhl oetovlrh oetovlhr oetovhlr oetovhrl oetlhorv oetlhovr oetlhrov oetlhrvo oetlhvro
oetlhvor oetlohrv oetlohvr oetlorhv oetlorvh oetlovrh oetlovhr oetlrohv oetlrovh oetlrhov oetlrhvo
oetlrvho oetlrvoh oetlvorh oetlvohr oetlvroh oetlvrho oetlvhro oetlvhor oetvholr oetvhorl oetvhlor
oetvhlro oetvhrlo oetvhrol oetvohlr oetvohrl oetvolhr oetvolrh oetvorlh oetvorhl oetvlohr oetvlorh
oetvlhor oetvlhro oetvlrho oetvlroh oetvrolh oetvrohl oetvrloh oetvrlho oetvrhlo oetvrhol orevholt
orevhotl orevhlot orevhlto orevhtlo orevhtol orevohlt orevohtl orevolht orevolth orevotlh orevothl
orevloht orevloth orevlhot orevlhto orevltho orevltoh orevtolh orevtohl orevtloh orevtlho orevthlo
orevthol orehvolt orehvotl orehvlot orehvlto orehvtlo orehvtol orehovlt orehovtl oreholvt oreholtv
orehotlv orehotvl orehlovt orehlotv orehlvot orehlvto orehltvo orehltov orehtolv orehtovl orehtlov
orehtlvo orehtvlo orehtvol oreohvlt oreohvtl oreohlvt oreohltv oreohtlv oreohtvl oreovhlt oreovhtl
oreovlht oreovlth oreovtlh oreovthl oreolvht oreolvth oreolhvt oreolhtv oreolthv oreoltvh oreotvlh
oreotvhl oreotlvh oreotlhv oreothlv oreothvl orelhovt orelhotv orelhvot orelhvto orelhtvo orelhtov
orelohvt orelohtv orelovht orelovth orelotvh orelothv orelvoht orelvoth orelvhot orelvhto orelvtho
orelvtoh oreltovh oreltohv oreltvoh oreltvho orelthvo orelthov oretholv orethovl orethlov orethlvo
orethvlo orethvol oretohlv oretohvl oretolhv oretolvh oretovlh oretovhl oretlohv oretlovh oretlhov
oretlhvo oretlvho oretlvoh oretvolh oretvohl oretvloh oretvlho oretvhlo oretvhol orveholt orvehotl
orvehlot orvehlto orvehtlo orvehtol orveohlt orveohtl orveolht orveolth orveotlh orveothl orveloht
orveloth orvelhot orvelhto orveltho orveltoh orvetolh orvetohl orvetloh orvetlho orvethlo orvethol
orvheolt orvheotl orvhelot orvhelto orvhetlo orvhetol orvhoelt orvhoetl orvholet orvholte orvhotle
orvhotel orvhloet orvhlote orvhleot orvhleto orvhlteo orvhltoe orvhtole orvhtoel orvhtloe orvhtleo
orvhtelo orvhteol orvohelt orvohetl orvohlet orvohlte orvohtle orvohtel orvoehlt orvoehtl orvoelht
orvoelth orvoetlh orvoethl orvoleht orvoleth orvolhet orvolhte orvolthe orvolteh orvotelh orvotehl
orvotleh orvotlhe orvothle orvothel orvlhoet orvlhote orvlheot orvlheto orvlhteo orvlhtoe orvlohet
orvlohte orvloeht orvloeth orvloteh orvlothe orvleoht orvleoth orvlehot orvlehto orvletho orvletoh
orvltoeh orvltohe orvlteoh orvlteho orvltheo orvlthoe orvthole orvthoel orvthloe orvthleo orvthelo
orvtheol orvtohle orvtohel orvtolhe orvtoleh orvtoelh orvtoehl orvtlohe orvtloeh orvtlhoe orvtlheo
orvtleho orvtleoh orvteolh orvteohl orvteloh orvtelho orvtehlo orvtehol orhveolt orhveotl orhvelot
orhvelto orhvetlo orhvetol orhvoelt orhvoetl orhvolet orhvolte orhvotle orhvotel orhvloet orhvlote
orhvleot orhvleto orhvlteo orhvltoe orhvtole orhvtoel orhvtloe orhvtleo orhvtelo orhvteol orhevolt
orhevotl orhevlot orhevlto orhevtlo orhevtol orheovlt orheovtl orheolvt orheoltv orheotlv orheotvl
orhelovt orhelotv orhelvot orhelvto orheltvo orheltov orhetolv orhetovl orhetlov orhetlvo orhetvlo
orhetvol orhoevlt orhoevtl orhoelvt orhoeltv orhoetlv orhoetvl orhovelt orhovetl orhovlet orhovlte
orhovtle orhovtel orholvet orholvte orholevt orholetv orholtev orholtve orhotvle orhotvel orhotlve
orhotlev orhotelv orhotevl orhleovt orhleotv orhlevot orhlevto orhletvo orhletov orhloevt orhloetv
orhlovet orhlovte orhlotve orhlotev orhlvoet orhlvote orhlveot orhlveto orhlvteo orhlvtoe orhltove
orhltoev orhltvoe orhltveo orhltevo orhlteov orhteolv orhteovl orhtelov orhtelvo orhtevlo orhtevol
orhtoelv orhtoevl orhtolev orhtolve orhtovle orhtovel orhtloev orhtlove orhtleov orhtlevo orhtlveo
orhtlvoe orhtvole orhtvoel orhtvloe orhtvleo orhtvelo orhtveol orovhelt orovhetl orovhlet orovhlte
orovhtle orovhtel orovehlt orovehtl orovelht orovelth orovetlh orovethl orovleht orovleth orovlhet
orovlhte orovlthe orovlteh orovtelh orovtehl orovtleh orovtlhe orovthle orovthel orohvelt orohvetl
orohvlet orohvlte orohvtle orohvtel orohevlt orohevtl orohelvt oroheltv orohetlv orohetvl orohlevt
orohletv orohlvet orohlvte orohltve orohltev orohtelv orohtevl orohtlev orohtlve orohtvle orohtvel
