easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

foxpark

stridamque

megalobatrachus

psychopathology

vialful

tumultibusque

bantlings

soaplike

avonde

kamoru

longueville

volitavimusque

paleoichnology

campignian

matribus

contigimusque

totemite

telemetric


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: oquossoc
cipher variations:
prvpttpd qswquuqe rtxrvvrf suyswwsg tvztxxth
uwauyyui vxbvzzvj wycwaawk xzdxbbxl yaeyccym
zbfzddzn acgaeeao bdhbffbp ceicggcq dfjdhhdr
egkeiies fhlfjjft gimgkkgu hjnhllhv ikoimmiw
jlpjnnjx kmqkooky lnrlpplz mosmqqma nptnrrnb

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: oquossoc
Cipher: ljflhhlx

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: oquossoc
Cipher: ABBAB ABBBB BAABB ABBAB BAAAB BAAAB ABBAB AAABA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: oquossoc
cipher variations:
prvpttpdrxjrddrhtdxtnntlvjlvxxvpxpzxhhxtzvnzrrzxdhpdlldffndfvvfj
htrhffhnjzfjppjrlftlzzlvnlhnjjnzqswquuqesykseesiueyuooumwkmwyywq
yqayiiyuawoassayeiqemmeggoegwwgkiusiggiokagkqqksmgumaamwomiokkoa
rtxrvvrftzltfftjvfzvppvnxlnxzzxrzrbzjjzvbxpbttbzfjrfnnfhhpfhxxhl
jvtjhhjplbhlrrltnhvnbbnxpnjpllpbsuyswwsguamuggukwgawqqwoymoyaays
ascakkawcyqcuucagksgoogiiqgiyyimkwukiikqmcimssmuoiwoccoyqokqmmqc
tvztxxthvbnvhhvlxhbxrrxpznpzbbztbtdbllbxdzrdvvdbhlthpphjjrhjzzjn
lxvljjlrndjnttnvpjxpddpzrplrnnrduwauyyuiwcowiiwmyicyssyqaoqaccau
cuecmmcyeasewwecimuiqqikksikaakomywmkkmsoekouuowqkyqeeqasqmsoose
vxbvzzvjxdpxjjxnzjdzttzrbprbddbvdvfdnndzfbtfxxfdjnvjrrjlltjlbblp
nzxnllntpflpvvpxrlzrffrbtrntpptfwycwaawkyeqykkyoakeauuascqsceecw
ewgeooeagcugyygekowksskmmukmccmqoayommouqgmqwwqysmasggscusouqqug
xzdxbbxlzfrzllzpblfbvvbtdrtdffdxfxhfppfbhdvhzzhflpxlttlnnvlnddnr
pbzpnnpvrhnrxxrztnbthhtdvtpvrrvhyaeyccymagsammaqcmgcwwcuesueggey
gyigqqgciewiaaigmqymuumoowmoeeosqcaqooqwsiosyysauocuiiuewuqwsswi
zbfzddznbhtbnnbrdnhdxxdvftvfhhfzhzjhrrhdjfxjbbjhnrznvvnppxnpffpt
rdbrpprxtjptzztbvpdvjjvfxvrxttxjacgaeeaociucoocseoieyyewguwgiiga
iakissiekgykcckiosaowwoqqyoqggqusecsqqsyukquaaucwqewkkwgywsyuuyk
bdhbffbpdjvdppdtfpjfzzfxhvxhjjhbjbljttjflhzlddljptbpxxprrzprhhrv
tfdtrrtzvlrvbbvdxrfxllxhzxtzvvzlceicggcqekweqqeugqkgaagyiwyikkic
kcmkuukgmiameemkqucqyyqssaqsiiswugeussuawmswccweysgymmyiayuawwam
dfjdhhdrflxfrrfvhrlhbbhzjxzjlljdldnlvvlhnjbnffnlrvdrzzrttbrtjjtx
vhfvttvbxntxddxfzthznnzjbzvbxxbnegkeiiesgmygssgwismicciakyakmmke
meomwwmiokcoggomswesaasuucsukkuywigwuuwcyouyeeygauiaooakcawcyyco
fhlfjjfthnzhtthxjtnjddjblzblnnlfnfpnxxnjpldphhpntxftbbtvvdtvllvz
xjhxvvxdzpvzffzhbvjbppbldbxdzzdpgimgkkguioaiuuiykuokeekcmacmoomg
ogqoyyokqmeqiiqouyguccuwweuwmmwaykiywwyeaqwaggaicwkcqqcmecyeaaeq
hjnhllhvjpbjvvjzlvplffldnbdnppnhphrpzzplrnfrjjrpvzhvddvxxfvxnnxb
zljzxxzfbrxbhhbjdxldrrdnfdzfbbfrikoimmiwkqckwwkamwqmggmeoceoqqoi
qisqaaqmsogskksqwaiweewyygwyooycamkayyagcsyciickeymesseogeagccgs
jlpjnnjxlrdlxxlbnxrnhhnfpdfprrpjrjtrbbrntphtlltrxbjxffxzzhxzppzd
bnlbzzbhdtzdjjdlfznfttfphfbhddhtkmqkookymsemyymcoysoiiogqegqssqk
skusccsouqiummusyckyggyaaiyaqqaecomcaacieuaekkemgaoguugqigcieeiu
lnrlpplzntfnzzndpztpjjphrfhrttrltlvtddtpvrjvnnvtzdlzhhzbbjzbrrbf
dpndbbdjfvbfllfnhbphvvhrjhdjffjvmosmqqmaougoaaoeqauqkkqisgisuusm
umwueeuqwskwoowuaemaiiacckacsscgeqoeccekgwcgmmgoicqiwwiskiekggkw
nptnrrnbpvhpbbpfrbvrllrjthjtvvtnvnxvffvrxtlxppxvbfnbjjbddlbdttdh
frpfddflhxdhnnhpjdrjxxjtljflhhlxoquossocqwiqccqgscwsmmskuikuwwuo
woywggwsyumyqqywcgockkceemceuueigsqgeegmiyeiooiqkeskyykumkgmiimy

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: oquossoc
Cipher: bdhbffbp

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: oquossoc
Cipher: 4314544334344331

Extended Methods:
Method #1

Plaintext: oquossoc
method variations:
tvztxxthyaeyccyndfkdhhdsilpinnix

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
o q u o s s o c 
4 1 5 4 3 3 4 3 
3 4 4 3 4 4 3 1 
They are then read out in rows:
4154334334434431
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: oquossoc
Cipher: dunosotc

Read more ...
Method #3

Plaintext: oquossoc
method variations:
cytnotnq ytnotnqc tnotnqcy
notnqcyt otnqcytn tnqcytno
nqcytnot qcytnotn

