easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

volplane

outslept

sutlership

incurability

parsings

gatorf

quasiparticle

runkles

debateful

comparandamque

demigod

aposthia

archontic

paralyzation

polygon

resinously

sidatisque

gorfton


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: outsideness
cipher variations:
pvutjefoftt qwvukfgpguu rxwvlghqhvv syxwmhiriww tzyxnijsjxx
uazyojktkyy vbazpklulzz wcbaqlmvmaa xdcbrmnwnbb yedcsnoxocc
zfedtopypdd agfeupqzqee bhgfvqrarff cihgwrsbsgg djihxstcthh
ekjiytuduii flkjzuvevjj gmlkavwfwkk hnmlbwxgxll ionmcxyhymm
jpondyziznn kqpoezajaoo lrqpfabkbpp msrqgbclcqq ntsrhcdmdrr

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: outsideness
Cipher: lfghrwvmvhh

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: outsideness
Cipher: ABBAB BAABB BAABA BAAAB ABAAA AAABB AABAA ABBAA AABAA BAAAB BAAAB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: outsideness
cipher variations:
pvutjefofttrjgdzknonddtxsnpqvovnnvlexfwdodxxxzqhvclolhhzncrlitotrrdpalrujojllfdmvharorvv
hryfxgzozffjfkpnmhohppltwzdspopzznhijtyxoxjjqwvukfgpguuskhealopoeeuytoqrwpwoowmfygxepeyy
yariwdmpmiiaodsmjupusseqbmsvkpkmmgenwibspswwiszgyhapaggkglqonipiqqmuxaetqpqaaoijkuzypykk
rxwvlghqhvvtlifbmpqpffvzuprsxqxppxngzhyfqfzzzbsjxenqnjjbpetnkvqvttfrcntwlqlnnhfoxjctqtxx
jtahzibqbhhlhmrpojqjrrnvybfurqrbbpjklvazqzllsyxwmhiriwwumjgcnqrqggwavqstyryqqyohaizgrgaa
actkyforokkcqfuolwrwuugsdouxmrmooigpykduruyykubiajcrciiminsqpkrkssowzcgvsrsccqklmwbaramm
tzyxnijsjxxvnkhdorsrhhxbwrtuzszrrzpibjahshbbbdulzgpsplldrgvpmxsxvvhtepvynsnppjhqzlevsvzz
lvcjbkdsdjjnjotrqlslttpxadhwtstddrlmnxcbsbnnuazyojktkyywoliepstsiiycxsuvatassaqjckbiticc
cevmahqtqmmeshwqnytywwiufqwzotoqqkiramfwtwaamwdkcletekkokpusrmtmuuqybeixutueesmnoydctcoo
vbazpklulzzxpmjfqtutjjzdytvwbubttbrkdlcjujdddfwnbirurnnftixrozuzxxjvgrxapuprrljsbngxuxbb
nxeldmfufllplqvtsnunvvrzcfjyvuvfftnopzedudppwcbaqlmvmaayqnkgruvukkaezuwxcvcuucslemdkvkee
egxocjsvsoogujyspavayykwhsybqvqssmktcohyvyccoyfmengvgmmqmrwutovowwsadgkzwvwgguopqafeveqq
xdcbrmnwnbbzrolhsvwvllbfavxydwdvvdtmfnelwlfffhypdktwtpphvkztqbwbzzlxitzcrwrttnludpizwzdd
pzgnfohwhnnrnsxvupwpxxtbehlaxwxhhvpqrbgfwfrryedcsnoxoccaspmitwxwmmcgbwyzexewweungofmxmgg
gizqeluxuqqiwlaurcxcaamyjuadsxsuuomveqjaxaeeqahogpixioosotywvqxqyyucfimbyxyiiwqrschgxgss
zfedtopypddbtqnjuxyxnndhcxzafyfxxfvohpgnynhhhjarfmvyvrrjxmbvsdydbbnzkvbetytvvpnwfrkbybff
rbiphqjyjpptpuzxwryrzzvdgjnczyzjjxrstdihyhttagfeupqzqeecurokvyzyooeidyabgzgyygwpiqhozoii
ikbsgnwzwsskyncwtezeccoalwcfuzuwwqoxgslczcggscjqirkzkqquqvayxszsaawehkodazakkystuejiziuu
bhgfvqrarffdvsplwzazppfjezbchahzzhxqjripapjjjlcthoxaxttlzodxufafddpbmxdgvavxxrpyhtmdadhh
tdkrjslalrrvrwbzytatbbxfilpebabllztuvfkjajvvcihgwrsbsggewtqmxabaqqgkfacdibiaaiyrksjqbqkk
kmduipybyuumapeyvgbgeeqcnyehwbwyysqziunebeiiuelsktmbmsswsxcazubuccygjmqfcbcmmauvwglkbkww
djihxstcthhfxurnybcbrrhlgbdejcjbbjzsltkrcrlllnevjqzczvvnbqfzwhchffrdozfixcxzztrajvofcfjj
vfmtluncnttxtydbavcvddzhknrgdcdnnbvwxhmlclxxekjiytuduiigyvsozcdcssimhcefkdkcckatmulsdsmm
mofwkradawwocrgaxidiggsepagjydyaausbkwpgdgkkwgnumvodouuyuzecbwdweeailoshedeoocwxyinmdmyy
flkjzuvevjjhzwtpadedttjnidfglelddlbunvmtetnnnpgxlsbebxxpdshbyjejhhtfqbhkzezbbvtclxqhehll
xhovnwpepvvzvafdcxexffbjmptifefppdxyzjonenzzgmlkavwfwkkiaxuqbefeuukojeghmfmeemcvownufuoo
oqhymtcfcyyqeticzkfkiiugrcilafaccwudmyrifimmyipwoxqfqwwawbgedyfyggcknqujgfgqqeyzakpofoaa
hnmlbwxgxlljbyvrcfgfvvlpkfhingnffndwpxovgvpppriznudgdzzrfujdalgljjvhsdjmbgbddxvenzsjgjnn
zjqxpyrgrxxbxchfezgzhhdlorvkhghrrfzablqpgpbbionmcxyhymmkczwsdghgwwmqlgijohoggoexqypwhwqq
qsjaoveheaasgvkebmhmkkwiteknchceeywfoatkhkooakryqzshsyycydigfahaiiempswlihissgabcmrqhqcc
jpondyziznnldaxtehihxxnrmhjkpiphhpfyrzqxixrrrtkbpwfifbbthwlfcninllxjuflodidffzxgpbulilpp
blszratitzzdzejhgbibjjfnqtxmjijtthbcdnsrirddkqpoezajaoomebyufijiyyosniklqjqiiqgzsaryjyss
sulcqxgjgccuixmgdojommykvgmpejeggayhqcvmjmqqcmtasbujuaaeafkihcjckkgoruynkjkuuicdeotsjsee
lrqpfabkbppnfczvgjkjzzptojlmrkrjjrhatbszkztttvmdryhkhddvjynhepkpnnzlwhnqfkfhhbzirdwnknrr
dnubtcvkvbbfbgljidkdllhpsvzolklvvjdefputktffmsrqgbclcqqogdawhklkaaqupkmnslskksibuctalauu
uwneszilieewkzoifqlqooamxiorglgiicajsexolosseovcudwlwccgchmkjelemmiqtwapmlmwwkefgqvulugg
ntsrhcdmdrrphebxilmlbbrvqlnotmtlltjcvdubmbvvvxoftajmjffxlapjgrmrppbnyjpshmhjjdbktfypmptt
fpwdvexmxddhdinlkfmfnnjruxbqnmnxxlfghrwvmvhhoutsidenessqifcyjmnmccswrmopunummukdwevcncww
wypgubknkggymbqkhsnsqqcozkqtinikkeclugzqnquugqxewfynyeeiejomlgngooksvycronoyymghisxwnwii

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: outsideness
Cipher: bhgfvqrarff

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: outsideness
Cipher: 4354443442415133513434

Extended Methods:
Method #1

Plaintext: outsideness
method variations:
tzyxoikskxxyedctopxpccdkihytucuhhipondyzhznn

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
o u t s i d e n e s s 
4 5 4 3 4 4 5 3 5 3 3 
3 4 4 4 2 1 1 3 1 4 4 
They are then read out in rows:
4543445353334442113144
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: outsideness
Cipher: yotppntiact

Read more ...
Method #3

Plaintext: outsideness
method variations:
xtotrvlxlot totrvlxlotx otrvlxlotxt
trvlxlotxto rvlxlotxtot vlxlotxtotr
lxlotxtotrv xlotxtotrvl lotxtotrvlx
otxtotrvlxl txtotrvlxlo