oroehvlt oroehvtl oroehlvt oroehltv oroehtlv oroehtvl oroevhlt oroevhtl oroevlht oroevlth oroevtlh
oroevthl oroelvht oroelvth oroelhvt oroelhtv oroelthv oroeltvh oroetvlh oroetvhl oroetlvh oroetlhv
oroethlv oroethvl orolhevt orolhetv orolhvet orolhvte orolhtve orolhtev orolehvt orolehtv orolevht
orolevth oroletvh orolethv orolveht orolveth orolvhet orolvhte orolvthe orolvteh oroltevh oroltehv
oroltveh oroltvhe orolthve orolthev orothelv orothevl orothlev orothlve orothvle orothvel orotehlv
orotehvl orotelhv orotelvh orotevlh orotevhl orotlehv orotlevh orotlhev orotlhve orotlvhe orotlveh
orotvelh orotvehl orotvleh orotvlhe orotvhle orotvhel orlvhoet orlvhote orlvheot orlvheto orlvhteo
orlvhtoe orlvohet orlvohte orlvoeht orlvoeth orlvoteh orlvothe orlveoht orlveoth orlvehot orlvehto
orlvetho orlvetoh orlvtoeh orlvtohe orlvteoh orlvteho orlvtheo orlvthoe orlhvoet orlhvote orlhveot
orlhveto orlhvteo orlhvtoe orlhovet orlhovte orlhoevt orlhoetv orlhotev orlhotve orlheovt orlheotv
orlhevot orlhevto orlhetvo orlhetov orlhtoev orlhtove orlhteov orlhtevo orlhtveo orlhtvoe orlohvet
orlohvte orlohevt orlohetv orlohtev orlohtve orlovhet orlovhte orloveht orloveth orlovteh orlovthe
orloevht orloevth orloehvt orloehtv orloethv orloetvh orlotveh orlotvhe orlotevh orlotehv orlothev
orlothve orlehovt orlehotv orlehvot orlehvto orlehtvo orlehtov orleohvt orleohtv orleovht orleovth
orleotvh orleothv orlevoht orlevoth orlevhot orlevhto orlevtho orlevtoh orletovh orletohv orletvoh
orletvho orlethvo orlethov orlthoev orlthove orltheov orlthevo orlthveo orlthvoe orltohev orltohve
orltoehv orltoevh orltoveh orltovhe orlteohv orlteovh orltehov orltehvo orltevho orltevoh orltvoeh
orltvohe orltveoh orltveho orltvheo orltvhoe ortvhole ortvhoel ortvhloe ortvhleo ortvhelo ortvheol
ortvohle ortvohel ortvolhe ortvoleh ortvoelh ortvoehl ortvlohe ortvloeh ortvlhoe ortvlheo ortvleho
ortvleoh ortveolh ortveohl ortveloh ortvelho ortvehlo ortvehol orthvole orthvoel orthvloe orthvleo
orthvelo orthveol orthovle orthovel ortholve ortholev orthoelv orthoevl orthlove orthloev orthlvoe
orthlveo orthlevo orthleov ortheolv ortheovl orthelov orthelvo orthevlo orthevol ortohvle ortohvel
ortohlve ortohlev ortohelv ortohevl ortovhle ortovhel ortovlhe ortovleh ortovelh ortovehl ortolvhe
ortolveh ortolhve ortolhev ortolehv ortolevh ortoevlh ortoevhl ortoelvh ortoelhv ortoehlv ortoehvl
ortlhove ortlhoev ortlhvoe ortlhveo ortlhevo ortlheov ortlohve ortlohev ortlovhe ortloveh ortloevh
ortloehv ortlvohe ortlvoeh ortlvhoe ortlvheo ortlveho ortlveoh ortleovh ortleohv ortlevoh ortlevho
ortlehvo ortlehov orteholv ortehovl ortehlov ortehlvo ortehvlo ortehvol orteohlv orteohvl orteolhv
orteolvh orteovlh orteovhl ortelohv ortelovh ortelhov ortelhvo ortelvho ortelvoh ortevolh ortevohl
ortevloh ortevlho ortevhlo ortevhol ohervolt ohervotl ohervlot ohervlto ohervtlo ohervtol oherovlt
oherovtl oherolvt oheroltv oherotlv oherotvl oherlovt oherlotv oherlvot oherlvto oherltvo oherltov
ohertolv ohertovl ohertlov ohertlvo ohertvlo ohertvol ohevrolt ohevrotl ohevrlot ohevrlto ohevrtlo
ohevrtol ohevorlt ohevortl ohevolrt ohevoltr ohevotlr ohevotrl ohevlort ohevlotr ohevlrot ohevlrto
ohevltro ohevltor ohevtolr ohevtorl ohevtlor ohevtlro ohevtrlo ohevtrol oheovrlt oheovrtl oheovlrt
oheovltr oheovtlr oheovtrl oheorvlt oheorvtl oheorlvt oheorltv oheortlv oheortvl oheolrvt oheolrtv
oheolvrt oheolvtr oheoltvr oheoltrv oheotrlv oheotrvl oheotlrv oheotlvr oheotvlr oheotvrl ohelvort
ohelvotr ohelvrot ohelvrto ohelvtro ohelvtor ohelovrt ohelovtr ohelorvt ohelortv ohelotrv ohelotvr
ohelrovt ohelrotv ohelrvot ohelrvto ohelrtvo ohelrtov oheltorv oheltovr oheltrov oheltrvo oheltvro
oheltvor ohetvolr ohetvorl ohetvlor ohetvlro ohetvrlo ohetvrol ohetovlr ohetovrl ohetolvr ohetolrv
ohetorlv ohetorvl ohetlovr ohetlorv ohetlvor ohetlvro ohetlrvo ohetlrov ohetrolv ohetrovl ohetrlov
ohetrlvo ohetrvlo ohetrvol ohrevolt ohrevotl ohrevlot ohrevlto ohrevtlo ohrevtol ohreovlt ohreovtl
ohreolvt ohreoltv ohreotlv ohreotvl ohrelovt ohrelotv ohrelvot ohrelvto ohreltvo ohreltov ohretolv