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: oquossoc

first 5040 cipher variations(40320 total)
oquossoc oquossco oquososc oquosocs oquoscos oquoscso oquossoc oquossco oquososc oquosocs oquoscos
oquoscso oquoossc oquooscs oquoossc oquooscs oquoocss oquoocss oquocsos oquocsso oquocoss oquocoss
oquocsos oquocsso oqusosoc oqusosco oqusoosc oqusoocs oqusocos oqusocso oqussooc oqussoco oqussooc
oqussoco oqusscoo oqusscoo oqusosoc oqusosco oqusoosc oqusoocs oqusocos oqusocso oquscsoo oquscsoo
oquscoso oquscoos oquscoos oquscoso oqussooc oqussoco oqussooc oqussoco oqusscoo oqusscoo oqusosoc
oqusosco oqusoosc oqusoocs oqusocos oqusocso oqusoosc oqusoocs oqusosoc oqusosco oqusocso oqusocos
oquscoos oquscoso oquscoos oquscoso oquscsoo oquscsoo oquossoc oquossco oquososc oquosocs oquoscos
oquoscso oquossoc oquossco oquososc oquosocs oquoscos oquoscso oquoossc oquooscs oquoossc oquooscs
oquoocss oquoocss oquocsos oquocsso oquocoss oquocoss oquocsos oquocsso oqucssoo oqucssoo oqucsoso
oqucsoos oqucsoos oqucsoso oqucssoo oqucssoo oqucsoso oqucsoos oqucsoos oqucsoso oqucosso oqucosos
oqucosso oqucosos oqucooss oqucooss oqucosos oqucosso oqucooss oqucooss oqucosos oqucosso oqoussoc
oqoussco oqousosc oqousocs oqouscos oqouscso oqoussoc oqoussco oqousosc oqousocs oqouscos oqouscso
oqouossc oqouoscs oqouossc oqouoscs oqouocss oqouocss oqoucsos oqoucsso oqoucoss oqoucoss oqoucsos
oqoucsso oqosusoc oqosusco oqosuosc oqosuocs oqosucos oqosucso oqossuoc oqossuco oqossouc oqossocu
oqosscou oqosscuo oqososuc oqososcu oqosousc oqosoucs oqosocus oqosocsu oqoscsou oqoscsuo oqoscosu
oqoscous oqoscuos oqoscuso oqossuoc oqossuco oqossouc oqossocu oqosscou oqosscuo oqosusoc oqosusco
oqosuosc oqosuocs oqosucos oqosucso oqosousc oqosoucs oqososuc oqososcu oqosocsu oqosocus oqoscuos
oqoscuso oqoscous oqoscosu oqoscsou oqoscsuo oqoossuc oqoosscu oqoosusc oqoosucs oqooscus oqooscsu
oqoossuc oqoosscu oqoosusc oqoosucs oqooscus oqooscsu oqooussc oqoouscs oqooussc oqoouscs oqooucss
oqooucss oqoocsus oqoocssu oqoocuss oqoocuss oqoocsus oqoocssu oqocssou oqocssuo oqocsosu oqocsous
oqocsuos oqocsuso oqocssou oqocssuo oqocsosu oqocsous oqocsuos oqocsuso oqocossu oqocosus oqocossu
oqocosus oqocouss oqocouss oqocusos oqocusso oqocuoss oqocuoss oqocusos oqocusso oqsousoc oqsousco
oqsouosc oqsouocs oqsoucos oqsoucso oqsosuoc oqsosuco oqsosouc oqsosocu oqsoscou oqsoscuo oqsoosuc
oqsooscu oqsoousc oqsooucs oqsoocus oqsoocsu oqsocsou oqsocsuo oqsocosu oqsocous oqsocuos oqsocuso
oqsuosoc oqsuosco oqsuoosc oqsuoocs oqsuocos oqsuocso oqsusooc oqsusoco oqsusooc oqsusoco oqsuscoo
oqsuscoo oqsuosoc oqsuosco oqsuoosc oqsuoocs oqsuocos oqsuocso oqsucsoo oqsucsoo oqsucoso oqsucoos
oqsucoos oqsucoso oqssuooc oqssuoco oqssuooc oqssuoco oqssucoo oqssucoo oqssouoc oqssouco oqssoouc
oqssoocu oqssocou oqssocuo oqssoouc oqssoocu oqssouoc oqssouco oqssocuo oqssocou oqsscoou oqsscouo
oqsscoou oqsscouo oqsscuoo oqsscuoo oqsousoc oqsousco oqsouosc oqsouocs oqsoucos oqsoucso oqsosuoc
oqsosuco oqsosouc oqsosocu oqsoscou oqsoscuo oqsoosuc oqsooscu oqsoousc oqsooucs oqsoocus oqsoocsu
oqsocsou oqsocsuo oqsocosu oqsocous oqsocuos oqsocuso oqscusoo oqscusoo oqscuoso oqscuoos oqscuoos
oqscuoso oqscsuoo oqscsuoo oqscsouo oqscsoou oqscsoou oqscsouo oqscosuo oqscosou oqscouso oqscouos
oqscoous oqscoosu oqscosou oqscosuo oqscoosu oqscoous oqscouos oqscouso oqsosuoc oqsosuco oqsosouc
oqsosocu oqsoscou oqsoscuo oqsousoc oqsousco oqsouosc oqsouocs oqsoucos oqsoucso oqsoousc oqsooucs
oqsoosuc oqsooscu oqsoocsu oqsoocus oqsocuos oqsocuso oqsocous oqsocosu oqsocsou oqsocsuo oqssouoc
oqssouco oqssoouc oqssoocu oqssocou oqssocuo oqssuooc oqssuoco oqssuooc oqssuoco oqssucoo oqssucoo
oqssouoc oqssouco oqssoouc oqssoocu oqssocou oqssocuo oqsscuoo oqsscuoo oqsscouo oqsscoou oqsscoou
oqsscouo oqsusooc oqsusoco oqsusooc oqsusoco oqsuscoo oqsuscoo oqsuosoc oqsuosco oqsuoosc oqsuoocs
oqsuocos oqsuocso oqsuoosc oqsuoocs oqsuosoc oqsuosco oqsuocso oqsuocos oqsucoos oqsucoso oqsucoos
oqsucoso oqsucsoo oqsucsoo oqsosuoc oqsosuco oqsosouc oqsosocu oqsoscou oqsoscuo oqsousoc oqsousco
oqsouosc oqsouocs oqsoucos oqsoucso oqsoousc oqsooucs oqsoosuc oqsooscu oqsoocsu oqsoocus oqsocuos
oqsocuso oqsocous oqsocosu oqsocsou oqsocsuo oqscsuoo oqscsuoo oqscsouo oqscsoou oqscsoou oqscsouo
oqscusoo oqscusoo oqscuoso oqscuoos oqscuoos oqscuoso oqscouso oqscouos oqscosuo oqscosou oqscoosu
oqscoous oqscouos oqscouso oqscoous oqscoosu oqscosou oqscosuo oqoossuc oqoosscu oqoosusc oqoosucs
oqooscus oqooscsu oqoossuc oqoosscu oqoosusc oqoosucs oqooscus oqooscsu oqooussc oqoouscs oqooussc
oqoouscs oqooucss oqooucss oqoocsus oqoocssu oqoocuss oqoocuss oqoocsus oqoocssu oqososuc oqososcu
oqosousc oqosoucs oqosocus oqosocsu oqossouc oqossocu oqossuoc oqossuco oqosscuo oqosscou oqosusoc
oqosusco oqosuosc oqosuocs oqosucos oqosucso oqoscsuo oqoscsou oqoscuso oqoscuos oqoscous oqoscosu
oqossouc oqossocu oqossuoc oqossuco oqosscuo oqosscou oqososuc oqososcu oqosousc oqosoucs oqosocus
oqosocsu oqosuosc oqosuocs oqosusoc oqosusco oqosucso oqosucos oqoscous oqoscosu oqoscuos oqoscuso
oqoscsuo oqoscsou oqoussoc oqoussco oqousosc oqousocs oqouscos oqouscso oqoussoc oqoussco oqousosc
oqousocs oqouscos oqouscso oqouossc oqouoscs oqouossc oqouoscs oqouocss oqouocss oqoucsos oqoucsso
oqoucoss oqoucoss oqoucsos oqoucsso oqocssuo oqocssou oqocsuso oqocsuos oqocsous oqocsosu oqocssuo
oqocssou oqocsuso oqocsuos oqocsous oqocsosu oqocusso oqocusos oqocusso oqocusos oqocuoss oqocuoss
oqocosus oqocossu oqocouss oqocouss oqocosus oqocossu oqcossou oqcossuo oqcososu oqcosous oqcosuos
oqcosuso oqcossou oqcossuo oqcososu oqcosous oqcosuos oqcosuso oqcoossu oqcoosus oqcoossu oqcoosus
oqcoouss oqcoouss oqcousos oqcousso oqcouoss oqcouoss oqcousos oqcousso oqcsosou oqcsosuo oqcsoosu
oqcsoous oqcsouos oqcsouso oqcssoou oqcssouo oqcssoou oqcssouo oqcssuoo oqcssuoo oqcsosou oqcsosuo
oqcsoosu oqcsoous oqcsouos oqcsouso oqcsusoo oqcsusoo oqcsuoso oqcsuoos oqcsuoos oqcsuoso oqcssoou
oqcssouo oqcssoou oqcssouo oqcssuoo oqcssuoo oqcsosou oqcsosuo oqcsoosu oqcsoous oqcsouos oqcsouso
oqcsoosu oqcsoous oqcsosou oqcsosuo oqcsouso oqcsouos oqcsuoos oqcsuoso oqcsuoos oqcsuoso oqcsusoo
oqcsusoo oqcossou oqcossuo oqcososu oqcosous oqcosuos oqcosuso oqcossou oqcossuo oqcososu oqcosous
oqcosuos oqcosuso oqcoossu oqcoosus oqcoossu oqcoosus oqcoouss oqcoouss oqcousos oqcousso oqcouoss
oqcouoss oqcousos oqcousso oqcussoo oqcussoo oqcusoso oqcusoos oqcusoos oqcusoso oqcussoo oqcussoo
oqcusoso oqcusoos oqcusoos oqcusoso oqcuosso oqcuosos oqcuosso oqcuosos oqcuooss oqcuooss oqcuosos