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: outsideness

first 5040 cipher variations(39615626 total)
outsideness outsideness outsidenses outsidensse outsidensse outsidenses outsideenss outsideenss outsideesns outsideessn
outsideessn outsideesns outsidesens outsidesesn outsidesnes outsidesnse outsidessne outsidessen outsidesesn outsidesens
outsidessen outsidessne outsidesnse outsidesnes outsidneess outsidneess outsidneses outsidnesse outsidnesse outsidneses
outsidneess outsidneess outsidneses outsidnesse outsidnesse outsidneses outsidnsees outsidnsese outsidnsees outsidnsese
outsidnssee outsidnssee outsidnsese outsidnsees outsidnssee outsidnssee outsidnsese outsidnsees outsideness outsideness
outsidenses outsidensse outsidensse outsidenses outsideenss outsideenss outsideesns outsideessn outsideessn outsideesns
outsidesens outsidesesn outsidesnes outsidesnse outsidessne outsidessen outsidesesn outsidesens outsidessen outsidessne
outsidesnse outsidesnes outsidsnees outsidsnese outsidsnees outsidsnese outsidsnsee outsidsnsee outsidsenes outsidsense
outsidseens outsidseesn outsidsesen outsidsesne outsidseens outsidseesn outsidsenes outsidsense outsidsesne outsidsesen
outsidsseen outsidssene outsidsseen outsidssene outsidssnee outsidssnee outsidsnese outsidsnees outsidsnsee outsidsnsee
outsidsnese outsidsnees outsidsense outsidsenes outsidsesne outsidsesen outsidseesn outsidseens outsidssene outsidsseen
outsidssnee outsidssnee outsidssene outsidsseen outsidseesn outsidseens outsidsesen outsidsesne outsidsense outsidsenes
outsiedness outsiedness outsiednses outsiednsse outsiednsse outsiednses outsiedenss outsiedenss outsiedesns outsiedessn
outsiedessn outsiedesns outsiedsens outsiedsesn outsiedsnes outsiedsnse outsiedssne outsiedssen outsiedsesn outsiedsens
outsiedssen outsiedssne outsiedsnse outsiedsnes outsiendess outsiendess outsiendses outsiendsse outsiendsse outsiendses
outsienedss outsienedss outsienesds outsienessd outsienessd outsienesds outsienseds outsiensesd outsiensdes outsiensdse
outsienssde outsienssed outsiensesd outsienseds outsienssed outsienssde outsiensdse outsiensdes outsieendss outsieendss
outsieensds outsieenssd outsieenssd outsieensds outsieednss outsieednss outsieedsns outsieedssn outsieedssn outsieedsns
outsieesdns outsieesdsn outsieesnds outsieesnsd outsieessnd outsieessdn outsieesdsn outsieesdns outsieessdn outsieessnd
outsieesnsd outsieesnds outsiesneds outsiesnesd outsiesndes outsiesndse outsiesnsde outsiesnsed outsiesends outsiesensd
outsiesedns outsiesedsn outsiesesdn outsiesesnd outsiesdens outsiesdesn outsiesdnes outsiesdnse outsiesdsne outsiesdsen
outsiessedn outsiessend outsiessden outsiessdne outsiessnde outsiessned outsiesnesd outsiesneds outsiesnsed outsiesnsde
outsiesndse outsiesndes outsiesensd outsiesends outsiesesnd outsiesesdn outsiesedsn outsiesedns outsiessend outsiessedn
outsiessned outsiessnde outsiessdne outsiessden outsiesdesn outsiesdens outsiesdsen outsiesdsne outsiesdnse outsiesdnes
outsinedess outsinedess outsinedses outsinedsse outsinedsse outsinedses outsineedss outsineedss outsineesds outsineessd
outsineessd outsineesds outsineseds outsinesesd outsinesdes outsinesdse outsinessde outsinessed outsinesesd outsineseds
outsinessed outsinessde outsinesdse outsinesdes outsindeess outsindeess outsindeses outsindesse outsindesse outsindeses
outsindeess outsindeess outsindeses outsindesse outsindesse outsindeses outsindsees outsindsese outsindsees outsindsese
outsindssee outsindssee outsindsese outsindsees outsindssee outsindssee outsindsese outsindsees outsinedess outsinedess
outsinedses outsinedsse outsinedsse outsinedses outsineedss outsineedss outsineesds outsineessd outsineessd outsineesds
outsineseds outsinesesd outsinesdes outsinesdse outsinessde outsinessed outsinesesd outsineseds outsinessed outsinessde
outsinesdse outsinesdes outsinsdees outsinsdese outsinsdees outsinsdese outsinsdsee outsinsdsee outsinsedes outsinsedse
outsinseeds outsinseesd outsinsesed outsinsesde outsinseeds outsinseesd outsinsedes outsinsedse outsinsesde outsinsesed
outsinsseed outsinssede outsinsseed outsinssede outsinssdee outsinssdee outsinsdese outsinsdees outsinsdsee outsinsdsee
outsinsdese outsinsdees outsinsedse outsinsedes outsinsesde outsinsesed outsinseesd outsinseeds outsinssede outsinsseed
outsinssdee outsinssdee outsinssede outsinsseed outsinseesd outsinseeds outsinsesed outsinsesde outsinsedse outsinsedes
outsieendss outsieendss outsieensds outsieenssd outsieenssd outsieensds outsieednss outsieednss outsieedsns outsieedssn
outsieedssn outsieedsns outsieesdns outsieesdsn outsieesnds outsieesnsd outsieessnd outsieessdn outsieesdsn outsieesdns
outsieessdn outsieessnd outsieesnsd outsieesnds outsienedss outsienedss outsienesds outsienessd outsienessd outsienesds
outsiendess outsiendess outsiendses outsiendsse outsiendsse outsiendses outsiensdes outsiensdse outsienseds outsiensesd
outsienssed outsienssde outsiensdse outsiensdes outsienssde outsienssed outsiensesd outsienseds outsiedness outsiedness
outsiednses outsiednsse outsiednsse outsiednses outsiedenss outsiedenss outsiedesns outsiedessn outsiedessn outsiedesns
outsiedsens outsiedsesn outsiedsnes outsiedsnse outsiedssne outsiedssen outsiedsesn outsiedsens outsiedssen outsiedssne
outsiedsnse outsiedsnes outsiesndes outsiesndse outsiesneds outsiesnesd outsiesnsed outsiesnsde outsiesdnes outsiesdnse
outsiesdens outsiesdesn outsiesdsen outsiesdsne outsiesedns outsiesedsn outsiesends outsiesensd outsiesesnd outsiesesdn
outsiessden outsiessdne outsiessedn outsiessend outsiessned outsiessnde outsiesndse outsiesndes outsiesnsde outsiesnsed
outsiesnesd outsiesneds outsiesdnse outsiesdnes outsiesdsne outsiesdsen outsiesdesn outsiesdens outsiessdne outsiessden
outsiessnde outsiessned outsiessend outsiessedn outsiesedsn outsiesedns outsiesesdn outsiesesnd outsiesensd outsiesends
outsiseneds outsisenesd outsisendes outsisendse outsisensde outsisensed outsiseends outsiseensd outsiseedns outsiseedsn
outsiseesdn outsiseesnd outsisedens outsisedesn outsisednes outsisednse outsisedsne outsisedsen outsisesedn outsisesend
outsisesden outsisesdne outsisesnde outsisesned outsisneeds outsisneesd outsisnedes outsisnedse outsisnesde outsisnesed
outsisneeds outsisneesd outsisnedes outsisnedse outsisnesde outsisnesed outsisndees outsisndese outsisndees outsisndese
outsisndsee outsisndsee outsisnsede outsisnseed outsisnsdee outsisnsdee outsisnsede outsisnseed outsiseneds outsisenesd
outsisendes outsisendse outsisensde outsisensed outsiseends outsiseensd outsiseedns outsiseedsn outsiseesdn outsiseesnd
outsisedens outsisedesn outsisednes outsisednse outsisedsne outsisedsen outsisesedn outsisesend outsisesden outsisesdne
outsisesnde outsisesned outsisdnees outsisdnese outsisdnees outsisdnese outsisdnsee outsisdnsee outsisdenes outsisdense
outsisdeens outsisdeesn outsisdesen outsisdesne outsisdeens outsisdeesn outsisdenes outsisdense outsisdesne outsisdesen
outsisdseen outsisdsene outsisdseen outsisdsene outsisdsnee outsisdsnee outsissnede outsissneed outsissndee outsissndee
outsissnede outsissneed outsissende outsissened outsissedne outsisseden outsisseedn outsisseend outsissdene outsissdeen
outsissdnee outsissdnee outsissdene outsissdeen outsisseedn outsisseend outsisseden outsissedne outsissende outsissened
outsisenesd outsiseneds outsisensed outsisensde outsisendse outsisendes outsiseensd outsiseends outsiseesnd outsiseesdn
outsiseedsn outsiseedns outsisesend outsisesedn outsisesned outsisesnde outsisesdne outsisesden outsisedesn outsisedens
outsisedsen outsisedsne outsisednse outsisednes outsisneesd outsisneeds outsisnesed outsisnesde outsisnedse outsisnedes
outsisneesd outsisneeds outsisnesed outsisnesde outsisnedse outsisnedes outsisnseed outsisnsede outsisnseed outsisnsede
outsisnsdee outsisnsdee outsisndese outsisndees outsisndsee outsisndsee outsisndese outsisndees outsisenesd outsiseneds
outsisensed outsisensde outsisendse outsisendes outsiseensd outsiseends outsiseesnd outsiseesdn outsiseedsn outsiseedns
outsisesend outsisesedn outsisesned outsisesnde outsisesdne outsisesden outsisedesn outsisedens outsisedsen outsisedsne
outsisednse outsisednes outsissneed outsissnede outsissneed outsissnede outsissndee outsissndee outsissened outsissende
outsisseend outsisseedn outsisseden outsissedne outsisseend outsisseedn outsissened outsissende outsissedne outsisseden
outsissdeen outsissdene outsissdeen outsissdene outsissdnee outsissdnee outsisdnese outsisdnees outsisdnsee outsisdnsee
outsisdnese outsisdnees outsisdense outsisdenes outsisdesne outsisdesen outsisdeesn outsisdeens outsisdsene outsisdseen