ohretovl ohretlov ohretlvo ohretvlo ohretvol ohrveolt ohrveotl ohrvelot ohrvelto ohrvetlo ohrvetol
ohrvoelt ohrvoetl ohrvolet ohrvolte ohrvotle ohrvotel ohrvloet ohrvlote ohrvleot ohrvleto ohrvlteo
ohrvltoe ohrvtole ohrvtoel ohrvtloe ohrvtleo ohrvtelo ohrvteol ohrovelt ohrovetl ohrovlet ohrovlte
ohrovtle ohrovtel ohroevlt ohroevtl ohroelvt ohroeltv ohroetlv ohroetvl ohrolevt ohroletv ohrolvet
ohrolvte ohroltve ohroltev ohrotelv ohrotevl ohrotlev ohrotlve ohrotvle ohrotvel ohrlvoet ohrlvote
ohrlveot ohrlveto ohrlvteo ohrlvtoe ohrlovet ohrlovte ohrloevt ohrloetv ohrlotev ohrlotve ohrleovt
ohrleotv ohrlevot ohrlevto ohrletvo ohrletov ohrltoev ohrltove ohrlteov ohrltevo ohrltveo ohrltvoe
ohrtvole ohrtvoel ohrtvloe ohrtvleo ohrtvelo ohrtveol ohrtovle ohrtovel ohrtolve ohrtolev ohrtoelv
ohrtoevl ohrtlove ohrtloev ohrtlvoe ohrtlveo ohrtlevo ohrtleov ohrteolv ohrteovl ohrtelov ohrtelvo
ohrtevlo ohrtevol ohvreolt ohvreotl ohvrelot ohvrelto ohvretlo ohvretol ohvroelt ohvroetl ohvrolet
ohvrolte ohvrotle ohvrotel ohvrloet ohvrlote ohvrleot ohvrleto ohvrlteo ohvrltoe ohvrtole ohvrtoel
ohvrtloe ohvrtleo ohvrtelo ohvrteol ohverolt ohverotl ohverlot ohverlto ohvertlo ohvertol ohveorlt
ohveortl ohveolrt ohveoltr ohveotlr ohveotrl ohvelort ohvelotr ohvelrot ohvelrto ohveltro ohveltor
ohvetolr ohvetorl ohvetlor ohvetlro ohvetrlo ohvetrol ohvoerlt ohvoertl ohvoelrt ohvoeltr ohvoetlr
ohvoetrl ohvorelt ohvoretl ohvorlet ohvorlte ohvortle ohvortel ohvolret ohvolrte ohvolert ohvoletr
ohvolter ohvoltre ohvotrle ohvotrel ohvotlre ohvotler ohvotelr ohvoterl ohvleort ohvleotr ohvlerot
ohvlerto ohvletro ohvletor ohvloert ohvloetr ohvloret ohvlorte ohvlotre ohvloter ohvlroet ohvlrote
ohvlreot ohvlreto ohvlrteo ohvlrtoe ohvltore ohvltoer ohvltroe ohvltreo ohvltero ohvlteor ohvteolr
ohvteorl ohvtelor ohvtelro ohvterlo ohvterol ohvtoelr ohvtoerl ohvtoler ohvtolre ohvtorle ohvtorel
ohvtloer ohvtlore ohvtleor ohvtlero ohvtlreo ohvtlroe ohvtrole ohvtroel ohvtrloe ohvtrleo ohvtrelo
ohvtreol ohorvelt ohorvetl ohorvlet ohorvlte ohorvtle ohorvtel ohorevlt ohorevtl ohorelvt ohoreltv
ohoretlv ohoretvl ohorlevt ohorletv ohorlvet ohorlvte ohorltve ohorltev ohortelv ohortevl ohortlev
ohortlve ohortvle ohortvel ohovrelt ohovretl ohovrlet ohovrlte ohovrtle ohovrtel ohoverlt ohovertl
ohovelrt ohoveltr ohovetlr ohovetrl ohovlert ohovletr ohovlret ohovlrte ohovltre ohovlter ohovtelr
ohovterl ohovtler ohovtlre ohovtrle ohovtrel ohoevrlt ohoevrtl ohoevlrt ohoevltr ohoevtlr ohoevtrl
ohoervlt ohoervtl ohoerlvt ohoerltv ohoertlv ohoertvl ohoelrvt ohoelrtv ohoelvrt ohoelvtr ohoeltvr
ohoeltrv ohoetrlv ohoetrvl ohoetlrv ohoetlvr ohoetvlr ohoetvrl oholvert oholvetr oholvret oholvrte
oholvtre oholvter oholevrt oholevtr oholervt oholertv oholetrv oholetvr oholrevt oholretv oholrvet
oholrvte oholrtve oholrtev oholterv oholtevr oholtrev oholtrve oholtvre oholtver ohotvelr ohotverl
ohotvler ohotvlre ohotvrle ohotvrel ohotevlr ohotevrl ohotelvr ohotelrv ohoterlv ohotervl ohotlevr
ohotlerv ohotlver ohotlvre ohotlrve ohotlrev ohotrelv ohotrevl ohotrlev ohotrlve ohotrvle ohotrvel
ohlrvoet ohlrvote ohlrveot ohlrveto ohlrvteo ohlrvtoe ohlrovet ohlrovte ohlroevt ohlroetv ohlrotev
ohlrotve ohlreovt ohlreotv ohlrevot ohlrevto ohlretvo ohlretov ohlrtoev ohlrtove ohlrteov ohlrtevo
ohlrtveo ohlrtvoe ohlvroet ohlvrote ohlvreot ohlvreto ohlvrteo ohlvrtoe ohlvoret ohlvorte ohlvoert
ohlvoetr ohlvoter ohlvotre ohlveort ohlveotr ohlverot ohlverto ohlvetro ohlvetor ohlvtoer ohlvtore
ohlvteor ohlvtero ohlvtreo ohlvtroe ohlovret ohlovrte ohlovert ohlovetr ohlovter ohlovtre ohlorvet
ohlorvte ohlorevt ohloretv ohlortev ohlortve ohloervt ohloertv ohloevrt ohloevtr ohloetvr ohloetrv
ohlotrev ohlotrve ohloterv ohlotevr ohlotver ohlotvre ohlevort ohlevotr ohlevrot ohlevrto ohlevtro
ohlevtor ohleovrt ohleovtr ohleorvt ohleortv ohleotrv ohleotvr ohlerovt ohlerotv ohlervot ohlervto
ohlertvo ohlertov ohletorv ohletovr ohletrov ohletrvo ohletvro ohletvor ohltvoer ohltvore ohltveor
ohltvero ohltvreo ohltvroe ohltover ohltovre ohltoevr ohltoerv ohltorev ohltorve ohlteovr ohlteorv
ohltevor ohltevro ohltervo ohlterov ohltroev ohltrove ohltreov ohltrevo ohltrveo ohltrvoe ohtrvole