oqcuosso oqcuooss oqcuooss oqcuosos oqcuosso ouqossoc ouqossco ouqososc ouqosocs ouqoscos ouqoscso
ouqossoc ouqossco ouqososc ouqosocs ouqoscos ouqoscso ouqoossc ouqooscs ouqoossc ouqooscs ouqoocss
ouqoocss ouqocsos ouqocsso ouqocoss ouqocoss ouqocsos ouqocsso ouqsosoc ouqsosco ouqsoosc ouqsoocs
ouqsocos ouqsocso ouqssooc ouqssoco ouqssooc ouqssoco ouqsscoo ouqsscoo ouqsosoc ouqsosco ouqsoosc
ouqsoocs ouqsocos ouqsocso ouqscsoo ouqscsoo ouqscoso ouqscoos ouqscoos ouqscoso ouqssooc ouqssoco
ouqssooc ouqssoco ouqsscoo ouqsscoo ouqsosoc ouqsosco ouqsoosc ouqsoocs ouqsocos ouqsocso ouqsoosc
ouqsoocs ouqsosoc ouqsosco ouqsocso ouqsocos ouqscoos ouqscoso ouqscoos ouqscoso ouqscsoo ouqscsoo
ouqossoc ouqossco ouqososc ouqosocs ouqoscos ouqoscso ouqossoc ouqossco ouqososc ouqosocs ouqoscos
ouqoscso ouqoossc ouqooscs ouqoossc ouqooscs ouqoocss ouqoocss ouqocsos ouqocsso ouqocoss ouqocoss
ouqocsos ouqocsso ouqcssoo ouqcssoo ouqcsoso ouqcsoos ouqcsoos ouqcsoso ouqcssoo ouqcssoo ouqcsoso
ouqcsoos ouqcsoos ouqcsoso ouqcosso ouqcosos ouqcosso ouqcosos ouqcooss ouqcooss ouqcosos ouqcosso
ouqcooss ouqcooss ouqcosos ouqcosso ouoqssoc ouoqssco ouoqsosc ouoqsocs ouoqscos ouoqscso ouoqssoc
ouoqssco ouoqsosc ouoqsocs ouoqscos ouoqscso ouoqossc ouoqoscs ouoqossc ouoqoscs ouoqocss ouoqocss
ouoqcsos ouoqcsso ouoqcoss ouoqcoss ouoqcsos ouoqcsso ouosqsoc ouosqsco ouosqosc ouosqocs ouosqcos
ouosqcso ouossqoc ouossqco ouossoqc ouossocq ouosscoq ouosscqo ouososqc ouososcq ouosoqsc ouosoqcs
ouosocqs ouosocsq ouoscsoq ouoscsqo ouoscosq ouoscoqs ouoscqos ouoscqso ouossqoc ouossqco ouossoqc
ouossocq ouosscoq ouosscqo ouosqsoc ouosqsco ouosqosc ouosqocs ouosqcos ouosqcso ouosoqsc ouosoqcs
ouososqc ouososcq ouosocsq ouosocqs ouoscqos ouoscqso ouoscoqs ouoscosq ouoscsoq ouoscsqo ouoossqc
ouoosscq ouoosqsc ouoosqcs ouooscqs ouooscsq ouoossqc ouoosscq ouoosqsc ouoosqcs ouooscqs ouooscsq
ouooqssc ouooqscs ouooqssc ouooqscs ouooqcss ouooqcss ouoocsqs ouoocssq ouoocqss ouoocqss ouoocsqs
ouoocssq ouocssoq ouocssqo ouocsosq ouocsoqs ouocsqos ouocsqso ouocssoq ouocssqo ouocsosq ouocsoqs
ouocsqos ouocsqso ouocossq ouocosqs ouocossq ouocosqs ouocoqss ouocoqss ouocqsos ouocqsso ouocqoss
ouocqoss ouocqsos ouocqsso ousoqsoc ousoqsco ousoqosc ousoqocs ousoqcos ousoqcso ousosqoc ousosqco
ousosoqc ousosocq ousoscoq ousoscqo ousoosqc ousooscq ousooqsc ousooqcs ousoocqs ousoocsq ousocsoq
ousocsqo ousocosq ousocoqs ousocqos ousocqso ousqosoc ousqosco ousqoosc ousqoocs ousqocos ousqocso
ousqsooc ousqsoco ousqsooc ousqsoco ousqscoo ousqscoo ousqosoc ousqosco ousqoosc ousqoocs ousqocos
ousqocso ousqcsoo ousqcsoo ousqcoso ousqcoos ousqcoos ousqcoso oussqooc oussqoco oussqooc oussqoco
oussqcoo oussqcoo oussoqoc oussoqco oussooqc oussoocq oussocoq oussocqo oussooqc oussoocq oussoqoc
oussoqco oussocqo oussocoq ousscooq ousscoqo ousscooq ousscoqo ousscqoo ousscqoo ousoqsoc ousoqsco
ousoqosc ousoqocs ousoqcos ousoqcso ousosqoc ousosqco ousosoqc ousosocq ousoscoq ousoscqo ousoosqc
ousooscq ousooqsc ousooqcs ousoocqs ousoocsq ousocsoq ousocsqo ousocosq ousocoqs ousocqos ousocqso
ouscqsoo ouscqsoo ouscqoso ouscqoos ouscqoos ouscqoso ouscsqoo ouscsqoo ouscsoqo ouscsooq ouscsooq
ouscsoqo ouscosqo ouscosoq ouscoqso ouscoqos ouscooqs ouscoosq ouscosoq ouscosqo ouscoosq ouscooqs
ouscoqos ouscoqso ousosqoc ousosqco ousosoqc ousosocq ousoscoq ousoscqo ousoqsoc ousoqsco ousoqosc
ousoqocs ousoqcos ousoqcso ousooqsc ousooqcs ousoosqc ousooscq ousoocsq ousoocqs ousocqos ousocqso
ousocoqs ousocosq ousocsoq ousocsqo oussoqoc oussoqco oussooqc oussoocq oussocoq oussocqo oussqooc
oussqoco oussqooc oussqoco oussqcoo oussqcoo oussoqoc oussoqco oussooqc oussoocq oussocoq oussocqo
ousscqoo ousscqoo ousscoqo ousscooq ousscooq ousscoqo ousqsooc ousqsoco ousqsooc ousqsoco ousqscoo
ousqscoo ousqosoc ousqosco ousqoosc ousqoocs ousqocos ousqocso ousqoosc ousqoocs ousqosoc ousqosco
ousqocso ousqocos ousqcoos ousqcoso ousqcoos ousqcoso ousqcsoo ousqcsoo ousosqoc ousosqco ousosoqc
ousosocq ousoscoq ousoscqo ousoqsoc ousoqsco ousoqosc ousoqocs ousoqcos ousoqcso ousooqsc ousooqcs
ousoosqc ousooscq ousoocsq ousoocqs ousocqos ousocqso ousocoqs ousocosq ousocsoq ousocsqo ouscsqoo
ouscsqoo ouscsoqo ouscsooq ouscsooq ouscsoqo ouscqsoo ouscqsoo ouscqoso ouscqoos ouscqoos ouscqoso
ouscoqso ouscoqos ouscosqo ouscosoq ouscoosq ouscooqs ouscoqos ouscoqso ouscooqs ouscoosq ouscosoq
ouscosqo ouoossqc ouoosscq ouoosqsc ouoosqcs ouooscqs ouooscsq ouoossqc ouoosscq ouoosqsc ouoosqcs
ouooscqs ouooscsq ouooqssc ouooqscs ouooqssc ouooqscs ouooqcss ouooqcss ouoocsqs ouoocssq ouoocqss
ouoocqss ouoocsqs ouoocssq ouososqc ouososcq ouosoqsc ouosoqcs ouosocqs ouosocsq ouossoqc ouossocq
ouossqoc ouossqco ouosscqo ouosscoq ouosqsoc ouosqsco ouosqosc ouosqocs ouosqcos ouosqcso ouoscsqo
ouoscsoq ouoscqso ouoscqos ouoscoqs ouoscosq ouossoqc ouossocq ouossqoc ouossqco ouosscqo ouosscoq
ouososqc ouososcq ouosoqsc ouosoqcs ouosocqs ouosocsq ouosqosc ouosqocs ouosqsoc ouosqsco ouosqcso
ouosqcos ouoscoqs ouoscosq ouoscqos ouoscqso ouoscsqo ouoscsoq ouoqssoc ouoqssco ouoqsosc ouoqsocs
ouoqscos ouoqscso ouoqssoc ouoqssco ouoqsosc ouoqsocs ouoqscos ouoqscso ouoqossc ouoqoscs ouoqossc
ouoqoscs ouoqocss ouoqocss ouoqcsos ouoqcsso ouoqcoss ouoqcoss ouoqcsos ouoqcsso ouocssqo ouocssoq
ouocsqso ouocsqos ouocsoqs ouocsosq ouocssqo ouocssoq ouocsqso ouocsqos ouocsoqs ouocsosq ouocqsso
ouocqsos ouocqsso ouocqsos ouocqoss ouocqoss ouocosqs ouocossq ouocoqss ouocoqss ouocosqs ouocossq
oucossoq oucossqo oucososq oucosoqs oucosqos oucosqso oucossoq oucossqo oucososq oucosoqs oucosqos
oucosqso oucoossq oucoosqs oucoossq oucoosqs oucooqss oucooqss oucoqsos oucoqsso oucoqoss oucoqoss
oucoqsos oucoqsso oucsosoq oucsosqo oucsoosq oucsooqs oucsoqos oucsoqso oucssooq oucssoqo oucssooq
oucssoqo oucssqoo oucssqoo oucsosoq oucsosqo oucsoosq oucsooqs oucsoqos oucsoqso oucsqsoo oucsqsoo
oucsqoso oucsqoos oucsqoos oucsqoso oucssooq oucssoqo oucssooq oucssoqo oucssqoo oucssqoo oucsosoq
oucsosqo oucsoosq oucsooqs oucsoqos oucsoqso oucsoosq oucsooqs oucsosoq oucsosqo oucsoqso oucsoqos
oucsqoos oucsqoso oucsqoos oucsqoso oucsqsoo oucsqsoo oucossoq oucossqo oucososq oucosoqs oucosqos
oucosqso oucossoq oucossqo oucososq oucosoqs oucosqos oucosqso oucoossq oucoosqs oucoossq oucoosqs
oucooqss oucooqss oucoqsos oucoqsso oucoqoss oucoqoss oucoqsos oucoqsso oucqssoo oucqssoo oucqsoso
oucqsoos oucqsoos oucqsoso oucqssoo oucqssoo oucqsoso oucqsoos oucqsoos oucqsoso oucqosso oucqosos