outsisdsnee outsisdsnee outsisdsene outsisdseen outsisdeesn outsisdeens outsisdesen outsisdesne outsisdense outsisdenes
outsdieness outsdieness outsdienses outsdiensse outsdiensse outsdienses outsdieenss outsdieenss outsdieesns outsdieessn
outsdieessn outsdieesns outsdiesens outsdiesesn outsdiesnes outsdiesnse outsdiessne outsdiessen outsdiesesn outsdiesens
outsdiessen outsdiessne outsdiesnse outsdiesnes outsdineess outsdineess outsdineses outsdinesse outsdinesse outsdineses
outsdineess outsdineess outsdineses outsdinesse outsdinesse outsdineses outsdinsees outsdinsese outsdinsees outsdinsese
outsdinssee outsdinssee outsdinsese outsdinsees outsdinssee outsdinssee outsdinsese outsdinsees outsdieness outsdieness
outsdienses outsdiensse outsdiensse outsdienses outsdieenss outsdieenss outsdieesns outsdieessn outsdieessn outsdieesns
outsdiesens outsdiesesn outsdiesnes outsdiesnse outsdiessne outsdiessen outsdiesesn outsdiesens outsdiessen outsdiessne
outsdiesnse outsdiesnes outsdisnees outsdisnese outsdisnees outsdisnese outsdisnsee outsdisnsee outsdisenes outsdisense
outsdiseens outsdiseesn outsdisesen outsdisesne outsdiseens outsdiseesn outsdisenes outsdisense outsdisesne outsdisesen
outsdisseen outsdissene outsdisseen outsdissene outsdissnee outsdissnee outsdisnese outsdisnees outsdisnsee outsdisnsee
outsdisnese outsdisnees outsdisense outsdisenes outsdisesne outsdisesen outsdiseesn outsdiseens outsdissene outsdisseen
outsdissnee outsdissnee outsdissene outsdisseen outsdiseesn outsdiseens outsdisesen outsdisesne outsdisense outsdisenes
outsdeiness outsdeiness outsdeinses outsdeinsse outsdeinsse outsdeinses outsdeienss outsdeienss outsdeiesns outsdeiessn
outsdeiessn outsdeiesns outsdeisens outsdeisesn outsdeisnes outsdeisnse outsdeissne outsdeissen outsdeisesn outsdeisens
outsdeissen outsdeissne outsdeisnse outsdeisnes outsdeniess outsdeniess outsdenises outsdenisse outsdenisse outsdenises
outsdeneiss outsdeneiss outsdenesis outsdenessi outsdenessi outsdenesis outsdenseis outsdensesi outsdensies outsdensise
outsdenssie outsdenssei outsdensesi outsdenseis outsdenssei outsdenssie outsdensise outsdensies outsdeeniss outsdeeniss
outsdeensis outsdeenssi outsdeenssi outsdeensis outsdeeinss outsdeeinss outsdeeisns outsdeeissn outsdeeissn outsdeeisns
outsdeesins outsdeesisn outsdeesnis outsdeesnsi outsdeessni outsdeessin outsdeesisn outsdeesins outsdeessin outsdeessni
outsdeesnsi outsdeesnis outsdesneis outsdesnesi outsdesnies outsdesnise outsdesnsie outsdesnsei outsdesenis outsdesensi
outsdeseins outsdeseisn outsdesesin outsdesesni outsdesiens outsdesiesn outsdesines outsdesinse outsdesisne outsdesisen
outsdessein outsdesseni outsdessien outsdessine outsdessnie outsdessnei outsdesnesi outsdesneis outsdesnsei outsdesnsie
outsdesnise outsdesnies outsdesensi outsdesenis outsdesesni outsdesesin outsdeseisn outsdeseins outsdesseni outsdessein
outsdessnei outsdessnie outsdessine outsdessien outsdesiesn outsdesiens outsdesisen outsdesisne outsdesinse outsdesines
outsdneiess outsdneiess outsdneises outsdneisse outsdneisse outsdneises outsdneeiss outsdneeiss outsdneesis outsdneessi
outsdneessi outsdneesis outsdneseis outsdnesesi outsdnesies outsdnesise outsdnessie outsdnessei outsdnesesi outsdneseis
outsdnessei outsdnessie outsdnesise outsdnesies outsdnieess outsdnieess outsdnieses outsdniesse outsdniesse outsdnieses
outsdnieess outsdnieess outsdnieses outsdniesse outsdniesse outsdnieses outsdnisees outsdnisese outsdnisees outsdnisese
outsdnissee outsdnissee outsdnisese outsdnisees outsdnissee outsdnissee outsdnisese outsdnisees outsdneiess outsdneiess
outsdneises outsdneisse outsdneisse outsdneises outsdneeiss outsdneeiss outsdneesis outsdneessi outsdneessi outsdneesis
outsdneseis outsdnesesi outsdnesies outsdnesise outsdnessie outsdnessei outsdnesesi outsdneseis outsdnessei outsdnessie
outsdnesise outsdnesies outsdnsiees outsdnsiese outsdnsiees outsdnsiese outsdnsisee outsdnsisee outsdnseies outsdnseise
outsdnseeis outsdnseesi outsdnsesei outsdnsesie outsdnseeis outsdnseesi outsdnseies outsdnseise outsdnsesie outsdnsesei
outsdnsseei outsdnsseie outsdnsseei outsdnsseie outsdnssiee outsdnssiee outsdnsiese outsdnsiees outsdnsisee outsdnsisee
outsdnsiese outsdnsiees outsdnseise outsdnseies outsdnsesie outsdnsesei outsdnseesi outsdnseeis outsdnsseie outsdnsseei
outsdnssiee outsdnssiee outsdnsseie outsdnsseei outsdnseesi outsdnseeis outsdnsesei outsdnsesie outsdnseise outsdnseies
outsdeeniss outsdeeniss outsdeensis outsdeenssi outsdeenssi outsdeensis outsdeeinss outsdeeinss outsdeeisns outsdeeissn
outsdeeissn outsdeeisns outsdeesins outsdeesisn outsdeesnis outsdeesnsi outsdeessni outsdeessin outsdeesisn outsdeesins
outsdeessin outsdeessni outsdeesnsi outsdeesnis outsdeneiss outsdeneiss outsdenesis outsdenessi outsdenessi outsdenesis
outsdeniess outsdeniess outsdenises outsdenisse outsdenisse outsdenises outsdensies outsdensise outsdenseis outsdensesi
outsdenssei outsdenssie outsdensise outsdensies outsdenssie outsdenssei outsdensesi outsdenseis outsdeiness outsdeiness
outsdeinses outsdeinsse outsdeinsse outsdeinses outsdeienss outsdeienss outsdeiesns outsdeiessn outsdeiessn outsdeiesns
outsdeisens outsdeisesn outsdeisnes outsdeisnse outsdeissne outsdeissen outsdeisesn outsdeisens outsdeissen outsdeissne
outsdeisnse outsdeisnes outsdesnies outsdesnise outsdesneis outsdesnesi outsdesnsei outsdesnsie outsdesines outsdesinse
outsdesiens outsdesiesn outsdesisen outsdesisne outsdeseins outsdeseisn outsdesenis outsdesensi outsdesesni outsdesesin
outsdessien outsdessine outsdessein outsdesseni outsdessnei outsdessnie outsdesnise outsdesnies outsdesnsie outsdesnsei
outsdesnesi outsdesneis outsdesinse outsdesines outsdesisne outsdesisen outsdesiesn outsdesiens outsdessine outsdessien
outsdessnie outsdessnei outsdesseni outsdessein outsdeseisn outsdeseins outsdesesin outsdesesni outsdesensi outsdesenis
outsdseneis outsdsenesi outsdsenies outsdsenise outsdsensie outsdsensei outsdseenis outsdseensi outsdseeins outsdseeisn
outsdseesin outsdseesni outsdseiens outsdseiesn outsdseines outsdseinse outsdseisne outsdseisen outsdsesein outsdseseni
outsdsesien outsdsesine outsdsesnie outsdsesnei outsdsneeis outsdsneesi outsdsneies outsdsneise outsdsnesie outsdsnesei
outsdsneeis outsdsneesi outsdsneies outsdsneise outsdsnesie outsdsnesei outsdsniees outsdsniese outsdsniees outsdsniese
outsdsnisee outsdsnisee outsdsnseie outsdsnseei outsdsnsiee outsdsnsiee outsdsnseie outsdsnseei outsdseneis outsdsenesi
outsdsenies outsdsenise outsdsensie outsdsensei outsdseenis outsdseensi outsdseeins outsdseeisn outsdseesin outsdseesni
outsdseiens outsdseiesn outsdseines outsdseinse outsdseisne outsdseisen outsdsesein outsdseseni outsdsesien outsdsesine
outsdsesnie outsdsesnei outsdsinees outsdsinese outsdsinees outsdsinese outsdsinsee outsdsinsee outsdsienes outsdsiense
outsdsieens outsdsieesn outsdsiesen outsdsiesne outsdsieens outsdsieesn outsdsienes outsdsiense outsdsiesne outsdsiesen
outsdsiseen outsdsisene outsdsiseen outsdsisene outsdsisnee outsdsisnee outsdssneie outsdssneei outsdssniee outsdssniee
outsdssneie outsdssneei outsdssenie outsdssenei outsdsseine outsdsseien outsdsseein outsdsseeni outsdssiene outsdssieen
outsdssinee outsdssinee outsdssiene outsdssieen outsdsseein outsdsseeni outsdsseien outsdsseine outsdssenie outsdssenei
outsdsenesi outsdseneis outsdsensei outsdsensie outsdsenise outsdsenies outsdseensi outsdseenis outsdseesni outsdseesin
outsdseeisn outsdseeins outsdseseni outsdsesein outsdsesnei outsdsesnie outsdsesine outsdsesien outsdseiesn outsdseiens
outsdseisen outsdseisne outsdseinse outsdseines outsdsneesi outsdsneeis outsdsnesei outsdsnesie outsdsneise outsdsneies
outsdsneesi outsdsneeis outsdsnesei outsdsnesie outsdsneise outsdsneies outsdsnseei outsdsnseie outsdsnseei outsdsnseie
outsdsnsiee outsdsnsiee outsdsniese outsdsniees outsdsnisee outsdsnisee outsdsniese outsdsniees outsdsenesi outsdseneis
outsdsensei outsdsensie outsdsenise outsdsenies outsdseensi outsdseenis outsdseesni outsdseesin outsdseeisn outsdseeins
outsdseseni outsdsesein outsdsesnei outsdsesnie outsdsesine outsdsesien outsdseiesn outsdseiens outsdseisen outsdseisne
outsdseinse outsdseines outsdssneei outsdssneie outsdssneei outsdssneie outsdssniee outsdssniee outsdssenei outsdssenie
outsdsseeni outsdsseein outsdsseien outsdsseine outsdsseeni outsdsseein outsdssenei outsdssenie outsdsseine outsdsseien
outsdssieen outsdssiene outsdssieen outsdssiene outsdssinee outsdssinee outsdsinese outsdsinees outsdsinsee outsdsinsee
outsdsinese outsdsinees outsdsiense outsdsienes outsdsiesne outsdsiesen outsdsieesn outsdsieens outsdsisene outsdsiseen