ohtrvoel ohtrvloe ohtrvleo ohtrvelo ohtrveol ohtrovle ohtrovel ohtrolve ohtrolev ohtroelv ohtroevl
ohtrlove ohtrloev ohtrlvoe ohtrlveo ohtrlevo ohtrleov ohtreolv ohtreovl ohtrelov ohtrelvo ohtrevlo
ohtrevol ohtvrole ohtvroel ohtvrloe ohtvrleo ohtvrelo ohtvreol ohtvorle ohtvorel ohtvolre ohtvoler
ohtvoelr ohtvoerl ohtvlore ohtvloer ohtvlroe ohtvlreo ohtvlero ohtvleor ohtveolr ohtveorl ohtvelor
ohtvelro ohtverlo ohtverol ohtovrle ohtovrel ohtovlre ohtovler ohtovelr ohtoverl ohtorvle ohtorvel
ohtorlve ohtorlev ohtorelv ohtorevl ohtolrve ohtolrev ohtolvre ohtolver ohtolevr ohtolerv ohtoerlv
ohtoervl ohtoelrv ohtoelvr ohtoevlr ohtoevrl ohtlvore ohtlvoer ohtlvroe ohtlvreo ohtlvero ohtlveor
ohtlovre ohtlover ohtlorve ohtlorev ohtloerv ohtloevr ohtlrove ohtlroev ohtlrvoe ohtlrveo ohtlrevo
ohtlreov ohtleorv ohtleovr ohtlerov ohtlervo ohtlevro ohtlevor ohtevolr ohtevorl ohtevlor ohtevlro
ohtevrlo ohtevrol ohteovlr ohteovrl ohteolvr ohteolrv ohteorlv ohteorvl ohtelovr ohtelorv ohtelvor
ohtelvro ohtelrvo ohtelrov ohterolv ohterovl ohterlov ohterlvo ohtervlo ohtervol ooerhvlt ooerhvtl
ooerhlvt ooerhltv ooerhtlv ooerhtvl ooervhlt ooervhtl ooervlht ooervlth ooervtlh ooervthl ooerlvht
ooerlvth ooerlhvt ooerlhtv ooerlthv ooerltvh ooertvlh ooertvhl ooertlvh ooertlhv ooerthlv ooerthvl
ooehrvlt ooehrvtl ooehrlvt ooehrltv ooehrtlv ooehrtvl ooehvrlt ooehvrtl ooehvlrt ooehvltr ooehvtlr
ooehvtrl ooehlvrt ooehlvtr ooehlrvt ooehlrtv ooehltrv ooehltvr ooehtvlr ooehtvrl ooehtlvr ooehtlrv
ooehtrlv ooehtrvl ooevhrlt ooevhrtl ooevhlrt ooevhltr ooevhtlr ooevhtrl ooevrhlt ooevrhtl ooevrlht
ooevrlth ooevrtlh ooevrthl ooevlrht ooevlrth ooevlhrt ooevlhtr ooevlthr ooevltrh ooevtrlh ooevtrhl
ooevtlrh ooevtlhr ooevthlr ooevthrl ooelhvrt ooelhvtr ooelhrvt ooelhrtv ooelhtrv ooelhtvr ooelvhrt
ooelvhtr ooelvrht ooelvrth ooelvtrh ooelvthr ooelrvht ooelrvth ooelrhvt ooelrhtv ooelrthv ooelrtvh
ooeltvrh ooeltvhr ooeltrvh ooeltrhv ooelthrv ooelthvr ooethvlr ooethvrl ooethlvr ooethlrv ooethrlv
ooethrvl ooetvhlr ooetvhrl ooetvlhr ooetvlrh ooetvrlh ooetvrhl ooetlvhr ooetlvrh ooetlhvr ooetlhrv
ooetlrhv ooetlrvh ooetrvlh ooetrvhl ooetrlvh ooetrlhv ooetrhlv ooetrhvl oorehvlt oorehvtl oorehlvt
oorehltv oorehtlv oorehtvl oorevhlt oorevhtl oorevlht oorevlth oorevtlh oorevthl oorelvht oorelvth
oorelhvt oorelhtv oorelthv ooreltvh ooretvlh ooretvhl ooretlvh ooretlhv oorethlv oorethvl oorhevlt
oorhevtl oorhelvt oorheltv oorhetlv oorhetvl oorhvelt oorhvetl oorhvlet oorhvlte oorhvtle oorhvtel
oorhlvet oorhlvte oorhlevt oorhletv oorhltev oorhltve oorhtvle oorhtvel oorhtlve oorhtlev oorhtelv
oorhtevl oorvhelt oorvhetl oorvhlet oorvhlte oorvhtle oorvhtel oorvehlt oorvehtl oorvelht oorvelth
oorvetlh oorvethl oorvleht oorvleth oorvlhet oorvlhte oorvlthe oorvlteh oorvtelh oorvtehl oorvtleh
oorvtlhe oorvthle oorvthel oorlhvet oorlhvte oorlhevt oorlhetv oorlhtev oorlhtve oorlvhet oorlvhte
oorlveht oorlveth oorlvteh oorlvthe oorlevht oorlevth oorlehvt oorlehtv oorlethv oorletvh oorltveh
oorltvhe oorltevh oorltehv oorlthev oorlthve oorthvle oorthvel oorthlve oorthlev oorthelv oorthevl
oortvhle oortvhel oortvlhe oortvleh oortvelh oortvehl oortlvhe oortlveh oortlhve oortlhev oortlehv
oortlevh oortevlh oortevhl oortelvh oortelhv oortehlv oortehvl oohrevlt oohrevtl oohrelvt oohreltv
oohretlv oohretvl oohrvelt oohrvetl oohrvlet oohrvlte oohrvtle oohrvtel oohrlvet oohrlvte oohrlevt
oohrletv oohrltev oohrltve oohrtvle oohrtvel oohrtlve oohrtlev oohrtelv oohrtevl oohervlt oohervtl
ooherlvt ooherltv oohertlv oohertvl oohevrlt oohevrtl oohevlrt oohevltr oohevtlr oohevtrl oohelvrt
oohelvtr oohelrvt oohelrtv ooheltrv ooheltvr oohetvlr oohetvrl oohetlvr oohetlrv oohetrlv oohetrvl
oohverlt oohvertl oohvelrt oohveltr oohvetlr oohvetrl oohvrelt oohvretl oohvrlet oohvrlte oohvrtle
oohvrtel oohvlret oohvlrte oohvlert oohvletr oohvlter oohvltre oohvtrle oohvtrel oohvtlre oohvtler
oohvtelr oohvterl oohlevrt oohlevtr oohlervt oohlertv oohletrv oohletvr oohlvert oohlvetr oohlvret
oohlvrte oohlvtre oohlvter oohlrvet oohlrvte oohlrevt oohlretv oohlrtev oohlrtve oohltvre oohltver