oucqosso oucqosos oucqooss oucqooss oucqosos oucqosso oucqooss oucqooss oucqosos oucqosso oouqssoc
oouqssco oouqsosc oouqsocs oouqscos oouqscso oouqssoc oouqssco oouqsosc oouqsocs oouqscos oouqscso
oouqossc oouqoscs oouqossc oouqoscs oouqocss oouqocss oouqcsos oouqcsso oouqcoss oouqcoss oouqcsos
oouqcsso oousqsoc oousqsco oousqosc oousqocs oousqcos oousqcso ooussqoc ooussqco ooussoqc ooussocq
oousscoq oousscqo oousosqc oousoscq oousoqsc oousoqcs oousocqs oousocsq oouscsoq oouscsqo oouscosq
oouscoqs oouscqos oouscqso ooussqoc ooussqco ooussoqc ooussocq oousscoq oousscqo oousqsoc oousqsco
oousqosc oousqocs oousqcos oousqcso oousoqsc oousoqcs oousosqc oousoscq oousocsq oousocqs oouscqos
oouscqso oouscoqs oouscosq oouscsoq oouscsqo oouossqc oouosscq oouosqsc oouosqcs oouoscqs oouoscsq
oouossqc oouosscq oouosqsc oouosqcs oouoscqs oouoscsq oouoqssc oouoqscs oouoqssc oouoqscs oouoqcss
oouoqcss oouocsqs oouocssq oouocqss oouocqss oouocsqs oouocssq ooucssoq ooucssqo ooucsosq ooucsoqs
ooucsqos ooucsqso ooucssoq ooucssqo ooucsosq ooucsoqs ooucsqos ooucsqso ooucossq ooucosqs ooucossq
ooucosqs ooucoqss ooucoqss ooucqsos ooucqsso ooucqoss ooucqoss ooucqsos ooucqsso ooqussoc ooqussco
ooqusosc ooqusocs ooquscos ooquscso ooqussoc ooqussco ooqusosc ooqusocs ooquscos ooquscso ooquossc
ooquoscs ooquossc ooquoscs ooquocss ooquocss ooqucsos ooqucsso ooqucoss ooqucoss ooqucsos ooqucsso
ooqsusoc ooqsusco ooqsuosc ooqsuocs ooqsucos ooqsucso ooqssuoc ooqssuco ooqssouc ooqssocu ooqsscou
ooqsscuo ooqsosuc ooqsoscu ooqsousc ooqsoucs ooqsocus ooqsocsu ooqscsou ooqscsuo ooqscosu ooqscous
ooqscuos ooqscuso ooqssuoc ooqssuco ooqssouc ooqssocu ooqsscou ooqsscuo ooqsusoc ooqsusco ooqsuosc
ooqsuocs ooqsucos ooqsucso ooqsousc ooqsoucs ooqsosuc ooqsoscu ooqsocsu ooqsocus ooqscuos ooqscuso
ooqscous ooqscosu ooqscsou ooqscsuo ooqossuc ooqosscu ooqosusc ooqosucs ooqoscus ooqoscsu ooqossuc
ooqosscu ooqosusc ooqosucs ooqoscus ooqoscsu ooqoussc ooqouscs ooqoussc ooqouscs ooqoucss ooqoucss
ooqocsus ooqocssu ooqocuss ooqocuss ooqocsus ooqocssu ooqcssou ooqcssuo ooqcsosu ooqcsous ooqcsuos
ooqcsuso ooqcssou ooqcssuo ooqcsosu ooqcsous ooqcsuos ooqcsuso ooqcossu ooqcosus ooqcossu ooqcosus
ooqcouss ooqcouss ooqcusos ooqcusso ooqcuoss ooqcuoss ooqcusos ooqcusso oosqusoc oosqusco oosquosc
oosquocs oosqucos oosqucso oosqsuoc oosqsuco oosqsouc oosqsocu oosqscou oosqscuo oosqosuc oosqoscu
oosqousc oosqoucs oosqocus oosqocsu oosqcsou oosqcsuo oosqcosu oosqcous oosqcuos oosqcuso oosuqsoc
oosuqsco oosuqosc oosuqocs oosuqcos oosuqcso oosusqoc oosusqco oosusoqc oosusocq oosuscoq oosuscqo
oosuosqc oosuoscq oosuoqsc oosuoqcs oosuocqs oosuocsq oosucsoq oosucsqo oosucosq oosucoqs oosucqos
oosucqso oossuqoc oossuqco oossuoqc oossuocq oossucoq oossucqo oossquoc oossquco oossqouc oossqocu
oossqcou oossqcuo oossoquc oossoqcu oossouqc oossoucq oossocuq oossocqu oosscqou oosscquo oosscoqu
oosscouq oosscuoq oosscuqo oosousqc oosouscq oosouqsc oosouqcs oosoucqs oosoucsq oososuqc oososucq
oososquc oososqcu oososcqu oososcuq oosoqsuc oosoqscu oosoqusc oosoqucs oosoqcus oosoqcsu oosocsqu
oosocsuq oosocqsu oosocqus oosocuqs oosocusq ooscusoq ooscusqo ooscuosq ooscuoqs ooscuqos ooscuqso
ooscsuoq ooscsuqo ooscsouq ooscsoqu ooscsqou ooscsquo ooscosuq ooscosqu ooscousq ooscouqs ooscoqus
ooscoqsu ooscqsou ooscqsuo ooscqosu ooscqous ooscquos ooscquso oosqsuoc oosqsuco oosqsouc oosqsocu
oosqscou oosqscuo oosqusoc oosqusco oosquosc oosquocs oosqucos oosqucso oosqousc oosqoucs oosqosuc
oosqoscu oosqocsu oosqocus oosqcuos oosqcuso oosqcous oosqcosu oosqcsou oosqcsuo oossquoc oossquco
oossqouc oossqocu oossqcou oossqcuo oossuqoc oossuqco oossuoqc oossuocq oossucoq oossucqo oossouqc
oossoucq oossoquc oossoqcu oossocqu oossocuq oosscuoq oosscuqo oosscouq oosscoqu oosscqou oosscquo
oosusqoc oosusqco oosusoqc oosusocq oosuscoq oosuscqo oosuqsoc oosuqsco oosuqosc oosuqocs oosuqcos
oosuqcso oosuoqsc oosuoqcs oosuosqc oosuoscq oosuocsq oosuocqs oosucqos oosucqso oosucoqs oosucosq
oosucsoq oosucsqo oososuqc oososucq oososquc oososqcu oososcqu oososcuq oosousqc oosouscq oosouqsc
oosouqcs oosoucqs oosoucsq oosoqusc oosoqucs oosoqsuc oosoqscu oosoqcsu oosoqcus oosocuqs oosocusq
oosocqus oosocqsu oosocsqu oosocsuq ooscsuoq ooscsuqo ooscsouq ooscsoqu ooscsqou ooscsquo ooscusoq
ooscusqo ooscuosq ooscuoqs ooscuqos ooscuqso ooscousq ooscouqs ooscosuq ooscosqu ooscoqsu ooscoqus
ooscquos ooscquso ooscqous ooscqosu ooscqsou ooscqsuo oooqssuc oooqsscu oooqsusc oooqsucs oooqscus
oooqscsu oooqssuc oooqsscu oooqsusc oooqsucs oooqscus oooqscsu oooqussc oooquscs oooqussc oooquscs
oooqucss oooqucss oooqcsus oooqcssu oooqcuss oooqcuss oooqcsus oooqcssu ooosqsuc ooosqscu ooosqusc
ooosqucs ooosqcus ooosqcsu ooossquc ooossqcu ooossuqc ooossucq ooosscuq ooosscqu ooosusqc ooosuscq
ooosuqsc ooosuqcs ooosucqs ooosucsq oooscsuq oooscsqu oooscusq oooscuqs oooscqus oooscqsu ooossquc
ooossqcu ooossuqc ooossucq ooosscuq ooosscqu ooosqsuc ooosqscu ooosqusc ooosqucs ooosqcus ooosqcsu
ooosuqsc ooosuqcs ooosusqc ooosuscq ooosucsq ooosucqs oooscqus oooscqsu oooscuqs oooscusq oooscsuq
oooscsqu oooussqc ooousscq ooousqsc ooousqcs ooouscqs ooouscsq oooussqc ooousscq ooousqsc ooousqcs
ooouscqs ooouscsq ooouqssc ooouqscs ooouqssc ooouqscs ooouqcss ooouqcss oooucsqs oooucssq oooucqss
oooucqss oooucsqs oooucssq ooocssuq ooocssqu ooocsusq ooocsuqs ooocsqus ooocsqsu ooocssuq ooocssqu
ooocsusq ooocsuqs ooocsqus ooocsqsu ooocussq ooocusqs ooocussq ooocusqs ooocuqss ooocuqss ooocqsus
ooocqssu ooocquss ooocquss ooocqsus ooocqssu oocqssou oocqssuo oocqsosu oocqsous oocqsuos oocqsuso
oocqssou oocqssuo oocqsosu oocqsous oocqsuos oocqsuso oocqossu oocqosus oocqossu oocqosus oocqouss
oocqouss oocqusos oocqusso oocquoss oocquoss oocqusos oocqusso oocsqsou oocsqsuo oocsqosu oocsqous
oocsquos oocsquso oocssqou oocssquo oocssoqu oocssouq oocssuoq oocssuqo oocsosqu oocsosuq oocsoqsu
oocsoqus oocsouqs oocsousq oocsusoq oocsusqo oocsuosq oocsuoqs oocsuqos oocsuqso oocssqou oocssquo
oocssoqu oocssouq oocssuoq oocssuqo oocsqsou oocsqsuo oocsqosu oocsqous oocsquos oocsquso oocsoqsu
oocsoqus oocsosqu oocsosuq oocsousq oocsouqs oocsuqos oocsuqso oocsuoqs oocsuosq oocsusoq oocsusqo
oocossqu oocossuq oocosqsu oocosqus oocosuqs oocosusq oocossqu oocossuq oocosqsu oocosqus oocosuqs
oocosusq oocoqssu oocoqsus oocoqssu oocoqsus oocoquss oocoquss oocousqs oocoussq oocouqss oocouqss
oocousqs oocoussq oocussoq oocussqo oocusosq oocusoqs oocusqos oocusqso oocussoq oocussqo oocusosq
oocusoqs oocusqos oocusqso oocuossq oocuosqs oocuossq oocuosqs oocuoqss oocuoqss oocuqsos oocuqsso