outsdsisnee outsdsisnee outsdsisene outsdsiseen outsdsieesn outsdsieens outsdsiesen outsdsiesne outsdsiense outsdsienes
outsediness outsediness outsedinses outsedinsse outsedinsse outsedinses outsedienss outsedienss outsediesns outsediessn
outsediessn outsediesns outsedisens outsedisesn outsedisnes outsedisnse outsedissne outsedissen outsedisesn outsedisens
outsedissen outsedissne outsedisnse outsedisnes outsedniess outsedniess outsednises outsednisse outsednisse outsednises
outsedneiss outsedneiss outsednesis outsednessi outsednessi outsednesis outsednseis outsednsesi outsednsies outsednsise
outsednssie outsednssei outsednsesi outsednseis outsednssei outsednssie outsednsise outsednsies outsedeniss outsedeniss
outsedensis outsedenssi outsedenssi outsedensis outsedeinss outsedeinss outsedeisns outsedeissn outsedeissn outsedeisns
outsedesins outsedesisn outsedesnis outsedesnsi outsedessni outsedessin outsedesisn outsedesins outsedessin outsedessni
outsedesnsi outsedesnis outsedsneis outsedsnesi outsedsnies outsedsnise outsedsnsie outsedsnsei outsedsenis outsedsensi
outsedseins outsedseisn outsedsesin outsedsesni outsedsiens outsedsiesn outsedsines outsedsinse outsedsisne outsedsisen
outsedssein outsedsseni outsedssien outsedssine outsedssnie outsedssnei outsedsnesi outsedsneis outsedsnsei outsedsnsie
outsedsnise outsedsnies outsedsensi outsedsenis outsedsesni outsedsesin outsedseisn outsedseins outsedsseni outsedssein
outsedssnei outsedssnie outsedssine outsedssien outsedsiesn outsedsiens outsedsisen outsedsisne outsedsinse outsedsines
outseidness outseidness outseidnses outseidnsse outseidnsse outseidnses outseidenss outseidenss outseidesns outseidessn
outseidessn outseidesns outseidsens outseidsesn outseidsnes outseidsnse outseidssne outseidssen outseidsesn outseidsens
outseidssen outseidssne outseidsnse outseidsnes outseindess outseindess outseindses outseindsse outseindsse outseindses
outseinedss outseinedss outseinesds outseinessd outseinessd outseinesds outseinseds outseinsesd outseinsdes outseinsdse
outseinssde outseinssed outseinsesd outseinseds outseinssed outseinssde outseinsdse outseinsdes outseiendss outseiendss
outseiensds outseienssd outseienssd outseiensds outseiednss outseiednss outseiedsns outseiedssn outseiedssn outseiedsns
outseiesdns outseiesdsn outseiesnds outseiesnsd outseiessnd outseiessdn outseiesdsn outseiesdns outseiessdn outseiessnd
outseiesnsd outseiesnds outseisneds outseisnesd outseisndes outseisndse outseisnsde outseisnsed outseisends outseisensd
outseisedns outseisedsn outseisesdn outseisesnd outseisdens outseisdesn outseisdnes outseisdnse outseisdsne outseisdsen
outseissedn outseissend outseissden outseissdne outseissnde outseissned outseisnesd outseisneds outseisnsed outseisnsde
outseisndse outseisndes outseisensd outseisends outseisesnd outseisesdn outseisedsn outseisedns outseissend outseissedn
outseissned outseissnde outseissdne outseissden outseisdesn outseisdens outseisdsen outseisdsne outseisdnse outseisdnes
outsenidess outsenidess outsenidses outsenidsse outsenidsse outsenidses outseniedss outseniedss outseniesds outseniessd
outseniessd outseniesds outseniseds outsenisesd outsenisdes outsenisdse outsenissde outsenissed outsenisesd outseniseds
outsenissed outsenissde outsenisdse outsenisdes outsendiess outsendiess outsendises outsendisse outsendisse outsendises
outsendeiss outsendeiss outsendesis outsendessi outsendessi outsendesis outsendseis outsendsesi outsendsies outsendsise
outsendssie outsendssei outsendsesi outsendseis outsendssei outsendssie outsendsise outsendsies outsenediss outsenediss
outsenedsis outsenedssi outsenedssi outsenedsis outseneidss outseneidss outseneisds outseneissd outseneissd outseneisds
outsenesids outsenesisd outsenesdis outsenesdsi outsenessdi outsenessid outsenesisd outsenesids outsenessid outsenessdi
outsenesdsi outsenesdis outsensdeis outsensdesi outsensdies outsensdise outsensdsie outsensdsei outsensedis outsensedsi
outsenseids outsenseisd outsensesid outsensesdi outsensieds outsensiesd outsensides outsensidse outsensisde outsensised
outsensseid outsenssedi outsenssied outsensside outsenssdie outsenssdei outsensdesi outsensdeis outsensdsei outsensdsie
outsensdise outsensdies outsensedsi outsensedis outsensesdi outsensesid outsenseisd outsenseids outsenssedi outsensseid
outsenssdei outsenssdie outsensside outsenssied outsensiesd outsensieds outsensised outsensisde outsensidse outsensides
outseeindss outseeindss outseeinsds outseeinssd outseeinssd outseeinsds outseeidnss outseeidnss outseeidsns outseeidssn
outseeidssn outseeidsns outseeisdns outseeisdsn outseeisnds outseeisnsd outseeissnd outseeissdn outseeisdsn outseeisdns
outseeissdn outseeissnd outseeisnsd outseeisnds outseenidss outseenidss outseenisds outseenissd outseenissd outseenisds
outseendiss outseendiss outseendsis outseendssi outseendssi outseendsis outseensdis outseensdsi outseensids outseensisd
outseenssid outseenssdi outseensdsi outseensdis outseenssdi outseenssid outseensisd outseensids outseedniss outseedniss
outseednsis outseednssi outseednssi outseednsis outseedinss outseedinss outseedisns outseedissn outseedissn outseedisns
outseedsins outseedsisn outseedsnis outseedsnsi outseedssni outseedssin outseedsisn outseedsins outseedssin outseedssni
outseedsnsi outseedsnis outseesndis outseesndsi outseesnids outseesnisd outseesnsid outseesnsdi outseesdnis outseesdnsi
outseesdins outseesdisn outseesdsin outseesdsni outseesidns outseesidsn outseesinds outseesinsd outseesisnd outseesisdn
outseessdin outseessdni outseessidn outseessind outseessnid outseessndi outseesndsi outseesndis outseesnsdi outseesnsid
outseesnisd outseesnids outseesdnsi outseesdnis outseesdsni outseesdsin outseesdisn outseesdins outseessdni outseessdin
outseessndi outseessnid outseessind outseessidn outseesidsn outseesidns outseesisdn outseesisnd outseesinsd outseesinds
outsesineds outsesinesd outsesindes outsesindse outsesinsde outsesinsed outsesiends outsesiensd outsesiedns outsesiedsn
outsesiesdn outsesiesnd outsesidens outsesidesn outsesidnes outsesidnse outsesidsne outsesidsen outsesisedn outsesisend
outsesisden outsesisdne outsesisnde outsesisned outsesnieds outsesniesd outsesnides outsesnidse outsesnisde outsesnised
outsesneids outsesneisd outsesnedis outsesnedsi outsesnesdi outsesnesid outsesndeis outsesndesi outsesndies outsesndise
outsesndsie outsesndsei outsesnsedi outsesnseid outsesnsdei outsesnsdie outsesnside outsesnsied outsesenids outsesenisd
outsesendis outsesendsi outsesensdi outsesensid outseseinds outseseinsd outseseidns outseseidsn outseseisdn outseseisnd
outsesedins outsesedisn outsesednis outsesednsi outsesedsni outsesedsin outsesesidn outsesesind outsesesdin outsesesdni
outsesesndi outsesesnid outsesdneis outsesdnesi outsesdnies outsesdnise outsesdnsie outsesdnsei outsesdenis outsesdensi
outsesdeins outsesdeisn outsesdesin outsesdesni outsesdiens outsesdiesn outsesdines outsesdinse outsesdisne outsesdisen
outsesdsein outsesdseni outsesdsien outsesdsine outsesdsnie outsesdsnei outsessnedi outsessneid outsessndei outsessndie
outsessnide outsessnied outsessendi outsessenid outsessedni outsessedin outsesseidn outsesseind outsessdeni outsessdein
outsessdnei outsessdnie outsessdine outsessdien outsessiedn outsessiend outsessiden outsessidne outsessinde outsessined
outsesinesd outsesineds outsesinsed outsesinsde outsesindse outsesindes outsesiensd outsesiends outsesiesnd outsesiesdn
outsesiedsn outsesiedns outsesisend outsesisedn outsesisned outsesisnde outsesisdne outsesisden outsesidesn outsesidens
outsesidsen outsesidsne outsesidnse outsesidnes outsesniesd outsesnieds outsesnised outsesnisde outsesnidse outsesnides
outsesneisd outsesneids outsesnesid outsesnesdi outsesnedsi outsesnedis outsesnseid outsesnsedi outsesnsied outsesnside
outsesnsdie outsesnsdei outsesndesi outsesndeis outsesndsei outsesndsie outsesndise outsesndies outsesenisd outsesenids
outsesensid outsesensdi outsesendsi outsesendis outseseinsd outseseinds outseseisnd outseseisdn outseseidsn outseseidns
outsesesind outsesesidn outsesesnid outsesesndi outsesesdni outsesesdin outsesedisn outsesedins outsesedsin outsesedsni
outsesednsi outsesednis outsessneid outsessnedi outsessnied outsessnide outsessndie outsessndei outsessenid outsessendi
outsesseind outsesseidn outsessedin outsessedni outsessiend outsessiedn outsessined outsessinde outsessidne outsessiden
outsessdein outsessdeni outsessdien outsessdine outsessdnie outsessdnei outsesdnesi outsesdneis outsesdnsei outsesdnsie
outsesdnise outsesdnies outsesdensi outsesdenis outsesdesni outsesdesin outsesdeisn outsesdeins outsesdseni outsesdsein
outsesdsnei outsesdsnie outsesdsine outsesdsien outsesdiesn outsesdiens outsesdisen outsesdisne outsesdinse outsesdines