oohltrve oohltrev oohlterv oohltevr oohtevlr oohtevrl oohtelvr oohtelrv oohterlv oohtervl oohtvelr
oohtverl oohtvler oohtvlre oohtvrle oohtvrel oohtlver oohtlvre oohtlevr oohtlerv oohtlrev oohtlrve
oohtrvle oohtrvel oohtrlve oohtrlev oohtrelv oohtrevl oovrhelt oovrhetl oovrhlet oovrhlte oovrhtle
oovrhtel oovrehlt oovrehtl oovrelht oovrelth oovretlh oovrethl oovrleht oovrleth oovrlhet oovrlhte
oovrlthe oovrlteh oovrtelh oovrtehl oovrtleh oovrtlhe oovrthle oovrthel oovhrelt oovhretl oovhrlet
oovhrlte oovhrtle oovhrtel oovherlt oovhertl oovhelrt oovheltr oovhetlr oovhetrl oovhlert oovhletr
oovhlret oovhlrte oovhltre oovhlter oovhtelr oovhterl oovhtler oovhtlre oovhtrle oovhtrel oovehrlt
oovehrtl oovehlrt oovehltr oovehtlr oovehtrl ooverhlt ooverhtl ooverlht ooverlth oovertlh ooverthl
oovelrht oovelrth oovelhrt oovelhtr oovelthr ooveltrh oovetrlh oovetrhl oovetlrh oovetlhr oovethlr
oovethrl oovlhert oovlhetr oovlhret oovlhrte oovlhtre oovlhter oovlehrt oovlehtr oovlerht oovlerth
oovletrh oovlethr oovlreht oovlreth oovlrhet oovlrhte oovlrthe oovlrteh oovlterh oovltehr oovltreh
oovltrhe oovlthre oovlther oovthelr oovtherl oovthler oovthlre oovthrle oovthrel oovtehlr oovtehrl
oovtelhr oovtelrh oovterlh oovterhl oovtlehr oovtlerh oovtlher oovtlhre oovtlrhe oovtlreh oovtrelh
oovtrehl oovtrleh oovtrlhe oovtrhle oovtrhel oolrhvet oolrhvte oolrhevt oolrhetv oolrhtev oolrhtve
oolrvhet oolrvhte oolrveht oolrveth oolrvteh oolrvthe oolrevht oolrevth oolrehvt oolrehtv oolrethv
oolretvh oolrtveh oolrtvhe oolrtevh oolrtehv oolrthev oolrthve oolhrvet oolhrvte oolhrevt oolhretv
oolhrtev oolhrtve oolhvret oolhvrte oolhvert oolhvetr oolhvter oolhvtre oolhevrt oolhevtr oolhervt
oolhertv oolhetrv oolhetvr oolhtver oolhtvre oolhtevr oolhterv oolhtrev oolhtrve oolvhret oolvhrte
oolvhert oolvhetr oolvhter oolvhtre oolvrhet oolvrhte oolvreht oolvreth oolvrteh oolvrthe oolverht
oolverth oolvehrt oolvehtr oolvethr oolvetrh oolvtreh oolvtrhe oolvterh oolvtehr oolvther oolvthre
oolehvrt oolehvtr oolehrvt oolehrtv oolehtrv oolehtvr oolevhrt oolevhtr oolevrht oolevrth oolevtrh
oolevthr oolervht oolervth oolerhvt oolerhtv oolerthv oolertvh ooletvrh ooletvhr ooletrvh ooletrhv
oolethrv oolethvr oolthver oolthvre oolthevr ooltherv oolthrev oolthrve ooltvher ooltvhre ooltvehr
ooltverh ooltvreh ooltvrhe ooltevhr ooltevrh ooltehvr ooltehrv oolterhv ooltervh ooltrveh ooltrvhe
ooltrevh ooltrehv ooltrhev ooltrhve ootrhvle ootrhvel ootrhlve ootrhlev ootrhelv ootrhevl ootrvhle
ootrvhel ootrvlhe ootrvleh ootrvelh ootrvehl ootrlvhe ootrlveh ootrlhve ootrlhev ootrlehv ootrlevh
ootrevlh ootrevhl ootrelvh ootrelhv ootrehlv ootrehvl oothrvle oothrvel oothrlve oothrlev oothrelv
oothrevl oothvrle oothvrel oothvlre oothvler oothvelr oothverl oothlvre oothlver oothlrve oothlrev
oothlerv oothlevr oothevlr oothevrl oothelvr oothelrv ootherlv oothervl ootvhrle ootvhrel ootvhlre
ootvhler ootvhelr ootvherl ootvrhle ootvrhel ootvrlhe ootvrleh ootvrelh ootvrehl ootvlrhe ootvlreh
ootvlhre ootvlher ootvlehr ootvlerh ootverlh ootverhl ootvelrh ootvelhr ootvehlr ootvehrl ootlhvre
ootlhver ootlhrve ootlhrev ootlherv ootlhevr ootlvhre ootlvher ootlvrhe ootlvreh ootlverh ootlvehr
ootlrvhe ootlrveh ootlrhve ootlrhev ootlrehv ootlrevh ootlevrh ootlevhr ootlervh ootlerhv ootlehrv
ootlehvr ootehvlr ootehvrl ootehlvr ootehlrv ootehrlv ootehrvl ootevhlr ootevhrl ootevlhr ootevlrh
ootevrlh ootevrhl ootelvhr ootelvrh ootelhvr ootelhrv ootelrhv ootelrvh ootervlh ootervhl ooterlvh
ooterlhv ooterhlv ooterhvl olerhovt olerhotv olerhvot olerhvto olerhtvo olerhtov olerohvt olerohtv
olerovht olerovth olerotvh olerothv olervoht olervoth olervhot olervhto olervtho olervtoh olertovh
olertohv olertvoh olertvho olerthvo olerthov olehrovt olehrotv olehrvot olehrvto olehrtvo olehrtov
olehorvt olehortv olehovrt olehovtr olehotvr olehotrv olehvort olehvotr olehvrot olehvrto olehvtro
olehvtor olehtovr olehtorv olehtvor olehtvro olehtrvo olehtrov oleohrvt oleohrtv oleohvrt oleohvtr
oleohtvr oleohtrv oleorhvt oleorhtv oleorvht oleorvth oleortvh oleorthv oleovrht oleovrth oleovhrt
oleovhtr oleovthr oleovtrh oleotrvh oleotrhv oleotvrh oleotvhr oleothvr oleothrv olevhort olevhotr