oocuqoss oocuqoss oocuqsos oocuqsso osuoqsoc osuoqsco osuoqosc osuoqocs osuoqcos osuoqcso osuosqoc
osuosqco osuosoqc osuosocq osuoscoq osuoscqo osuoosqc osuooscq osuooqsc osuooqcs osuoocqs osuoocsq
osuocsoq osuocsqo osuocosq osuocoqs osuocqos osuocqso osuqosoc osuqosco osuqoosc osuqoocs osuqocos
osuqocso osuqsooc osuqsoco osuqsooc osuqsoco osuqscoo osuqscoo osuqosoc osuqosco osuqoosc osuqoocs
osuqocos osuqocso osuqcsoo osuqcsoo osuqcoso osuqcoos osuqcoos osuqcoso osusqooc osusqoco osusqooc
osusqoco osusqcoo osusqcoo osusoqoc osusoqco osusooqc osusoocq osusocoq osusocqo osusooqc osusoocq
osusoqoc osusoqco osusocqo osusocoq osuscooq osuscoqo osuscooq osuscoqo osuscqoo osuscqoo osuoqsoc
osuoqsco osuoqosc osuoqocs osuoqcos osuoqcso osuosqoc osuosqco osuosoqc osuosocq osuoscoq osuoscqo
osuoosqc osuooscq osuooqsc osuooqcs osuoocqs osuoocsq osuocsoq osuocsqo osuocosq osuocoqs osuocqos
osuocqso osucqsoo osucqsoo osucqoso osucqoos osucqoos osucqoso osucsqoo osucsqoo osucsoqo osucsooq
osucsooq osucsoqo osucosqo osucosoq osucoqso osucoqos osucooqs osucoosq osucosoq osucosqo osucoosq
osucooqs osucoqos osucoqso osouqsoc osouqsco osouqosc osouqocs osouqcos osouqcso osousqoc osousqco
osousoqc osousocq osouscoq osouscqo osouosqc osouoscq osouoqsc osouoqcs osouocqs osouocsq osoucsoq
osoucsqo osoucosq osoucoqs osoucqos osoucqso osoqusoc osoqusco osoquosc osoquocs osoqucos osoqucso
osoqsuoc osoqsuco osoqsouc osoqsocu osoqscou osoqscuo osoqosuc osoqoscu osoqousc osoqoucs osoqocus
osoqocsu osoqcsou osoqcsuo osoqcosu osoqcous osoqcuos osoqcuso ososquoc ososquco ososqouc ososqocu
ososqcou ososqcuo ososuqoc ososuqco ososuoqc ososuocq ososucoq ososucqo ososouqc ososoucq ososoquc
ososoqcu ososocqu ososocuq ososcuoq ososcuqo ososcouq ososcoqu ososcqou ososcquo osooqsuc osooqscu
osooqusc osooqucs osooqcus osooqcsu osoosquc osoosqcu osoosuqc osoosucq osooscuq osooscqu osoousqc
osoouscq osoouqsc osoouqcs osooucqs osooucsq osoocsuq osoocsqu osoocusq osoocuqs osoocqus osoocqsu
osocqsou osocqsuo osocqosu osocqous osocquos osocquso osocsqou osocsquo osocsoqu osocsouq osocsuoq
osocsuqo osocosqu osocosuq osocoqsu osocoqus osocouqs osocousq osocusoq osocusqo osocuosq osocuoqs
osocuqos osocuqso osqousoc osqousco osqouosc osqouocs osqoucos osqoucso osqosuoc osqosuco osqosouc
osqosocu osqoscou osqoscuo osqoosuc osqooscu osqoousc osqooucs osqoocus osqoocsu osqocsou osqocsuo
osqocosu osqocous osqocuos osqocuso osquosoc osquosco osquoosc osquoocs osquocos osquocso osqusooc
osqusoco osqusooc osqusoco osquscoo osquscoo osquosoc osquosco osquoosc osquoocs osquocos osquocso
osqucsoo osqucsoo osqucoso osqucoos osqucoos osqucoso osqsuooc osqsuoco osqsuooc osqsuoco osqsucoo
osqsucoo osqsouoc osqsouco osqsoouc osqsoocu osqsocou osqsocuo osqsoouc osqsoocu osqsouoc osqsouco
osqsocuo osqsocou osqscoou osqscouo osqscoou osqscouo osqscuoo osqscuoo osqousoc osqousco osqouosc
osqouocs osqoucos osqoucso osqosuoc osqosuco osqosouc osqosocu osqoscou osqoscuo osqoosuc osqooscu
osqoousc osqooucs osqoocus osqoocsu osqocsou osqocsuo osqocosu osqocous osqocuos osqocuso osqcusoo
osqcusoo osqcuoso osqcuoos osqcuoos osqcuoso osqcsuoo osqcsuoo osqcsouo osqcsoou osqcsoou osqcsouo
osqcosuo osqcosou osqcouso osqcouos osqcoous osqcoosu osqcosou osqcosuo osqcoosu osqcoous osqcouos
osqcouso ossoquoc ossoquco ossoqouc ossoqocu ossoqcou ossoqcuo ossouqoc ossouqco ossouoqc ossouocq
ossoucoq ossoucqo ossoouqc ossooucq ossooquc ossooqcu ossoocqu ossoocuq ossocuoq ossocuqo ossocouq
ossocoqu ossocqou ossocquo ossqouoc ossqouco ossqoouc ossqoocu ossqocou ossqocuo ossquooc ossquoco
ossquooc ossquoco ossqucoo ossqucoo ossqouoc ossqouco ossqoouc ossqoocu ossqocou ossqocuo ossqcuoo
ossqcuoo ossqcouo ossqcoou ossqcoou ossqcouo ossuqooc ossuqoco ossuqooc ossuqoco ossuqcoo ossuqcoo
ossuoqoc ossuoqco ossuooqc ossuoocq ossuocoq ossuocqo ossuooqc ossuoocq ossuoqoc ossuoqco ossuocqo
ossuocoq ossucooq ossucoqo ossucooq ossucoqo ossucqoo ossucqoo ossoquoc ossoquco ossoqouc ossoqocu
ossoqcou ossoqcuo ossouqoc ossouqco ossouoqc ossouocq ossoucoq ossoucqo ossoouqc ossooucq ossooquc
ossooqcu ossoocqu ossoocuq ossocuoq ossocuqo ossocouq ossocoqu ossocqou ossocquo osscquoo osscquoo
osscqouo osscqoou osscqoou osscqouo osscuqoo osscuqoo osscuoqo osscuooq osscuooq osscuoqo osscouqo
osscouoq osscoquo osscoqou osscooqu osscoouq osscouoq osscouqo osscoouq osscooqu osscoqou osscoquo
osooqsuc osooqscu osooqusc osooqucs osooqcus osooqcsu osoosquc osoosqcu osoosuqc osoosucq osooscuq
osooscqu osoousqc osoouscq osoouqsc osoouqcs osooucqs osooucsq osoocsuq osoocsqu osoocusq osoocuqs
osoocqus osoocqsu osoqosuc osoqoscu osoqousc osoqoucs osoqocus osoqocsu osoqsouc osoqsocu osoqsuoc
osoqsuco osoqscuo osoqscou osoqusoc osoqusco osoquosc osoquocs osoqucos osoqucso osoqcsuo osoqcsou
osoqcuso osoqcuos osoqcous osoqcosu ososqouc ososqocu ososquoc ososquco ososqcuo ososqcou ososoquc
ososoqcu ososouqc ososoucq ososocuq ososocqu ososuoqc ososuocq ososuqoc ososuqco ososucqo ososucoq
ososcouq ososcoqu ososcuoq ososcuqo ososcquo ososcqou osouqsoc osouqsco osouqosc osouqocs osouqcos
osouqcso osousqoc osousqco osousoqc osousocq osouscoq osouscqo osouosqc osouoscq osouoqsc osouoqcs
osouocqs osouocsq osoucsoq osoucsqo osoucosq osoucoqs osoucqos osoucqso osocqsuo osocqsou osocquso
osocquos osocqous osocqosu osocsquo osocsqou osocsuqo osocsuoq osocsouq osocsoqu osocusqo osocusoq
osocuqso osocuqos osocuoqs osocuosq osocosuq osocosqu osocousq osocouqs osocoqus osocoqsu oscoqsou
oscoqsuo oscoqosu oscoqous oscoquos oscoquso oscosqou oscosquo oscosoqu oscosouq oscosuoq oscosuqo
oscoosqu oscoosuq oscooqsu oscooqus oscoouqs oscoousq oscousoq oscousqo oscouosq oscouoqs oscouqos
oscouqso oscqosou oscqosuo oscqoosu oscqoous oscqouos oscqouso oscqsoou oscqsouo oscqsoou oscqsouo
oscqsuoo oscqsuoo oscqosou oscqosuo oscqoosu oscqoous oscqouos oscqouso oscqusoo oscqusoo oscquoso
oscquoos oscquoos oscquoso oscsqoou oscsqouo oscsqoou oscsqouo oscsquoo oscsquoo oscsoqou oscsoquo
oscsooqu oscsoouq oscsouoq oscsouqo oscsooqu oscsoouq oscsoqou oscsoquo oscsouqo oscsouoq oscsuooq
oscsuoqo oscsuooq oscsuoqo oscsuqoo oscsuqoo oscoqsou oscoqsuo oscoqosu oscoqous oscoquos oscoquso
oscosqou oscosquo oscosoqu oscosouq oscosuoq oscosuqo oscoosqu oscoosuq oscooqsu oscooqus oscoouqs
oscoousq oscousoq oscousqo oscouosq oscouoqs oscouqos oscouqso oscuqsoo oscuqsoo oscuqoso oscuqoos
oscuqoos oscuqoso oscusqoo oscusqoo oscusoqo oscusooq oscusooq oscusoqo oscuosqo oscuosoq oscuoqso
oscuoqos oscuooqs oscuoosq oscuosoq oscuosqo oscuoosq oscuooqs oscuoqos oscuoqso osuosqoc osuosqco