outsndeiess outsndeiess outsndeises outsndeisse outsndeisse outsndeises outsndeeiss outsndeeiss outsndeesis outsndeessi
outsndeessi outsndeesis outsndeseis outsndesesi outsndesies outsndesise outsndessie outsndessei outsndesesi outsndeseis
outsndessei outsndessie outsndesise outsndesies outsndieess outsndieess outsndieses outsndiesse outsndiesse outsndieses
outsndieess outsndieess outsndieses outsndiesse outsndiesse outsndieses outsndisees outsndisese outsndisees outsndisese
outsndissee outsndissee outsndisese outsndisees outsndissee outsndissee outsndisese outsndisees outsndeiess outsndeiess
outsndeises outsndeisse outsndeisse outsndeises outsndeeiss outsndeeiss outsndeesis outsndeessi outsndeessi outsndeesis
outsndeseis outsndesesi outsndesies outsndesise outsndessie outsndessei outsndesesi outsndeseis outsndessei outsndessie
outsndesise outsndesies outsndsiees outsndsiese outsndsiees outsndsiese outsndsisee outsndsisee outsndseies outsndseise
outsndseeis outsndseesi outsndsesei outsndsesie outsndseeis outsndseesi outsndseies outsndseise outsndsesie outsndsesei
outsndsseei outsndsseie outsndsseei outsndsseie outsndssiee outsndssiee outsndsiese outsndsiees outsndsisee outsndsisee
outsndsiese outsndsiees outsndseise outsndseies outsndsesie outsndsesei outsndseesi outsndseeis outsndsseie outsndsseei
outsndssiee outsndssiee outsndsseie outsndsseei outsndseesi outsndseeis outsndsesei outsndsesie outsndseise outsndseies
outsnediess outsnediess outsnedises outsnedisse outsnedisse outsnedises outsnedeiss outsnedeiss outsnedesis outsnedessi
outsnedessi outsnedesis outsnedseis outsnedsesi outsnedsies outsnedsise outsnedssie outsnedssei outsnedsesi outsnedseis
outsnedssei outsnedssie outsnedsise outsnedsies outsneidess outsneidess outsneidses outsneidsse outsneidsse outsneidses
outsneiedss outsneiedss outsneiesds outsneiessd outsneiessd outsneiesds outsneiseds outsneisesd outsneisdes outsneisdse
outsneissde outsneissed outsneisesd outsneiseds outsneissed outsneissde outsneisdse outsneisdes outsneeidss outsneeidss
outsneeisds outsneeissd outsneeissd outsneeisds outsneediss outsneediss outsneedsis outsneedssi outsneedssi outsneedsis
outsneesdis outsneesdsi outsneesids outsneesisd outsneessid outsneessdi outsneesdsi outsneesdis outsneessdi outsneessid
outsneesisd outsneesids outsnesieds outsnesiesd outsnesides outsnesidse outsnesisde outsnesised outsneseids outsneseisd
outsnesedis outsnesedsi outsnesesdi outsnesesid outsnesdeis outsnesdesi outsnesdies outsnesdise outsnesdsie outsnesdsei
outsnessedi outsnesseid outsnessdei outsnessdie outsnesside outsnessied outsnesiesd outsnesieds outsnesised outsnesisde
outsnesidse outsnesides outsneseisd outsneseids outsnesesid outsnesesdi outsnesedsi outsnesedis outsnesseid outsnessedi
outsnessied outsnesside outsnessdie outsnessdei outsnesdesi outsnesdeis outsnesdsei outsnesdsie outsnesdise outsnesdies
outsniedess outsniedess outsniedses outsniedsse outsniedsse outsniedses outsnieedss outsnieedss outsnieesds outsnieessd
outsnieessd outsnieesds outsnieseds outsniesesd outsniesdes outsniesdse outsniessde outsniessed outsniesesd outsnieseds
outsniessed outsniessde outsniesdse outsniesdes outsnideess outsnideess outsnideses outsnidesse outsnidesse outsnideses
outsnideess outsnideess outsnideses outsnidesse outsnidesse outsnideses outsnidsees outsnidsese outsnidsees outsnidsese
outsnidssee outsnidssee outsnidsese outsnidsees outsnidssee outsnidssee outsnidsese outsnidsees outsniedess outsniedess
outsniedses outsniedsse outsniedsse outsniedses outsnieedss outsnieedss outsnieesds outsnieessd outsnieessd outsnieesds
outsnieseds outsniesesd outsniesdes outsniesdse outsniessde outsniessed outsniesesd outsnieseds outsniessed outsniessde
outsniesdse outsniesdes outsnisdees outsnisdese outsnisdees outsnisdese outsnisdsee outsnisdsee outsnisedes outsnisedse
outsniseeds outsniseesd outsnisesed outsnisesde outsniseeds outsniseesd outsnisedes outsnisedse outsnisesde outsnisesed
outsnisseed outsnissede outsnisseed outsnissede outsnissdee outsnissdee outsnisdese outsnisdees outsnisdsee outsnisdsee
outsnisdese outsnisdees outsnisedse outsnisedes outsnisesde outsnisesed outsniseesd outsniseeds outsnissede outsnisseed
outsnissdee outsnissdee outsnissede outsnisseed outsniseesd outsniseeds outsnisesed outsnisesde outsnisedse outsnisedes
outsneeidss outsneeidss outsneeisds outsneeissd outsneeissd outsneeisds outsneediss outsneediss outsneedsis outsneedssi
outsneedssi outsneedsis outsneesdis outsneesdsi outsneesids outsneesisd outsneessid outsneessdi outsneesdsi outsneesdis
outsneessdi outsneessid outsneesisd outsneesids outsneiedss outsneiedss outsneiesds outsneiessd outsneiessd outsneiesds
outsneidess outsneidess outsneidses outsneidsse outsneidsse outsneidses outsneisdes outsneisdse outsneiseds outsneisesd
outsneissed outsneissde outsneisdse outsneisdes outsneissde outsneissed outsneisesd outsneiseds outsnediess outsnediess
outsnedises outsnedisse outsnedisse outsnedises outsnedeiss outsnedeiss outsnedesis outsnedessi outsnedessi outsnedesis
outsnedseis outsnedsesi outsnedsies outsnedsise outsnedssie outsnedssei outsnedsesi outsnedseis outsnedssei outsnedssie
outsnedsise outsnedsies outsnesides outsnesidse outsnesieds outsnesiesd outsnesised outsnesisde outsnesdies outsnesdise
outsnesdeis outsnesdesi outsnesdsei outsnesdsie outsnesedis outsnesedsi outsneseids outsneseisd outsnesesid outsnesesdi
outsnessdei outsnessdie outsnessedi outsnesseid outsnessied outsnesside outsnesidse outsnesides outsnesisde outsnesised
outsnesiesd outsnesieds outsnesdise outsnesdies outsnesdsie outsnesdsei outsnesdesi outsnesdeis outsnessdie outsnessdei
outsnesside outsnessied outsnesseid outsnessedi outsnesedsi outsnesedis outsnesesdi outsnesesid outsneseisd outsneseids
outsnseieds outsnseiesd outsnseides outsnseidse outsnseisde outsnseised outsnseeids outsnseeisd outsnseedis outsnseedsi
outsnseesdi outsnseesid outsnsedeis outsnsedesi outsnsedies outsnsedise outsnsedsie outsnsedsei outsnsesedi outsnseseid
outsnsesdei outsnsesdie outsnseside outsnsesied outsnsieeds outsnsieesd outsnsiedes outsnsiedse outsnsiesde outsnsiesed
outsnsieeds outsnsieesd outsnsiedes outsnsiedse outsnsiesde outsnsiesed outsnsidees outsnsidese outsnsidees outsnsidese
outsnsidsee outsnsidsee outsnsisede outsnsiseed outsnsisdee outsnsisdee outsnsisede outsnsiseed outsnseieds outsnseiesd
outsnseides outsnseidse outsnseisde outsnseised outsnseeids outsnseeisd outsnseedis outsnseedsi outsnseesdi outsnseesid
outsnsedeis outsnsedesi outsnsedies outsnsedise outsnsedsie outsnsedsei outsnsesedi outsnseseid outsnsesdei outsnsesdie
outsnseside outsnsesied outsnsdiees outsnsdiese outsnsdiees outsnsdiese outsnsdisee outsnsdisee outsnsdeies outsnsdeise
outsnsdeeis outsnsdeesi outsnsdesei outsnsdesie outsnsdeeis outsnsdeesi outsnsdeies outsnsdeise outsnsdesie outsnsdesei
outsnsdseei outsnsdseie outsnsdseei outsnsdseie outsnsdsiee outsnsdsiee outsnssiede outsnssieed outsnssidee outsnssidee
outsnssiede outsnssieed outsnsseide outsnsseied outsnssedie outsnssedei outsnsseedi outsnsseeid outsnssdeie outsnssdeei
outsnssdiee outsnssdiee outsnssdeie outsnssdeei outsnsseedi outsnsseeid outsnssedei outsnssedie outsnsseide outsnsseied
outsnseiesd outsnseieds outsnseised outsnseisde outsnseidse outsnseides outsnseeisd outsnseeids outsnseesid outsnseesdi
outsnseedsi outsnseedis outsnseseid outsnsesedi outsnsesied outsnseside outsnsesdie outsnsesdei outsnsedesi outsnsedeis
outsnsedsei outsnsedsie outsnsedise outsnsedies outsnsieesd outsnsieeds outsnsiesed outsnsiesde outsnsiedse outsnsiedes
outsnsieesd outsnsieeds outsnsiesed outsnsiesde outsnsiedse outsnsiedes outsnsiseed outsnsisede outsnsiseed outsnsisede
outsnsisdee outsnsisdee outsnsidese outsnsidees outsnsidsee outsnsidsee outsnsidese outsnsidees outsnseiesd outsnseieds
outsnseised outsnseisde outsnseidse outsnseides outsnseeisd outsnseeids outsnseesid outsnseesdi outsnseedsi outsnseedis
outsnseseid outsnsesedi outsnsesied outsnseside outsnsesdie outsnsesdei outsnsedesi outsnsedeis outsnsedsei outsnsedsie
outsnsedise outsnsedies outsnssieed outsnssiede outsnssieed outsnssiede outsnssidee outsnssidee outsnsseied outsnsseide
outsnsseeid outsnsseedi outsnssedei outsnssedie outsnsseeid outsnsseedi outsnsseied outsnsseide outsnssedie outsnssedei
outsnssdeei outsnssdeie outsnssdeei outsnssdeie outsnssdiee outsnssdiee outsnsdiese outsnsdiees outsnsdisee outsnsdisee
outsnsdiese outsnsdiees outsnsdeise outsnsdeies outsnsdesie outsnsdesei outsnsdeesi outsnsdeeis outsnsdseie outsnsdseei
outsnsdsiee outsnsdsiee outsnsdseie outsnsdseei outsnsdeesi outsnsdeeis outsnsdesei outsnsdesie outsnsdeise outsnsdeies