olevhrot olevhrto olevhtro olevhtor olevohrt olevohtr olevorht olevorth olevotrh olevothr olevroht
olevroth olevrhot olevrhto olevrtho olevrtoh olevtorh olevtohr olevtroh olevtrho olevthro olevthor
olethovr olethorv olethvor olethvro olethrvo olethrov oletohvr oletohrv oletovhr oletovrh oletorvh
oletorhv oletvohr oletvorh oletvhor oletvhro oletvrho oletvroh oletrovh oletrohv oletrvoh oletrvho
oletrhvo oletrhov olrehovt olrehotv olrehvot olrehvto olrehtvo olrehtov olreohvt olreohtv olreovht
olreovth olreotvh olreothv olrevoht olrevoth olrevhot olrevhto olrevtho olrevtoh olretovh olretohv
olretvoh olretvho olrethvo olrethov olrheovt olrheotv olrhevot olrhevto olrhetvo olrhetov olrhoevt
olrhoetv olrhovet olrhovte olrhotve olrhotev olrhvoet olrhvote olrhveot olrhveto olrhvteo olrhvtoe
olrhtove olrhtoev olrhtvoe olrhtveo olrhtevo olrhteov olrohevt olrohetv olrohvet olrohvte olrohtve
olrohtev olroehvt olroehtv olroevht olroevth olroetvh olroethv olroveht olroveth olrovhet olrovhte
olrovthe olrovteh olrotevh olrotehv olrotveh olrotvhe olrothve olrothev olrvhoet olrvhote olrvheot
olrvheto olrvhteo olrvhtoe olrvohet olrvohte olrvoeht olrvoeth olrvoteh olrvothe olrveoht olrveoth
olrvehot olrvehto olrvetho olrvetoh olrvtoeh olrvtohe olrvteoh olrvteho olrvtheo olrvthoe olrthove
olrthoev olrthvoe olrthveo olrthevo olrtheov olrtohve olrtohev olrtovhe olrtoveh olrtoevh olrtoehv
olrtvohe olrtvoeh olrtvhoe olrtvheo olrtveho olrtveoh olrteovh olrteohv olrtevoh olrtevho olrtehvo
olrtehov olhreovt olhreotv olhrevot olhrevto olhretvo olhretov olhroevt olhroetv olhrovet olhrovte
olhrotve olhrotev olhrvoet olhrvote olhrveot olhrveto olhrvteo olhrvtoe olhrtove olhrtoev olhrtvoe
olhrtveo olhrtevo olhrteov olherovt olherotv olhervot olhervto olhertvo olhertov olheorvt olheortv
olheovrt olheovtr olheotvr olheotrv olhevort olhevotr olhevrot olhevrto olhevtro olhevtor olhetovr
olhetorv olhetvor olhetvro olhetrvo olhetrov olhoervt olhoertv olhoevrt olhoevtr olhoetvr olhoetrv
olhorevt olhoretv olhorvet olhorvte olhortve olhortev olhovret olhovrte olhovert olhovetr olhovter
olhovtre olhotrve olhotrev olhotvre olhotver olhotevr olhoterv olhveort olhveotr olhverot olhverto
olhvetro olhvetor olhvoert olhvoetr olhvoret olhvorte olhvotre olhvoter olhvroet olhvrote olhvreot
olhvreto olhvrteo olhvrtoe olhvtore olhvtoer olhvtroe olhvtreo olhvtero olhvteor olhteovr olhteorv
olhtevor olhtevro olhtervo olhterov olhtoevr olhtoerv olhtover olhtovre olhtorve olhtorev olhtvoer
olhtvore olhtveor olhtvero olhtvreo olhtvroe olhtrove olhtroev olhtrvoe olhtrveo olhtrevo olhtreov
olorhevt olorhetv olorhvet olorhvte olorhtve olorhtev olorehvt olorehtv olorevht olorevth oloretvh
olorethv olorveht olorveth olorvhet olorvhte olorvthe olorvteh olortevh olortehv olortveh olortvhe
olorthve olorthev olohrevt olohretv olohrvet olohrvte olohrtve olohrtev olohervt olohertv olohevrt
olohevtr olohetvr olohetrv olohvert olohvetr olohvret olohvrte olohvtre olohvter olohtevr olohterv
olohtver olohtvre olohtrve olohtrev oloehrvt oloehrtv oloehvrt oloehvtr oloehtvr oloehtrv oloerhvt
oloerhtv oloervht oloervth oloertvh oloerthv oloevrht oloevrth oloevhrt oloevhtr oloevthr oloevtrh
oloetrvh oloetrhv oloetvrh oloetvhr oloethvr oloethrv olovhert olovhetr olovhret olovhrte olovhtre
olovhter olovehrt olovehtr oloverht oloverth olovetrh olovethr olovreht olovreth olovrhet olovrhte
olovrthe olovrteh olovterh olovtehr olovtreh olovtrhe olovthre olovther olothevr olotherv olothver
olothvre olothrve olothrev olotehvr olotehrv olotevhr olotevrh olotervh oloterhv olotvehr olotverh
olotvher olotvhre olotvrhe olotvreh olotrevh olotrehv olotrveh olotrvhe olotrhve olotrhev olvrhoet
olvrhote olvrheot olvrheto olvrhteo olvrhtoe olvrohet olvrohte olvroeht olvroeth olvroteh olvrothe
olvreoht olvreoth olvrehot olvrehto olvretho olvretoh olvrtoeh olvrtohe olvrteoh olvrteho olvrtheo
olvrthoe olvhroet olvhrote olvhreot olvhreto olvhrteo olvhrtoe olvhoret olvhorte olvhoert olvhoetr
olvhoter olvhotre olvheort olvheotr olvherot olvherto olvhetro olvhetor olvhtoer olvhtore olvhteor
olvhtero olvhtreo olvhtroe olvohret olvohrte olvohert olvohetr olvohter olvohtre olvorhet olvorhte