osuosoqc osuosocq osuoscoq osuoscqo osuoqsoc osuoqsco osuoqosc osuoqocs osuoqcos osuoqcso osuooqsc
osuooqcs osuoosqc osuooscq osuoocsq osuoocqs osuocqos osuocqso osuocoqs osuocosq osuocsoq osuocsqo
osusoqoc osusoqco osusooqc osusoocq osusocoq osusocqo osusqooc osusqoco osusqooc osusqoco osusqcoo
osusqcoo osusoqoc osusoqco osusooqc osusoocq osusocoq osusocqo osuscqoo osuscqoo osuscoqo osuscooq
osuscooq osuscoqo osuqsooc osuqsoco osuqsooc osuqsoco osuqscoo osuqscoo osuqosoc osuqosco osuqoosc
osuqoocs osuqocos osuqocso osuqoosc osuqoocs osuqosoc osuqosco osuqocso osuqocos osuqcoos osuqcoso
osuqcoos osuqcoso osuqcsoo osuqcsoo osuosqoc osuosqco osuosoqc osuosocq osuoscoq osuoscqo osuoqsoc
osuoqsco osuoqosc osuoqocs osuoqcos osuoqcso osuooqsc osuooqcs osuoosqc osuooscq osuoocsq osuoocqs
osuocqos osuocqso osuocoqs osuocosq osuocsoq osuocsqo osucsqoo osucsqoo osucsoqo osucsooq osucsooq
osucsoqo osucqsoo osucqsoo osucqoso osucqoos osucqoos osucqoso osucoqso osucoqos osucosqo osucosoq
osucoosq osucooqs osucoqos osucoqso osucooqs osucoosq osucosoq osucosqo osousqoc osousqco osousoqc
osousocq osouscoq osouscqo osouqsoc osouqsco osouqosc osouqocs osouqcos osouqcso osouoqsc osouoqcs
osouosqc osouoscq osouocsq osouocqs osoucqos osoucqso osoucoqs osoucosq osoucsoq osoucsqo ososuqoc
ososuqco ososuoqc ososuocq ososucoq ososucqo ososquoc ososquco ososqouc ososqocu ososqcou ososqcuo
ososoquc ososoqcu ososouqc ososoucq ososocuq ososocqu ososcqou ososcquo ososcoqu ososcouq ososcuoq
ososcuqo osoqsuoc osoqsuco osoqsouc osoqsocu osoqscou osoqscuo osoqusoc osoqusco osoquosc osoquocs
osoqucos osoqucso osoqousc osoqoucs osoqosuc osoqoscu osoqocsu osoqocus osoqcuos osoqcuso osoqcous
osoqcosu osoqcsou osoqcsuo osoosquc osoosqcu osoosuqc osoosucq osooscuq osooscqu osooqsuc osooqscu
osooqusc osooqucs osooqcus osooqcsu osoouqsc osoouqcs osoousqc osoouscq osooucsq osooucqs osoocqus
osoocqsu osoocuqs osoocusq osoocsuq osoocsqu osocsqou osocsquo osocsoqu osocsouq osocsuoq osocsuqo
osocqsou osocqsuo osocqosu osocqous osocquos osocquso osocoqsu osocoqus osocosqu osocosuq osocousq
osocouqs osocuqos osocuqso osocuoqs osocuosq osocusoq osocusqo ossouqoc ossouqco ossouoqc ossouocq
ossoucoq ossoucqo ossoquoc ossoquco ossoqouc ossoqocu ossoqcou ossoqcuo ossooquc ossooqcu ossoouqc
ossooucq ossoocuq ossoocqu ossocqou ossocquo ossocoqu ossocouq ossocuoq ossocuqo ossuoqoc ossuoqco
ossuooqc ossuoocq ossuocoq ossuocqo ossuqooc ossuqoco ossuqooc ossuqoco ossuqcoo ossuqcoo ossuoqoc
ossuoqco ossuooqc ossuoocq ossuocoq ossuocqo ossucqoo ossucqoo ossucoqo ossucooq ossucooq ossucoqo
ossquooc ossquoco ossquooc ossquoco ossqucoo ossqucoo ossqouoc ossqouco ossqoouc ossqoocu ossqocou
ossqocuo ossqoouc ossqoocu ossqouoc ossqouco ossqocuo ossqocou ossqcoou ossqcouo ossqcoou ossqcouo
ossqcuoo ossqcuoo ossouqoc ossouqco ossouoqc ossouocq ossoucoq ossoucqo ossoquoc ossoquco ossoqouc
ossoqocu ossoqcou ossoqcuo ossooquc ossooqcu ossoouqc ossooucq ossoocuq ossoocqu ossocqou ossocquo
ossocoqu ossocouq ossocuoq ossocuqo osscuqoo osscuqoo osscuoqo osscuooq osscuooq osscuoqo osscquoo
osscquoo osscqouo osscqoou osscqoou osscqouo osscoquo osscoqou osscouqo osscouoq osscoouq osscooqu
osscoqou osscoquo osscooqu osscoouq osscouoq osscouqo osqosuoc osqosuco osqosouc osqosocu osqoscou
osqoscuo osqousoc osqousco osqouosc osqouocs osqoucos osqoucso osqoousc osqooucs osqoosuc osqooscu
osqoocsu osqoocus osqocuos osqocuso osqocous osqocosu osqocsou osqocsuo osqsouoc osqsouco osqsoouc
osqsoocu osqsocou osqsocuo osqsuooc osqsuoco osqsuooc osqsuoco osqsucoo osqsucoo osqsouoc osqsouco
osqsoouc osqsoocu osqsocou osqsocuo osqscuoo osqscuoo osqscouo osqscoou osqscoou osqscouo osqusooc
osqusoco osqusooc osqusoco osquscoo osquscoo osquosoc osquosco osquoosc osquoocs osquocos osquocso
osquoosc osquoocs osquosoc osquosco osquocso osquocos osqucoos osqucoso osqucoos osqucoso osqucsoo
osqucsoo osqosuoc osqosuco osqosouc osqosocu osqoscou osqoscuo osqousoc osqousco osqouosc osqouocs
osqoucos osqoucso osqoousc osqooucs osqoosuc osqooscu osqoocsu osqoocus osqocuos osqocuso osqocous
osqocosu osqocsou osqocsuo osqcsuoo osqcsuoo osqcsouo osqcsoou osqcsoou osqcsouo osqcusoo osqcusoo
osqcuoso osqcuoos osqcuoos osqcuoso osqcouso osqcouos osqcosuo osqcosou osqcoosu osqcoous osqcouos
osqcouso osqcoous osqcoosu osqcosou osqcosuo osoosquc osoosqcu osoosuqc osoosucq osooscuq osooscqu
osooqsuc osooqscu osooqusc osooqucs osooqcus osooqcsu osoouqsc osoouqcs osoousqc osoouscq osooucsq
osooucqs osoocqus osoocqsu osoocuqs osoocusq osoocsuq osoocsqu ososoquc ososoqcu ososouqc ososoucq
ososocuq ososocqu ososqouc ososqocu ososquoc ososquco ososqcuo ososqcou ososuqoc ososuqco ososuoqc
ososuocq ososucoq ososucqo ososcquo ososcqou ososcuqo ososcuoq ososcouq ososcoqu osoqsouc osoqsocu
osoqsuoc osoqsuco osoqscuo osoqscou osoqosuc osoqoscu osoqousc osoqoucs osoqocus osoqocsu osoquosc
osoquocs osoqusoc osoqusco osoqucso osoqucos osoqcous osoqcosu osoqcuos osoqcuso osoqcsuo osoqcsou
osousqoc osousqco osousoqc osousocq osouscoq osouscqo osouqsoc osouqsco osouqosc osouqocs osouqcos
osouqcso osouoqsc osouoqcs osouosqc osouoscq osouocsq osouocqs osoucqos osoucqso osoucoqs osoucosq
osoucsoq osoucsqo osocsquo osocsqou osocsuqo osocsuoq osocsouq osocsoqu osocqsuo osocqsou osocquso
osocquos osocqous osocqosu osocuqso osocuqos osocusqo osocusoq osocuosq osocuoqs osocoqus osocoqsu
osocouqs osocousq osocosuq osocosqu oscosqou oscosquo oscosoqu oscosouq oscosuoq oscosuqo oscoqsou
oscoqsuo oscoqosu oscoqous oscoquos oscoquso oscooqsu oscooqus oscoosqu oscoosuq oscoousq oscoouqs
oscouqos oscouqso oscouoqs oscouosq oscousoq oscousqo oscsoqou oscsoquo oscsooqu oscsoouq oscsouoq
oscsouqo oscsqoou oscsqouo oscsqoou oscsqouo oscsquoo oscsquoo oscsoqou oscsoquo oscsooqu oscsoouq
oscsouoq oscsouqo oscsuqoo oscsuqoo oscsuoqo oscsuooq oscsuooq oscsuoqo oscqsoou oscqsouo oscqsoou
oscqsouo oscqsuoo oscqsuoo oscqosou oscqosuo oscqoosu oscqoous oscqouos oscqouso oscqoosu oscqoous
oscqosou oscqosuo oscqouso oscqouos oscquoos oscquoso oscquoos oscquoso oscqusoo oscqusoo oscosqou
oscosquo oscosoqu oscosouq oscosuoq oscosuqo oscoqsou oscoqsuo oscoqosu oscoqous oscoquos oscoquso
oscooqsu oscooqus oscoosqu oscoosuq oscoousq oscoouqs oscouqos oscouqso oscouoqs oscouosq oscousoq
oscousqo oscusqoo oscusqoo oscusoqo oscusooq oscusooq oscusoqo oscuqsoo oscuqsoo oscuqoso oscuqoos
oscuqoos oscuqoso oscuoqso oscuoqos oscuosqo oscuosoq oscuoosq oscuooqs oscuoqos oscuoqso oscuooqs