outsedeniss outsedeniss outsedensis outsedenssi outsedenssi outsedensis outsedeinss outsedeinss outsedeisns outsedeissn
outsedeissn outsedeisns outsedesins outsedesisn outsedesnis outsedesnsi outsedessni outsedessin outsedesisn outsedesins
outsedessin outsedessni outsedesnsi outsedesnis outsedneiss outsedneiss outsednesis outsednessi outsednessi outsednesis
outsedniess outsedniess outsednises outsednisse outsednisse outsednises outsednsies outsednsise outsednseis outsednsesi
outsednssei outsednssie outsednsise outsednsies outsednssie outsednssei outsednsesi outsednseis outsediness outsediness
outsedinses outsedinsse outsedinsse outsedinses outsedienss outsedienss outsediesns outsediessn outsediessn outsediesns
outsedisens outsedisesn outsedisnes outsedisnse outsedissne outsedissen outsedisesn outsedisens outsedissen outsedissne
outsedisnse outsedisnes outsedsnies outsedsnise outsedsneis outsedsnesi outsedsnsei outsedsnsie outsedsines outsedsinse
outsedsiens outsedsiesn outsedsisen outsedsisne outsedseins outsedseisn outsedsenis outsedsensi outsedsesni outsedsesin
outsedssien outsedssine outsedssein outsedsseni outsedssnei outsedssnie outsedsnise outsedsnies outsedsnsie outsedsnsei
outsedsnesi outsedsneis outsedsinse outsedsines outsedsisne outsedsisen outsedsiesn outsedsiens outsedssine outsedssien
outsedssnie outsedssnei outsedsseni outsedssein outsedseisn outsedseins outsedsesin outsedsesni outsedsensi outsedsenis
outseedniss outseedniss outseednsis outseednssi outseednssi outseednsis outseedinss outseedinss outseedisns outseedissn
outseedissn outseedisns outseedsins outseedsisn outseedsnis outseedsnsi outseedssni outseedssin outseedsisn outseedsins
outseedssin outseedssni outseedsnsi outseedsnis outseendiss outseendiss outseendsis outseendssi outseendssi outseendsis
outseenidss outseenidss outseenisds outseenissd outseenissd outseenisds outseensids outseensisd outseensdis outseensdsi
outseenssdi outseenssid outseensisd outseensids outseenssid outseenssdi outseensdsi outseensdis outseeindss outseeindss
outseeinsds outseeinssd outseeinssd outseeinsds outseeidnss outseeidnss outseeidsns outseeidssn outseeidssn outseeidsns
outseeisdns outseeisdsn outseeisnds outseeisnsd outseeissnd outseeissdn outseeisdsn outseeisdns outseeissdn outseeissnd
outseeisnsd outseeisnds outseesnids outseesnisd outseesndis outseesndsi outseesnsdi outseesnsid outseesinds outseesinsd
outseesidns outseesidsn outseesisdn outseesisnd outseesdins outseesdisn outseesdnis outseesdnsi outseesdsni outseesdsin
outseessidn outseessind outseessdin outseessdni outseessndi outseessnid outseesnisd outseesnids outseesnsid outseesnsdi
outseesndsi outseesndis outseesinsd outseesinds outseesisnd outseesisdn outseesidsn outseesidns outseessind outseessidn
outseessnid outseessndi outseessdni outseessdin outseesdisn outseesdins outseesdsin outseesdsni outseesdnsi outseesdnis
outsenediss outsenediss outsenedsis outsenedssi outsenedssi outsenedsis outseneidss outseneidss outseneisds outseneissd
outseneissd outseneisds outsenesids outsenesisd outsenesdis outsenesdsi outsenessdi outsenessid outsenesisd outsenesids
outsenessid outsenessdi outsenesdsi outsenesdis outsendeiss outsendeiss outsendesis outsendessi outsendessi outsendesis
outsendiess outsendiess outsendises outsendisse outsendisse outsendises outsendsies outsendsise outsendseis outsendsesi
outsendssei outsendssie outsendsise outsendsies outsendssie outsendssei outsendsesi outsendseis outsenidess outsenidess
outsenidses outsenidsse outsenidsse outsenidses outseniedss outseniedss outseniesds outseniessd outseniessd outseniesds
outseniseds outsenisesd outsenisdes outsenisdse outsenissde outsenissed outsenisesd outseniseds outsenissed outsenissde
outsenisdse outsenisdes outsensdies outsensdise outsensdeis outsensdesi outsensdsei outsensdsie outsensides outsensidse
outsensieds outsensiesd outsensised outsensisde outsenseids outsenseisd outsensedis outsensedsi outsensesdi outsensesid
outsenssied outsensside outsensseid outsenssedi outsenssdei outsenssdie outsensdise outsensdies outsensdsie outsensdsei
outsensdesi outsensdeis outsensidse outsensides outsensisde outsensised outsensiesd outsensieds outsensside outsenssied
outsenssdie outsenssdei outsenssedi outsensseid outsenseisd outsenseids outsensesid outsensesdi outsensedsi outsensedis
outseiendss outseiendss outseiensds outseienssd outseienssd outseiensds outseiednss outseiednss outseiedsns outseiedssn
outseiedssn outseiedsns outseiesdns outseiesdsn outseiesnds outseiesnsd outseiessnd outseiessdn outseiesdsn outseiesdns
outseiessdn outseiessnd outseiesnsd outseiesnds outseinedss outseinedss outseinesds outseinessd outseinessd outseinesds
outseindess outseindess outseindses outseindsse outseindsse outseindses outseinsdes outseinsdse outseinseds outseinsesd
outseinssed outseinssde outseinsdse outseinsdes outseinssde outseinssed outseinsesd outseinseds outseidness outseidness
outseidnses outseidnsse outseidnsse outseidnses outseidenss outseidenss outseidesns outseidessn outseidessn outseidesns
outseidsens outseidsesn outseidsnes outseidsnse outseidssne outseidssen outseidsesn outseidsens outseidssen outseidssne
outseidsnse outseidsnes outseisndes outseisndse outseisneds outseisnesd outseisnsed outseisnsde outseisdnes outseisdnse
outseisdens outseisdesn outseisdsen outseisdsne outseisedns outseisedsn outseisends outseisensd outseisesnd outseisesdn
outseissden outseissdne outseissedn outseissend outseissned outseissnde outseisndse outseisndes outseisnsde outseisnsed
outseisnesd outseisneds outseisdnse outseisdnes outseisdsne outseisdsen outseisdesn outseisdens outseissdne outseissden
outseissnde outseissned outseissend outseissedn outseisedsn outseisedns outseisesdn outseisesnd outseisensd outseisends
outsesenids outsesenisd outsesendis outsesendsi outsesensdi outsesensid outseseinds outseseinsd outseseidns outseseidsn
outseseisdn outseseisnd outsesedins outsesedisn outsesednis outsesednsi outsesedsni outsesedsin outsesesidn outsesesind
outsesesdin outsesesdni outsesesndi outsesesnid outsesneids outsesneisd outsesnedis outsesnedsi outsesnesdi outsesnesid
outsesnieds outsesniesd outsesnides outsesnidse outsesnisde outsesnised outsesndies outsesndise outsesndeis outsesndesi
outsesndsei outsesndsie outsesnside outsesnsied outsesnsdie outsesnsdei outsesnsedi outsesnseid outsesineds outsesinesd
outsesindes outsesindse outsesinsde outsesinsed outsesiends outsesiensd outsesiedns outsesiedsn outsesiesdn outsesiesnd
outsesidens outsesidesn outsesidnes outsesidnse outsesidsne outsesidsen outsesisedn outsesisend outsesisden outsesisdne
outsesisnde outsesisned outsesdnies outsesdnise outsesdneis outsesdnesi outsesdnsei outsesdnsie outsesdines outsesdinse
outsesdiens outsesdiesn outsesdisen outsesdisne outsesdeins outsesdeisn outsesdenis outsesdensi outsesdesni outsesdesin
outsesdsien outsesdsine outsesdsein outsesdseni outsesdsnei outsesdsnie outsessnide outsessnied outsessndie outsessndei
outsessnedi outsessneid outsessinde outsessined outsessidne outsessiden outsessiedn outsessiend outsessdine outsessdien
outsessdnie outsessdnei outsessdeni outsessdein outsesseidn outsesseind outsessedin outsessedni outsessendi outsessenid
outsesenisd outsesenids outsesensid outsesensdi outsesendsi outsesendis outseseinsd outseseinds outseseisnd outseseisdn
outseseidsn outseseidns outsesesind outsesesidn outsesesnid outsesesndi outsesesdni outsesesdin outsesedisn outsesedins
outsesedsin outsesedsni outsesednsi outsesednis outsesneisd outsesneids outsesnesid outsesnesdi outsesnedsi outsesnedis
outsesniesd outsesnieds outsesnised outsesnisde outsesnidse outsesnides outsesnsied outsesnside outsesnseid outsesnsedi
outsesnsdei outsesnsdie outsesndise outsesndies outsesndsie outsesndsei outsesndesi outsesndeis outsesinesd outsesineds
outsesinsed outsesinsde outsesindse outsesindes outsesiensd outsesiends outsesiesnd outsesiesdn outsesiedsn outsesiedns
outsesisend outsesisedn outsesisned outsesisnde outsesisdne outsesisden outsesidesn outsesidens outsesidsen outsesidsne
outsesidnse outsesidnes outsessnied outsessnide outsessneid outsessnedi outsessndei outsessndie outsessined outsessinde
outsessiend outsessiedn outsessiden outsessidne outsesseind outsesseidn outsessenid outsessendi outsessedni outsessedin
outsessdien outsessdine outsessdein outsessdeni outsessdnei outsessdnie outsesdnise outsesdnies outsesdnsie outsesdnsei
outsesdnesi outsesdneis outsesdinse outsesdines outsesdisne outsesdisen outsesdiesn outsesdiens outsesdsine outsesdsien
outsesdsnie outsesdsnei outsesdseni outsesdsein outsesdeisn outsesdeins outsesdesin outsesdesni outsesdensi outsesdenis