olvoreht olvoreth olvorteh olvorthe olvoerht olvoerth olvoehrt olvoehtr olvoethr olvoetrh olvotreh
olvotrhe olvoterh olvotehr olvother olvothre olvehort olvehotr olvehrot olvehrto olvehtro olvehtor
olveohrt olveohtr olveorht olveorth olveotrh olveothr olveroht olveroth olverhot olverhto olvertho
olvertoh olvetorh olvetohr olvetroh olvetrho olvethro olvethor olvthoer olvthore olvtheor olvthero
olvthreo olvthroe olvtoher olvtohre olvtoehr olvtoerh olvtoreh olvtorhe olvteohr olvteorh olvtehor
olvtehro olvterho olvteroh olvtroeh olvtrohe olvtreoh olvtreho olvtrheo olvtrhoe oltrhove oltrhoev
oltrhvoe oltrhveo oltrhevo oltrheov oltrohve oltrohev oltrovhe oltroveh oltroevh oltroehv oltrvohe
oltrvoeh oltrvhoe oltrvheo oltrveho oltrveoh oltreovh oltreohv oltrevoh oltrevho oltrehvo oltrehov
olthrove olthroev olthrvoe olthrveo olthrevo olthreov olthorve olthorev olthovre olthover olthoevr
olthoerv olthvore olthvoer olthvroe olthvreo olthvero olthveor oltheovr oltheorv olthevor olthevro
olthervo oltherov oltohrve oltohrev oltohvre oltohver oltohevr oltoherv oltorhve oltorhev oltorvhe
oltorveh oltorevh oltorehv oltovrhe oltovreh oltovhre oltovher oltovehr oltoverh oltoervh oltoerhv
oltoevrh oltoevhr oltoehvr oltoehrv oltvhore oltvhoer oltvhroe oltvhreo oltvhero oltvheor oltvohre
oltvoher oltvorhe oltvoreh oltvoerh oltvoehr oltvrohe oltvroeh oltvrhoe oltvrheo oltvreho oltvreoh
oltveorh oltveohr oltveroh oltverho oltvehro oltvehor oltehovr oltehorv oltehvor oltehvro oltehrvo
oltehrov olteohvr olteohrv olteovhr olteovrh olteorvh olteorhv oltevohr oltevorh oltevhor oltevhro
oltevrho oltevroh olterovh olterohv oltervoh oltervho olterhvo olterhov oterholv oterhovl oterhlov
oterhlvo oterhvlo oterhvol oterohlv oterohvl oterolhv oterolvh oterovlh oterovhl oterlohv oterlovh
oterlhov oterlhvo oterlvho oterlvoh otervolh otervohl otervloh otervlho otervhlo otervhol otehrolv
otehrovl otehrlov otehrlvo otehrvlo otehrvol otehorlv otehorvl oteholrv oteholvr otehovlr otehovrl
otehlorv otehlovr otehlrov otehlrvo otehlvro otehlvor otehvolr otehvorl otehvlor otehvlro otehvrlo
otehvrol oteohrlv oteohrvl oteohlrv oteohlvr oteohvlr oteohvrl oteorhlv oteorhvl oteorlhv oteorlvh
oteorvlh oteorvhl oteolrhv oteolrvh oteolhrv oteolhvr oteolvhr oteolvrh oteovrlh oteovrhl oteovlrh
oteovlhr oteovhlr oteovhrl otelhorv otelhovr otelhrov otelhrvo otelhvro otelhvor otelohrv otelohvr
otelorhv otelorvh otelovrh otelovhr otelrohv otelrovh otelrhov otelrhvo otelrvho otelrvoh otelvorh
otelvohr otelvroh otelvrho otelvhro otelvhor otevholr otevhorl otevhlor otevhlro otevhrlo otevhrol
otevohlr otevohrl otevolhr otevolrh otevorlh otevorhl otevlohr otevlorh otevlhor otevlhro otevlrho
otevlroh otevrolh otevrohl otevrloh otevrlho otevrhlo otevrhol otreholv otrehovl otrehlov otrehlvo
otrehvlo otrehvol otreohlv otreohvl otreolhv otreolvh otreovlh otreovhl otrelohv otrelovh otrelhov
otrelhvo otrelvho otrelvoh otrevolh otrevohl otrevloh otrevlho otrevhlo otrevhol otrheolv otrheovl
otrhelov otrhelvo otrhevlo otrhevol otrhoelv otrhoevl otrholev otrholve otrhovle otrhovel otrhloev
otrhlove otrhleov otrhlevo otrhlveo otrhlvoe otrhvole otrhvoel otrhvloe otrhvleo otrhvelo otrhveol
otrohelv otrohevl otrohlev otrohlve otrohvle otrohvel otroehlv otroehvl otroelhv otroelvh otroevlh
otroevhl otrolehv otrolevh otrolhev otrolhve otrolvhe otrolveh otrovelh otrovehl otrovleh otrovlhe
otrovhle otrovhel otrlhoev otrlhove otrlheov otrlhevo otrlhveo otrlhvoe otrlohev otrlohve otrloehv
otrloevh otrloveh otrlovhe otrleohv otrleovh otrlehov otrlehvo otrlevho otrlevoh otrlvoeh otrlvohe
otrlveoh otrlveho otrlvheo otrlvhoe otrvhole otrvhoel otrvhloe otrvhleo otrvhelo otrvheol otrvohle
otrvohel otrvolhe otrvoleh otrvoelh otrvoehl otrvlohe otrvloeh otrvlhoe otrvlheo otrvleho otrvleoh
otrveolh otrveohl otrveloh otrvelho otrvehlo otrvehol othreolv othreovl othrelov othrelvo othrevlo
othrevol othroelv othroevl othrolev othrolve othrovle othrovel othrloev othrlove othrleov othrlevo
othrlveo othrlvoe othrvole othrvoel othrvloe othrvleo othrvelo othrveol otherolv otherovl otherlov