oscuoosq oscuosoq oscuosqo oouossqc oouosscq oouosqsc oouosqcs oouoscqs oouoscsq oouossqc oouosscq
oouosqsc oouosqcs oouoscqs oouoscsq oouoqssc oouoqscs oouoqssc oouoqscs oouoqcss oouoqcss oouocsqs
oouocssq oouocqss oouocqss oouocsqs oouocssq oousosqc oousoscq oousoqsc oousoqcs oousocqs oousocsq
ooussoqc ooussocq ooussqoc ooussqco oousscqo oousscoq oousqsoc oousqsco oousqosc oousqocs oousqcos
oousqcso oouscsqo oouscsoq oouscqso oouscqos oouscoqs oouscosq ooussoqc ooussocq ooussqoc ooussqco
oousscqo oousscoq oousosqc oousoscq oousoqsc oousoqcs oousocqs oousocsq oousqosc oousqocs oousqsoc
oousqsco oousqcso oousqcos oouscoqs oouscosq oouscqos oouscqso oouscsqo oouscsoq oouqssoc oouqssco
oouqsosc oouqsocs oouqscos oouqscso oouqssoc oouqssco oouqsosc oouqsocs oouqscos oouqscso oouqossc
oouqoscs oouqossc oouqoscs oouqocss oouqocss oouqcsos oouqcsso oouqcoss oouqcoss oouqcsos oouqcsso
ooucssqo ooucssoq ooucsqso ooucsqos ooucsoqs ooucsosq ooucssqo ooucssoq ooucsqso ooucsqos ooucsoqs
ooucsosq ooucqsso ooucqsos ooucqsso ooucqsos ooucqoss ooucqoss ooucosqs ooucossq ooucoqss ooucoqss
ooucosqs ooucossq oooussqc ooousscq ooousqsc ooousqcs ooouscqs ooouscsq oooussqc ooousscq ooousqsc
ooousqcs ooouscqs ooouscsq ooouqssc ooouqscs ooouqssc ooouqscs ooouqcss ooouqcss oooucsqs oooucssq
oooucqss oooucqss oooucsqs oooucssq ooosusqc ooosuscq ooosuqsc ooosuqcs ooosucqs ooosucsq ooossuqc
ooossucq ooossquc ooossqcu ooosscqu ooosscuq ooosqsuc ooosqscu ooosqusc ooosqucs ooosqcus ooosqcsu
oooscsqu oooscsuq oooscqsu oooscqus oooscuqs oooscusq ooossuqc ooossucq ooossquc ooossqcu ooosscqu
ooosscuq ooosusqc ooosuscq ooosuqsc ooosuqcs ooosucqs ooosucsq ooosqusc ooosqucs ooosqsuc ooosqscu
ooosqcsu ooosqcus oooscuqs oooscusq oooscqus oooscqsu oooscsqu oooscsuq oooqssuc oooqsscu oooqsusc
oooqsucs oooqscus oooqscsu oooqssuc oooqsscu oooqsusc oooqsucs oooqscus oooqscsu oooqussc oooquscs
oooqussc oooquscs oooqucss oooqucss oooqcsus oooqcssu oooqcuss oooqcuss oooqcsus oooqcssu ooocssqu
ooocssuq ooocsqsu ooocsqus ooocsuqs ooocsusq ooocssqu ooocssuq ooocsqsu ooocsqus ooocsuqs ooocsusq
ooocqssu ooocqsus ooocqssu ooocqsus ooocquss ooocquss ooocusqs ooocussq ooocuqss ooocuqss ooocusqs
ooocussq oosousqc oosouscq oosouqsc oosouqcs oosoucqs oosoucsq oososuqc oososucq oososquc oososqcu
oososcqu oososcuq oosoqsuc oosoqscu oosoqusc oosoqucs oosoqcus oosoqcsu oosocsqu oosocsuq oosocqsu
oosocqus oosocuqs oosocusq oosuosqc oosuoscq oosuoqsc oosuoqcs oosuocqs oosuocsq oosusoqc oosusocq
oosusqoc oosusqco oosuscqo oosuscoq oosuqsoc oosuqsco oosuqosc oosuqocs oosuqcos oosuqcso oosucsqo
oosucsoq oosucqso oosucqos oosucoqs oosucosq oossuoqc oossuocq oossuqoc oossuqco oossucqo oossucoq
oossouqc oossoucq oossoquc oossoqcu oossocqu oossocuq oossqouc oossqocu oossquoc oossquco oossqcuo
oossqcou oosscoqu oosscouq oosscqou oosscquo oosscuqo oosscuoq oosqusoc oosqusco oosquosc oosquocs
oosqucos oosqucso oosqsuoc oosqsuco oosqsouc oosqsocu oosqscou oosqscuo oosqosuc oosqoscu oosqousc
oosqoucs oosqocus oosqocsu oosqcsou oosqcsuo oosqcosu oosqcous oosqcuos oosqcuso ooscusqo ooscusoq
ooscuqso ooscuqos ooscuoqs ooscuosq ooscsuqo ooscsuoq ooscsquo ooscsqou ooscsoqu ooscsouq ooscqsuo
ooscqsou ooscquso ooscquos ooscqous ooscqosu ooscosqu ooscosuq ooscoqsu ooscoqus ooscouqs ooscousq
oososuqc oososucq oososquc oososqcu oososcqu oososcuq oosousqc oosouscq oosouqsc oosouqcs oosoucqs
oosoucsq oosoqusc oosoqucs oosoqsuc oosoqscu oosoqcsu oosoqcus oosocuqs oosocusq oosocqus oosocqsu
oosocsqu oosocsuq oossouqc oossoucq oossoquc oossoqcu oossocqu oossocuq oossuoqc oossuocq oossuqoc
oossuqco oossucqo oossucoq oossquoc oossquco oossqouc oossqocu oossqcou oossqcuo oosscuqo oosscuoq
oosscquo oosscqou oosscoqu oosscouq oosusoqc oosusocq oosusqoc oosusqco oosuscqo oosuscoq oosuosqc
oosuoscq oosuoqsc oosuoqcs oosuocqs oosuocsq oosuqosc oosuqocs oosuqsoc oosuqsco oosuqcso oosuqcos
oosucoqs oosucosq oosucqos oosucqso oosucsqo oosucsoq oosqsuoc oosqsuco oosqsouc oosqsocu oosqscou
oosqscuo oosqusoc oosqusco oosquosc oosquocs oosqucos oosqucso oosqousc oosqoucs oosqosuc oosqoscu
oosqocsu oosqocus oosqcuos oosqcuso oosqcous oosqcosu oosqcsou oosqcsuo ooscsuqo ooscsuoq ooscsquo
ooscsqou ooscsoqu ooscsouq ooscusqo ooscusoq ooscuqso ooscuqos ooscuoqs ooscuosq ooscquso ooscquos
ooscqsuo ooscqsou ooscqosu ooscqous ooscouqs ooscousq ooscoqus ooscoqsu ooscosqu ooscosuq ooqossuc
ooqosscu ooqosusc ooqosucs ooqoscus ooqoscsu ooqossuc ooqosscu ooqosusc ooqosucs ooqoscus ooqoscsu
ooqoussc ooqouscs ooqoussc ooqouscs ooqoucss ooqoucss ooqocsus ooqocssu ooqocuss ooqocuss ooqocsus
ooqocssu ooqsosuc ooqsoscu ooqsousc ooqsoucs ooqsocus ooqsocsu ooqssouc ooqssocu ooqssuoc ooqssuco
ooqsscuo ooqsscou ooqsusoc ooqsusco ooqsuosc ooqsuocs ooqsucos ooqsucso ooqscsuo ooqscsou ooqscuso
ooqscuos ooqscous ooqscosu ooqssouc ooqssocu ooqssuoc ooqssuco ooqsscuo ooqsscou ooqsosuc ooqsoscu
ooqsousc ooqsoucs ooqsocus ooqsocsu ooqsuosc ooqsuocs ooqsusoc ooqsusco ooqsucso ooqsucos ooqscous
ooqscosu ooqscuos ooqscuso ooqscsuo ooqscsou ooqussoc ooqussco ooqusosc ooqusocs ooquscos ooquscso
ooqussoc ooqussco ooqusosc ooqusocs ooquscos ooquscso ooquossc ooquoscs ooquossc ooquoscs ooquocss
ooquocss ooqucsos ooqucsso ooqucoss ooqucoss ooqucsos ooqucsso ooqcssuo ooqcssou ooqcsuso ooqcsuos
ooqcsous ooqcsosu ooqcssuo ooqcssou ooqcsuso ooqcsuos ooqcsous ooqcsosu ooqcusso ooqcusos ooqcusso
ooqcusos ooqcuoss ooqcuoss ooqcosus ooqcossu ooqcouss ooqcouss ooqcosus ooqcossu oocossqu oocossuq
oocosqsu oocosqus oocosuqs oocosusq oocossqu oocossuq oocosqsu oocosqus oocosuqs oocosusq oocoqssu
oocoqsus oocoqssu oocoqsus oocoquss oocoquss oocousqs oocoussq oocouqss oocouqss oocousqs oocoussq
oocsosqu oocsosuq oocsoqsu oocsoqus oocsouqs oocsousq oocssoqu oocssouq oocssqou oocssquo oocssuqo
oocssuoq oocsqsou oocsqsuo oocsqosu oocsqous oocsquos oocsquso oocsusqo oocsusoq oocsuqso oocsuqos
oocsuoqs oocsuosq oocssoqu oocssouq oocssqou oocssquo oocssuqo oocssuoq oocsosqu oocsosuq oocsoqsu
oocsoqus oocsouqs oocsousq oocsqosu oocsqous oocsqsou oocsqsuo oocsquso oocsquos oocsuoqs oocsuosq
oocsuqos oocsuqso oocsusqo oocsusoq oocqssou oocqssuo oocqsosu oocqsous oocqsuos oocqsuso oocqssou
oocqssuo oocqsosu oocqsous oocqsuos oocqsuso oocqossu oocqosus oocqossu oocqosus oocqouss oocqouss
oocqusos oocqusso oocquoss oocquoss oocqusos oocqusso oocussqo oocussoq oocusqso oocusqos oocusoqs
oocusosq oocussqo oocussoq oocusqso oocusqos oocusoqs oocusosq oocuqsso oocuqsos oocuqsso oocuqsos
oocuqoss oocuqoss oocuosqs oocuossq oocuoqss oocuoqss oocuosqs oocuossq ocuossoq ocuossqo ocuososq