outssdeneis outssdenesi outssdenies outssdenise outssdensie outssdensei outssdeenis outssdeensi outssdeeins outssdeeisn
outssdeesin outssdeesni outssdeiens outssdeiesn outssdeines outssdeinse outssdeisne outssdeisen outssdesein outssdeseni
outssdesien outssdesine outssdesnie outssdesnei outssdneeis outssdneesi outssdneies outssdneise outssdnesie outssdnesei
outssdneeis outssdneesi outssdneies outssdneise outssdnesie outssdnesei outssdniees outssdniese outssdniees outssdniese
outssdnisee outssdnisee outssdnseie outssdnseei outssdnsiee outssdnsiee outssdnseie outssdnseei outssdeneis outssdenesi
outssdenies outssdenise outssdensie outssdensei outssdeenis outssdeensi outssdeeins outssdeeisn outssdeesin outssdeesni
outssdeiens outssdeiesn outssdeines outssdeinse outssdeisne outssdeisen outssdesein outssdeseni outssdesien outssdesine
outssdesnie outssdesnei outssdinees outssdinese outssdinees outssdinese outssdinsee outssdinsee outssdienes outssdiense
outssdieens outssdieesn outssdiesen outssdiesne outssdieens outssdieesn outssdienes outssdiense outssdiesne outssdiesen
outssdiseen outssdisene outssdiseen outssdisene outssdisnee outssdisnee outssdsneie outssdsneei outssdsniee outssdsniee
outssdsneie outssdsneei outssdsenie outssdsenei outssdseine outssdseien outssdseein outssdseeni outssdsiene outssdsieen
outssdsinee outssdsinee outssdsiene outssdsieen outssdseein outssdseeni outssdseien outssdseine outssdsenie outssdsenei
outssedneis outssednesi outssednies outssednise outssednsie outssednsei outssedenis outssedensi outssedeins outssedeisn
outssedesin outssedesni outssediens outssediesn outssedines outssedinse outssedisne outssedisen outssedsein outssedseni
outssedsien outssedsine outssedsnie outssedsnei outssendeis outssendesi outssendies outssendise outssendsie outssendsei
outssenedis outssenedsi outsseneids outsseneisd outssenesid outssenesdi outssenieds outsseniesd outssenides outssenidse
outssenisde outssenised outssenseid outssensedi outssensied outssenside outssensdie outssensdei outsseendis outsseendsi
outsseenids outsseenisd outsseensid outsseensdi outsseednis outsseednsi outsseedins outsseedisn outsseedsin outsseedsni
outsseeidns outsseeidsn outsseeinds outsseeinsd outsseeisnd outsseeisdn outsseesdin outsseesdni outsseesidn outsseesind
outsseesnid outsseesndi outsseineds outsseinesd outsseindes outsseindse outsseinsde outsseinsed outsseiends outsseiensd
outsseiedns outsseiedsn outsseiesdn outsseiesnd outsseidens outsseidesn outsseidnes outsseidnse outsseidsne outsseidsen
outsseisedn outsseisend outsseisden outsseisdne outsseisnde outsseisned outssesneid outssesnedi outssesnied outssesnide
outssesndie outssesndei outssesenid outssesendi outsseseind outsseseidn outssesedin outssesedni outssesiend outssesiedn
outssesined outssesinde outssesidne outssesiden outssesdein outssesdeni outssesdien outssesdine outssesdnie outssesdnei
outssnedeis outssnedesi outssnedies outssnedise outssnedsie outssnedsei outssneedis outssneedsi outssneeids outssneeisd
outssneesid outssneesdi outssneieds outssneiesd outssneides outssneidse outssneisde outssneised outssneseid outssnesedi
outssnesied outssneside outssnesdie outssnesdei outssndeeis outssndeesi outssndeies outssndeise outssndesie outssndesei
outssndeeis outssndeesi outssndeies outssndeise outssndesie outssndesei outssndiees outssndiese outssndiees outssndiese
outssndisee outssndisee outssndseie outssndseei outssndsiee outssndsiee outssndseie outssndseei outssnedeis outssnedesi
outssnedies outssnedise outssnedsie outssnedsei outssneedis outssneedsi outssneeids outssneeisd outssneesid outssneesdi
outssneieds outssneiesd outssneides outssneidse outssneisde outssneised outssneseid outssnesedi outssnesied outssneside
outssnesdie outssnesdei outssnidees outssnidese outssnidees outssnidese outssnidsee outssnidsee outssniedes outssniedse
outssnieeds outssnieesd outssniesed outssniesde outssnieeds outssnieesd outssniedes outssniedse outssniesde outssniesed
outssniseed outssnisede outssniseed outssnisede outssnisdee outssnisdee outssnsdeie outssnsdeei outssnsdiee outssnsdiee
outssnsdeie outssnsdeei outssnsedie outssnsedei outssnseide outssnseied outssnseeid outssnseedi outssnsiede outssnsieed
outssnsidee outssnsidee outssnsiede outssnsieed outssnseeid outssnseedi outssnseied outssnseide outssnsedie outssnsedei
outsseendis outsseendsi outsseenids outsseenisd outsseensid outsseensdi outsseednis outsseednsi outsseedins outsseedisn
outsseedsin outsseedsni outsseeidns outsseeidsn outsseeinds outsseeinsd outsseeisnd outsseeisdn outsseesdin outsseesdni
outsseesidn outsseesind outsseesnid outsseesndi outssenedis outssenedsi outsseneids outsseneisd outssenesid outssenesdi
outssendeis outssendesi outssendies outssendise outssendsie outssendsei outssenides outssenidse outssenieds outsseniesd
outssenised outssenisde outssensdie outssensdei outssenside outssensied outssenseid outssensedi outssedneis outssednesi
outssednies outssednise outssednsie outssednsei outssedenis outssedensi outssedeins outssedeisn outssedesin outssedesni
outssediens outssediesn outssedines outssedinse outssedisne outssedisen outssedsein outssedseni outssedsien outssedsine
outssedsnie outssedsnei outsseindes outsseindse outsseineds outsseinesd outsseinsed outsseinsde outsseidnes outsseidnse
outsseidens outsseidesn outsseidsen outsseidsne outsseiedns outsseiedsn outsseiends outsseiensd outsseiesnd outsseiesdn
outsseisden outsseisdne outsseisedn outsseisend outsseisned outsseisnde outssesndie outssesndei outssesnide outssesnied
outssesneid outssesnedi outssesdnie outssesdnei outssesdine outssesdien outssesdein outssesdeni outssesidne outssesiden
outssesinde outssesined outssesiend outssesiedn outssesedin outssesedni outsseseidn outsseseind outssesenid outssesendi
outssieneds outssienesd outssiendes outssiendse outssiensde outssiensed outssieends outssieensd outssieedns outssieedsn
outssieesdn outssieesnd outssiedens outssiedesn outssiednes outssiednse outssiedsne outssiedsen outssiesedn outssiesend
outssiesden outssiesdne outssiesnde outssiesned outssineeds outssineesd outssinedes outssinedse outssinesde outssinesed
outssineeds outssineesd outssinedes outssinedse outssinesde outssinesed outssindees outssindese outssindees outssindese
outssindsee outssindsee outssinsede outssinseed outssinsdee outssinsdee outssinsede outssinseed outssieneds outssienesd
outssiendes outssiendse outssiensde outssiensed outssieends outssieensd outssieedns outssieedsn outssieesdn outssieesnd
outssiedens outssiedesn outssiednes outssiednse outssiedsne outssiedsen outssiesedn outssiesend outssiesden outssiesdne
outssiesnde outssiesned outssidnees outssidnese outssidnees outssidnese outssidnsee outssidnsee outssidenes outssidense
outssideens outssideesn outssidesen outssidesne outssideens outssideesn outssidenes outssidense outssidesne outssidesen
outssidseen outssidsene outssidseen outssidsene outssidsnee outssidsnee outssisnede outssisneed outssisndee outssisndee
outssisnede outssisneed outssisende outssisened outssisedne outssiseden outssiseedn outssiseend outssisdene outssisdeen
outssisdnee outssisdnee outssisdene outssisdeen outssiseedn outssiseend outssiseden outssisedne outssisende outssisened
outssseneid outsssenedi outsssenied outsssenide outsssendie outsssendei outssseenid outssseendi outssseeind outssseeidn
outssseedin outssseedni outssseiend outssseiedn outssseined outssseinde outssseidne outssseiden outsssedein outsssedeni
outsssedien outsssedine outsssednie outsssednei outsssneeid outsssneedi outsssneied outsssneide outsssnedie outsssnedei
outsssneeid outsssneedi outsssneied outsssneide outsssnedie outsssnedei outsssnieed outsssniede outsssnieed outsssniede
outsssnidee outsssnidee outsssndeie outsssndeei outsssndiee outsssndiee outsssndeie outsssndeei outssseneid outsssenedi
outsssenied outsssenide outsssendie outsssendei outssseenid outssseendi outssseeind outssseeidn outssseedin outssseedni
outssseiend outssseiedn outssseined outssseinde outssseidne outssseiden outsssedein outsssedeni outsssedien outsssedine
outsssednie outsssednei outsssineed outsssinede outsssineed outsssinede outsssindee outsssindee outsssiened outsssiende
outsssieend outsssieedn outsssieden outsssiedne outsssieend outsssieedn outsssiened outsssiende outsssiedne outsssieden
outsssideen outsssidene outsssideen outsssidene outsssidnee outsssidnee outsssdneie outsssdneei outsssdniee outsssdniee
outsssdneie outsssdneei outsssdenie outsssdenei outsssdeine outsssdeien outsssdeein outsssdeeni outsssdiene outsssdieen
outsssdinee outsssdinee outsssdiene outsssdieen outsssdeein outsssdeeni outsssdeien outsssdeine outsssdenie outsssdenei