otherlvo othervlo othervol otheorlv otheorvl otheolrv otheolvr otheovlr otheovrl othelorv othelovr
othelrov othelrvo othelvro othelvor othevolr othevorl othevlor othevlro othevrlo othevrol othoerlv
othoervl othoelrv othoelvr othoevlr othoevrl othorelv othorevl othorlev othorlve othorvle othorvel
otholrev otholrve otholerv otholevr otholver otholvre othovrle othovrel othovlre othovler othovelr
othoverl othleorv othleovr othlerov othlervo othlevro othlevor othloerv othloevr othlorev othlorve
othlovre othlover othlroev othlrove othlreov othlrevo othlrveo othlrvoe othlvore othlvoer othlvroe
othlvreo othlvero othlveor othveolr othveorl othvelor othvelro othverlo othverol othvoelr othvoerl
othvoler othvolre othvorle othvorel othvloer othvlore othvleor othvlero othvlreo othvlroe othvrole
othvroel othvrloe othvrleo othvrelo othvreol otorhelv otorhevl otorhlev otorhlve otorhvle otorhvel
otorehlv otorehvl otorelhv otorelvh otorevlh otorevhl otorlehv otorlevh otorlhev otorlhve otorlvhe
otorlveh otorvelh otorvehl otorvleh otorvlhe otorvhle otorvhel otohrelv otohrevl otohrlev otohrlve
otohrvle otohrvel otoherlv otohervl otohelrv otohelvr otohevlr otohevrl otohlerv otohlevr otohlrev
otohlrve otohlvre otohlver otohvelr otohverl otohvler otohvlre otohvrle otohvrel otoehrlv otoehrvl
otoehlrv otoehlvr otoehvlr otoehvrl otoerhlv otoerhvl otoerlhv otoerlvh otoervlh otoervhl otoelrhv
otoelrvh otoelhrv otoelhvr otoelvhr otoelvrh otoevrlh otoevrhl otoevlrh otoevlhr otoevhlr otoevhrl
otolherv otolhevr otolhrev otolhrve otolhvre otolhver otolehrv otolehvr otolerhv otolervh otolevrh
otolevhr otolrehv otolrevh otolrhev otolrhve otolrvhe otolrveh otolverh otolvehr otolvreh otolvrhe
otolvhre otolvher otovhelr otovherl otovhler otovhlre otovhrle otovhrel otovehlr otovehrl otovelhr
otovelrh otoverlh otoverhl otovlehr otovlerh otovlher otovlhre otovlrhe otovlreh otovrelh otovrehl
otovrleh otovrlhe otovrhle otovrhel otlrhoev otlrhove otlrheov otlrhevo otlrhveo otlrhvoe otlrohev
otlrohve otlroehv otlroevh otlroveh otlrovhe otlreohv otlreovh otlrehov otlrehvo otlrevho otlrevoh
otlrvoeh otlrvohe otlrveoh otlrveho otlrvheo otlrvhoe otlhroev otlhrove otlhreov otlhrevo otlhrveo
otlhrvoe otlhorev otlhorve otlhoerv otlhoevr otlhover otlhovre otlheorv otlheovr otlherov otlhervo
otlhevro otlhevor otlhvoer otlhvore otlhveor otlhvero otlhvreo otlhvroe otlohrev otlohrve otloherv
otlohevr otlohver otlohvre otlorhev otlorhve otlorehv otlorevh otlorveh otlorvhe otloerhv otloervh
otloehrv otloehvr otloevhr otloevrh otlovreh otlovrhe otloverh otlovehr otlovher otlovhre otlehorv
otlehovr otlehrov otlehrvo otlehvro otlehvor otleohrv otleohvr otleorhv otleorvh otleovrh otleovhr
otlerohv otlerovh otlerhov otlerhvo otlervho otlervoh otlevorh otlevohr otlevroh otlevrho otlevhro
otlevhor otlvhoer otlvhore otlvheor otlvhero otlvhreo otlvhroe otlvoher otlvohre otlvoehr otlvoerh
otlvoreh otlvorhe otlveohr otlveorh otlvehor otlvehro otlverho otlveroh otlvroeh otlvrohe otlvreoh
otlvreho otlvrheo otlvrhoe otvrhole otvrhoel otvrhloe otvrhleo otvrhelo otvrheol otvrohle otvrohel
otvrolhe otvroleh otvroelh otvroehl otvrlohe otvrloeh otvrlhoe otvrlheo otvrleho otvrleoh otvreolh
otvreohl otvreloh otvrelho otvrehlo otvrehol otvhrole otvhroel otvhrloe otvhrleo otvhrelo otvhreol
otvhorle otvhorel otvholre otvholer otvhoelr otvhoerl otvhlore otvhloer otvhlroe otvhlreo otvhlero
otvhleor otvheolr otvheorl otvhelor otvhelro otvherlo otvherol otvohrle otvohrel otvohlre otvohler
otvohelr otvoherl otvorhle otvorhel otvorlhe otvorleh otvorelh otvorehl otvolrhe otvolreh otvolhre
otvolher otvolehr otvolerh otvoerlh otvoerhl otvoelrh otvoelhr otvoehlr otvoehrl otvlhore otvlhoer
otvlhroe otvlhreo otvlhero otvlheor otvlohre otvloher otvlorhe otvloreh otvloerh otvloehr otvlrohe
otvlroeh otvlrhoe otvlrheo otvlreho otvlreoh otvleorh otvleohr otvleroh otvlerho otvlehro otvlehor
otveholr otvehorl otvehlor otvehlro otvehrlo otvehrol otveohlr otveohrl otveolhr otveolrh otveorlh
otveorhl otvelohr otvelorh otvelhor otvelhro otvelrho otvelroh otverolh otverohl otverloh otverlho
otverhlo otverhol

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us