ocuosoqs ocuosqos ocuosqso ocuossoq ocuossqo ocuososq ocuosoqs ocuosqos ocuosqso ocuoossq ocuoosqs
ocuoossq ocuoosqs ocuooqss ocuooqss ocuoqsos ocuoqsso ocuoqoss ocuoqoss ocuoqsos ocuoqsso ocusosoq
ocusosqo ocusoosq ocusooqs ocusoqos ocusoqso ocussooq ocussoqo ocussooq ocussoqo ocussqoo ocussqoo
ocusosoq ocusosqo ocusoosq ocusooqs ocusoqos ocusoqso ocusqsoo ocusqsoo ocusqoso ocusqoos ocusqoos
ocusqoso ocussooq ocussoqo ocussooq ocussoqo ocussqoo ocussqoo ocusosoq ocusosqo ocusoosq ocusooqs
ocusoqos ocusoqso ocusoosq ocusooqs ocusosoq ocusosqo ocusoqso ocusoqos ocusqoos ocusqoso ocusqoos
ocusqoso ocusqsoo ocusqsoo ocuossoq ocuossqo ocuososq ocuosoqs ocuosqos ocuosqso ocuossoq ocuossqo
ocuososq ocuosoqs ocuosqos ocuosqso ocuoossq ocuoosqs ocuoossq ocuoosqs ocuooqss ocuooqss ocuoqsos
ocuoqsso ocuoqoss ocuoqoss ocuoqsos ocuoqsso ocuqssoo ocuqssoo ocuqsoso ocuqsoos ocuqsoos ocuqsoso
ocuqssoo ocuqssoo ocuqsoso ocuqsoos ocuqsoos ocuqsoso ocuqosso ocuqosos ocuqosso ocuqosos ocuqooss
ocuqooss ocuqosos ocuqosso ocuqooss ocuqooss ocuqosos ocuqosso ocoussoq ocoussqo ocousosq ocousoqs
ocousqos ocousqso ocoussoq ocoussqo ocousosq ocousoqs ocousqos ocousqso ocouossq ocouosqs ocouossq
ocouosqs ocouoqss ocouoqss ocouqsos ocouqsso ocouqoss ocouqoss ocouqsos ocouqsso ocosusoq ocosusqo
ocosuosq ocosuoqs ocosuqos ocosuqso ocossuoq ocossuqo ocossouq ocossoqu ocossqou ocossquo ocososuq
ocososqu ocosousq ocosouqs ocosoqus ocosoqsu ocosqsou ocosqsuo ocosqosu ocosqous ocosquos ocosquso
ocossuoq ocossuqo ocossouq ocossoqu ocossqou ocossquo ocosusoq ocosusqo ocosuosq ocosuoqs ocosuqos
ocosuqso ocosousq ocosouqs ocososuq ocososqu ocosoqsu ocosoqus ocosquos ocosquso ocosqous ocosqosu
ocosqsou ocosqsuo ocoossuq ocoossqu ocoosusq ocoosuqs ocoosqus ocoosqsu ocoossuq ocoossqu ocoosusq
ocoosuqs ocoosqus ocoosqsu ocooussq ocoousqs ocooussq ocoousqs ocoouqss ocoouqss ocooqsus ocooqssu
ocooquss ocooquss ocooqsus ocooqssu ocoqssou ocoqssuo ocoqsosu ocoqsous ocoqsuos ocoqsuso ocoqssou
ocoqssuo ocoqsosu ocoqsous ocoqsuos ocoqsuso ocoqossu ocoqosus ocoqossu ocoqosus ocoqouss ocoqouss
ocoqusos ocoqusso ocoquoss ocoquoss ocoqusos ocoqusso ocsousoq ocsousqo ocsouosq ocsouoqs ocsouqos
ocsouqso ocsosuoq ocsosuqo ocsosouq ocsosoqu ocsosqou ocsosquo ocsoosuq ocsoosqu ocsoousq ocsoouqs
ocsooqus ocsooqsu ocsoqsou ocsoqsuo ocsoqosu ocsoqous ocsoquos ocsoquso ocsuosoq ocsuosqo ocsuoosq
ocsuooqs ocsuoqos ocsuoqso ocsusooq ocsusoqo ocsusooq ocsusoqo ocsusqoo ocsusqoo ocsuosoq ocsuosqo
ocsuoosq ocsuooqs ocsuoqos ocsuoqso ocsuqsoo ocsuqsoo ocsuqoso ocsuqoos ocsuqoos ocsuqoso ocssuooq
ocssuoqo ocssuooq ocssuoqo ocssuqoo ocssuqoo ocssouoq ocssouqo ocssoouq ocssooqu ocssoqou ocssoquo
ocssoouq ocssooqu ocssouoq ocssouqo ocssoquo ocssoqou ocssqoou ocssqouo ocssqoou ocssqouo ocssquoo
ocssquoo ocsousoq ocsousqo ocsouosq ocsouoqs ocsouqos ocsouqso ocsosuoq ocsosuqo ocsosouq ocsosoqu
ocsosqou ocsosquo ocsoosuq ocsoosqu ocsoousq ocsoouqs ocsooqus ocsooqsu ocsoqsou ocsoqsuo ocsoqosu
ocsoqous ocsoquos ocsoquso ocsqusoo ocsqusoo ocsquoso ocsquoos ocsquoos ocsquoso ocsqsuoo ocsqsuoo
ocsqsouo ocsqsoou ocsqsoou ocsqsouo ocsqosuo ocsqosou ocsqouso ocsqouos ocsqoous ocsqoosu ocsqosou
ocsqosuo ocsqoosu ocsqoous ocsqouos ocsqouso ocsosuoq ocsosuqo ocsosouq ocsosoqu ocsosqou ocsosquo
ocsousoq ocsousqo ocsouosq ocsouoqs ocsouqos ocsouqso ocsoousq ocsoouqs ocsoosuq ocsoosqu ocsooqsu
ocsooqus ocsoquos ocsoquso ocsoqous ocsoqosu ocsoqsou ocsoqsuo ocssouoq ocssouqo ocssoouq ocssooqu
ocssoqou ocssoquo ocssuooq ocssuoqo ocssuooq ocssuoqo ocssuqoo ocssuqoo ocssouoq ocssouqo ocssoouq
ocssooqu ocssoqou ocssoquo ocssquoo ocssquoo ocssqouo ocssqoou ocssqoou ocssqouo ocsusooq ocsusoqo
ocsusooq ocsusoqo ocsusqoo ocsusqoo ocsuosoq ocsuosqo ocsuoosq ocsuooqs ocsuoqos ocsuoqso ocsuoosq
ocsuooqs ocsuosoq ocsuosqo ocsuoqso ocsuoqos ocsuqoos ocsuqoso ocsuqoos ocsuqoso ocsuqsoo ocsuqsoo
ocsosuoq ocsosuqo ocsosouq ocsosoqu ocsosqou ocsosquo ocsousoq ocsousqo ocsouosq ocsouoqs ocsouqos
ocsouqso ocsoousq ocsoouqs ocsoosuq ocsoosqu ocsooqsu ocsooqus ocsoquos ocsoquso ocsoqous ocsoqosu
ocsoqsou ocsoqsuo ocsqsuoo ocsqsuoo ocsqsouo ocsqsoou ocsqsoou ocsqsouo ocsqusoo ocsqusoo ocsquoso
ocsquoos ocsquoos ocsquoso ocsqouso ocsqouos ocsqosuo ocsqosou ocsqoosu ocsqoous ocsqouos ocsqouso
ocsqoous ocsqoosu ocsqosou ocsqosuo ocoossuq ocoossqu ocoosusq ocoosuqs ocoosqus ocoosqsu ocoossuq
ocoossqu ocoosusq ocoosuqs ocoosqus ocoosqsu ocooussq ocoousqs ocooussq ocoousqs ocoouqss ocoouqss
ocooqsus ocooqssu ocooquss ocooquss ocooqsus ocooqssu ocososuq ocososqu ocosousq ocosouqs ocosoqus
ocosoqsu ocossouq ocossoqu ocossuoq ocossuqo ocossquo ocossqou ocosusoq ocosusqo ocosuosq ocosuoqs
ocosuqos ocosuqso ocosqsuo ocosqsou ocosquso ocosquos ocosqous ocosqosu ocossouq ocossoqu ocossuoq
ocossuqo ocossquo ocossqou ocososuq ocososqu ocosousq ocosouqs ocosoqus ocosoqsu ocosuosq ocosuoqs
ocosusoq ocosusqo ocosuqso ocosuqos ocosqous ocosqosu ocosquos ocosquso ocosqsuo ocosqsou ocoussoq
ocoussqo ocousosq ocousoqs ocousqos ocousqso ocoussoq ocoussqo ocousosq ocousoqs ocousqos ocousqso
ocouossq ocouosqs ocouossq ocouosqs ocouoqss ocouoqss ocouqsos ocouqsso ocouqoss ocouqoss ocouqsos
ocouqsso ocoqssuo ocoqssou ocoqsuso ocoqsuos ocoqsous ocoqsosu ocoqssuo ocoqssou ocoqsuso ocoqsuos
ocoqsous ocoqsosu ocoqusso ocoqusos ocoqusso ocoqusos ocoquoss ocoquoss ocoqosus ocoqossu ocoqouss
ocoqouss ocoqosus ocoqossu ocqossou ocqossuo ocqososu ocqosous ocqosuos ocqosuso ocqossou ocqossuo
ocqososu ocqosous ocqosuos ocqosuso ocqoossu ocqoosus ocqoossu ocqoosus ocqoouss ocqoouss ocqousos
ocqousso ocqouoss ocqouoss ocqousos ocqousso ocqsosou ocqsosuo ocqsoosu ocqsoous ocqsouos ocqsouso
ocqssoou ocqssouo ocqssoou ocqssouo ocqssuoo ocqssuoo ocqsosou ocqsosuo ocqsoosu ocqsoous ocqsouos
ocqsouso ocqsusoo ocqsusoo ocqsuoso ocqsuoos ocqsuoos ocqsuoso ocqssoou ocqssouo ocqssoou ocqssouo
ocqssuoo ocqssuoo ocqsosou ocqsosuo ocqsoosu ocqsoous ocqsouos ocqsouso ocqsoosu ocqsoous ocqsosou
ocqsosuo ocqsouso ocqsouos ocqsuoos ocqsuoso ocqsuoos ocqsuoso ocqsusoo ocqsusoo ocqossou ocqossuo
ocqososu ocqosous ocqosuos ocqosuso ocqossou ocqossuo ocqososu ocqosous ocqosuos ocqosuso ocqoossu
ocqoosus ocqoossu ocqoosus ocqoouss ocqoouss ocqousos ocqousso ocqouoss ocqouoss ocqousos ocqousso
ocqussoo ocqussoo ocqusoso ocqusoos ocqusoos ocqusoso ocqussoo ocqussoo ocqusoso ocqusoos ocqusoos
ocqusoso ocquosso ocquosos ocquosso ocquosos ocquooss ocquooss ocquosos ocquosso ocquooss ocquooss
ocquosos ocquosso

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us