outssdenesi outssdeneis outssdensei outssdensie outssdenise outssdenies outssdeensi outssdeenis outssdeesni outssdeesin
outssdeeisn outssdeeins outssdeseni outssdesein outssdesnei outssdesnie outssdesine outssdesien outssdeiesn outssdeiens
outssdeisen outssdeisne outssdeinse outssdeines outssdneesi outssdneeis outssdnesei outssdnesie outssdneise outssdneies
outssdneesi outssdneeis outssdnesei outssdnesie outssdneise outssdneies outssdnseei outssdnseie outssdnseei outssdnseie
outssdnsiee outssdnsiee outssdniese outssdniees outssdnisee outssdnisee outssdniese outssdniees outssdenesi outssdeneis
outssdensei outssdensie outssdenise outssdenies outssdeensi outssdeenis outssdeesni outssdeesin outssdeeisn outssdeeins
outssdeseni outssdesein outssdesnei outssdesnie outssdesine outssdesien outssdeiesn outssdeiens outssdeisen outssdeisne
outssdeinse outssdeines outssdsneei outssdsneie outssdsneei outssdsneie outssdsniee outssdsniee outssdsenei outssdsenie
outssdseeni outssdseein outssdseien outssdseine outssdseeni outssdseein outssdsenei outssdsenie outssdseine outssdseien
outssdsieen outssdsiene outssdsieen outssdsiene outssdsinee outssdsinee outssdinese outssdinees outssdinsee outssdinsee
outssdinese outssdinees outssdiense outssdienes outssdiesne outssdiesen outssdieesn outssdieens outssdisene outssdiseen
outssdisnee outssdisnee outssdisene outssdiseen outssdieesn outssdieens outssdiesen outssdiesne outssdiense outssdienes
outssednesi outssedneis outssednsei outssednsie outssednise outssednies outssedensi outssedenis outssedesni outssedesin
outssedeisn outssedeins outssedseni outssedsein outssedsnei outssedsnie outssedsine outssedsien outssediesn outssediens
outssedisen outssedisne outssedinse outssedines outssendesi outssendeis outssendsei outssendsie outssendise outssendies
outssenedsi outssenedis outssenesdi outssenesid outsseneisd outsseneids outssensedi outssenseid outssensdei outssensdie
outssenside outssensied outsseniesd outssenieds outssenised outssenisde outssenidse outssenides outsseendsi outsseendis
outsseensdi outsseensid outsseenisd outsseenids outsseednsi outsseednis outsseedsni outsseedsin outsseedisn outsseedins
outsseesdni outsseesdin outsseesndi outsseesnid outsseesind outsseesidn outsseeidsn outsseeidns outsseeisdn outsseeisnd
outsseeinsd outsseeinds outssesnedi outssesneid outssesndei outssesndie outssesnide outssesnied outssesendi outssesenid
outssesedni outssesedin outsseseidn outsseseind outssesdeni outssesdein outssesdnei outssesdnie outssesdine outssesdien
outssesiedn outssesiend outssesiden outssesidne outssesinde outssesined outsseinesd outsseineds outsseinsed outsseinsde
outsseindse outsseindes outsseiensd outsseiends outsseiesnd outsseiesdn outsseiedsn outsseiedns outsseisend outsseisedn
outsseisned outsseisnde outsseisdne outsseisden outsseidesn outsseidens outsseidsen outsseidsne outsseidnse outsseidnes
outssnedesi outssnedeis outssnedsei outssnedsie outssnedise outssnedies outssneedsi outssneedis outssneesdi outssneesid
outssneeisd outssneeids outssnesedi outssneseid outssnesdei outssnesdie outssneside outssnesied outssneiesd outssneieds
outssneised outssneisde outssneidse outssneides outssndeesi outssndeeis outssndesei outssndesie outssndeise outssndeies
outssndeesi outssndeeis outssndesei outssndesie outssndeise outssndeies outssndseei outssndseie outssndseei outssndseie
outssndsiee outssndsiee outssndiese outssndiees outssndisee outssndisee outssndiese outssndiees outssnedesi outssnedeis
outssnedsei outssnedsie outssnedise outssnedies outssneedsi outssneedis outssneesdi outssneesid outssneeisd outssneeids
outssnesedi outssneseid outssnesdei outssnesdie outssneside outssnesied outssneiesd outssneieds outssneised outssneisde
outssneidse outssneides outssnsdeei outssnsdeie outssnsdeei outssnsdeie outssnsdiee outssnsdiee outssnsedei outssnsedie
outssnseedi outssnseeid outssnseied outssnseide outssnseedi outssnseeid outssnsedei outssnsedie outssnseide outssnseied
outssnsieed outssnsiede outssnsieed outssnsiede outssnsidee outssnsidee outssnidese outssnidees outssnidsee outssnidsee
outssnidese outssnidees outssniedse outssniedes outssniesde outssniesed outssnieesd outssnieeds outssnisede outssniseed
outssnisdee outssnisdee outssnisede outssniseed outssnieesd outssnieeds outssniesed outssniesde outssniedse outssniedes
outsseendsi outsseendis outsseensdi outsseensid outsseenisd outsseenids outsseednsi outsseednis outsseedsni outsseedsin
outsseedisn outsseedins outsseesdni outsseesdin outsseesndi outsseesnid outsseesind outsseesidn outsseeidsn outsseeidns
outsseeisdn outsseeisnd outsseeinsd outsseeinds outssenedsi outssenedis outssenesdi outssenesid outsseneisd outsseneids
outssendesi outssendeis outssendsei outssendsie outssendise outssendies outssensdei outssensdie outssensedi outssenseid
outssensied outssenside outssenidse outssenides outssenisde outssenised outsseniesd outssenieds outssednesi outssedneis
outssednsei outssednsie outssednise outssednies outssedensi outssedenis outssedesni outssedesin outssedeisn outssedeins
outssedseni outssedsein outssedsnei outssedsnie outssedsine outssedsien outssediesn outssediens outssedisen outssedisne
outssedinse outssedines outssesndei outssesndie outssesnedi outssesneid outssesnied outssesnide outssesdnei outssesdnie
outssesdeni outssesdein outssesdien outssesdine outssesedni outssesedin outssesendi outssesenid outsseseind outsseseidn
outssesiden outssesidne outssesiedn outssesiend outssesined outssesinde outsseindse outsseindes outsseinsde outsseinsed
outsseinesd outsseineds outsseidnse outsseidnes outsseidsne outsseidsen outsseidesn outsseidens outsseisdne outsseisden
outsseisnde outsseisned outsseisend outsseisedn outsseiedsn outsseiedns outsseiesdn outsseiesnd outsseiensd outsseiends
outsssenedi outssseneid outsssendei outsssendie outsssenide outsssenied outssseendi outssseenid outssseedni outssseedin
outssseeidn outssseeind outsssedeni outsssedein outsssednei outsssednie outsssedine outsssedien outssseiedn outssseiend
outssseiden outssseidne outssseinde outssseined outsssneedi outsssneeid outsssnedei outsssnedie outsssneide outsssneied
outsssneedi outsssneeid outsssnedei outsssnedie outsssneide outsssneied outsssndeei outsssndeie outsssndeei outsssndeie
outsssndiee outsssndiee outsssniede outsssnieed outsssnidee outsssnidee outsssniede outsssnieed outsssenedi outssseneid
outsssendei outsssendie outsssenide outsssenied outssseendi outssseenid outssseedni outssseedin outssseeidn outssseeind
outsssedeni outsssedein outsssednei outsssednie outsssedine outsssedien outssseiedn outssseiend outssseiden outssseidne
outssseinde outssseined outsssdneei outsssdneie outsssdneei outsssdneie outsssdniee outsssdniee outsssdenei outsssdenie
outsssdeeni outsssdeein outsssdeien outsssdeine outsssdeeni outsssdeein outsssdenei outsssdenie outsssdeine outsssdeien
outsssdieen outsssdiene outsssdieen outsssdiene outsssdinee outsssdinee outsssinede outsssineed outsssindee outsssindee
outsssinede outsssineed outsssiende outsssiened outsssiedne outsssieden outsssieedn outsssieend outsssidene outsssideen
outsssidnee outsssidnee outsssidene outsssideen outsssieedn outsssieend outsssieden outsssiedne outsssiende outsssiened
outssienesd outssieneds outssiensed outssiensde outssiendse outssiendes outssieensd outssieends outssieesnd outssieesdn
outssieedsn outssieedns outssiesend outssiesedn outssiesned outssiesnde outssiesdne outssiesden outssiedesn outssiedens
outssiedsen outssiedsne outssiednse outssiednes outssineesd outssineeds outssinesed outssinesde outssinedse outssinedes
outssineesd outssineeds outssinesed outssinesde outssinedse outssinedes outssinseed outssinsede outssinseed outssinsede
outssinsdee outssinsdee outssindese outssindees outssindsee outssindsee outssindese outssindees outssienesd outssieneds
outssiensed outssiensde outssiendse outssiendes outssieensd outssieends outssieesnd outssieesdn outssieedsn outssieedns
outssiesend outssiesedn outssiesned outssiesnde outssiesdne outssiesden outssiedesn outssiedens outssiedsen outssiedsne
outssiednse outssiednes outssisneed outssisnede outssisneed outssisnede outssisndee outssisndee outssisened outssisende
outssiseend outssiseedn outssiseden outssisedne outssiseend outssiseedn outssisened outssisende outssisedne outssiseden
outssisdeen outssisdene outssisdeen outssisdene outssisdnee outssisdnee outssidnese outssidnees outssidnsee outssidnsee
outssidnese outssidnees outssidense outssidenes outssidesne outssidesen outssideesn outssideens outssidsene outssidseen
outssidsnee outssidsnee outssidsene outssidseen outssideesn outssideens outssidesen outssidesne outssidense outssidenes

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us