easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

wolfer

outman

turfosa

seabolt

crowstepped

respiciebatque

intros

woronicz

vizslas

lockleaze

revampers

advance

temptaremusque

woodrome

wycoff

zobtenite

refusive

unperseveringly


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: occurrensque
cipher variations:
pddvssfotrvf qeewttgpuswg rffxuuhqvtxh sggyvvirwuyi thhzwwjsxvzj
uiiaxxktywak vjjbyyluzxbl wkkczzmvaycm xlldaanwbzdn ymmebboxcaeo
znnfccpydbfp aoogddqzecgq bppheerafdhr cqqiffsbgeis drrjggtchfjt
esskhhudigku fttliivejhlv guumjjwfkimw hvvnkkxgljnx iwwollyhmkoy
jxxpmmzinlpz kyyqnnajomqa lzzroobkpnrb maasppclqosc nbbtqqdmrptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: occurrensque
Cipher: lxxfiivmhjfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: occurrensque
Cipher: ABBAB AAABA AAABA BAABB BAAAA BAAAA AABAA ABBAA BAAAB ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: occurrensque
cipher variations:
pddvssfotrvfrhhjaanodxjntllxiivondxvvpplqqdoxjldxttzyylohpzlzxxnggtorvntdffpwwjolhpjfjjdeerovndr
hnnrmmzoftrzjrrfuuhopzfhlvvtccpozftpnzzhkkxojlhxqeewttgpuswgsiikbbopeykoummyjjwpoeywwqqmrrepykme
yuuazzmpiqamayyohhupswoueggqxxkpmiqkgkkeffspwoesioosnnapgusakssgvvipqagimwwuddqpaguqoaaillypkmiy
rffxuuhqvtxhtjjlccpqfzlpvnnzkkxqpfzxxrrnssfqzlnfzvvbaanqjrbnbzzpiivqtxpvfhhryylqnjrlhllfggtqxpft
jpptoobqhvtbltthwwjqrbhjnxxveerqbhvrpbbjmmzqlnjzsggyvvirwuyiukkmddqrgamqwooallyrqgayyssottgramog
awwcbborkscocaaqjjwruyqwgiiszzmroksmimmghhuryqgukqquppcriwucmuuixxkrscikoyywffsrciwsqccknnarmoka
thhzwwjsxvzjvllneershbnrxppbmmzsrhbzzttpuuhsbnphbxxdccpsltdpdbbrkkxsvzrxhjjtaanspltnjnnhiivszrhv
lrrvqqdsjxvdnvvjyylstdjlpzzxggtsdjxtrddloobsnplbuiiaxxktywakwmmoffsticosyqqcnnatsicaauuqvvitcoqi
cyyeddqtmueqeccsllytwasyikkubbotqmuokooijjwtasiwmsswrretkyweowwkzzmtuekmqaayhhutekyuseemppctoqmc
vjjbyyluzxblxnnpggtujdptzrrdoobutjdbbvvrwwjudprjdzzfeerunvfrfddtmmzuxbtzjllvccpurnvplppjkkxubtjx
nttxssfulzxfpxxlaanuvflnrbbziivuflzvtffnqqduprndwkkczzmvaycmyooqhhuvkequasseppcvukeccwwsxxkveqsk
eaagffsvowgsgeeunnavycuakmmwddqvsowqmqqkllyvcukyouuyttgvmaygqyymbbovwgmosccajjwvgmawuggorrevqsoe
xlldaanwbzdnzppriivwlfrvbttfqqdwvlfddxxtyylwfrtlfbbhggtwpxhthffvoobwzdvblnnxeerwtpxrnrrlmmzwdvlz
pvvzuuhwnbzhrzznccpwxhnptddbkkxwhnbxvhhpssfwrtpfymmebboxcaeoaqqsjjwxmgswcuugrrexwmgeeyyuzzmxgsum
gccihhuxqyiuiggwppcxaewcmooyffsxuqysossmnnaxewmaqwwavvixocaisaaoddqxyioqueecllyxiocywiiqttgxsuqg
znnfccpydbfpbrrtkkxynhtxdvvhssfyxnhffzzvaanyhtvnhddjiivyrzjvjhhxqqdybfxdnppzggtyvrztpttnoobyfxnb
rxxbwwjypdbjtbbpeeryzjprvffdmmzyjpdzxjjruuhytvrhaoogddqzecgqcssullyzoiuyewwittgzyoiggaawbboziuwo
ieekjjwzsakwkiiyrrezcgyeoqqahhuzwsauquuoppczgyocsyycxxkzqeckuccqffszakqswggennazkqeaykksvvizuwsi
bppheerafdhrdttvmmzapjvzfxxjuuhazpjhhbbxccpajvxpjfflkkxatblxljjzssfadhzfprrbiivaxtbvrvvpqqdahzpd
tzzdyylarfdlvddrggtablrtxhhfoobalrfbzlltwwjavxtjcqqiffsbgeiseuuwnnabqkwagyykvvibaqkiiccyddqbkwyq
kggmllybucmymkkattgbeiagqsscjjwbyucwswwqrrebiaqeuaaezzmbsgemweeshhubcmsuyiigppcbmsgcammuxxkbwyuk
drrjggtchfjtfvvxoobcrlxbhzzlwwjcbrljjddzeerclxzrlhhnmmzcvdnznllbuuhcfjbhrttdkkxczvdxtxxrssfcjbrf
vbbfaancthfnxfftiivcdntvzjjhqqdcnthdbnnvyylcxzvlesskhhudigkugwwyppcdsmyciaamxxkdcsmkkeeaffsdmyas
miionnadweoaommcvvidgkcisuuellydaweyuyysttgdkcsgwccgbboduigoyggujjwdeouwakkirredouiecoowzzmdyawm
fttliivejhlvhxxzqqdetnzdjbbnyyledtnllffbggtenzbtnjjpoobexfpbpnndwwjehldjtvvfmmzebxfzvzztuuheldth
xddhccpevjhpzhhvkkxefpvxblljssfepvjfdppxaanezbxnguumjjwfkimwiyyarrefuoaekccozzmfeuommggchhufoacu
okkqppcfygqcqooexxkfimekuwwgnnafcygawaauvvifmeuiyeeiddqfwkiqaiiwllyfgqwycmmkttgfqwkgeqqybbofacyo
hvvnkkxgljnxjzzbssfgvpbflddpaangfvpnnhhdiivgpbdvpllrqqdgzhrdrppfyylgjnflvxxhoobgdzhbxbbvwwjgnfvj
zffjeergxljrbjjxmmzghrxzdnnluuhgrxlhfrrzccpgbdzpiwwollyhmkoykaacttghwqcgmeeqbbohgwqooiiejjwhqcew
qmmsrrehaisesqqgzzmhkogmwyyippcheaicyccwxxkhogwkaggkffshymksckkynnahisyaeoomvvihsymigssaddqhceaq
jxxpmmzinlpzlbbduuhixrdhnffrccpihxrppjjfkkxirdfxrnntssfibjtftrrhaanilphnxzzjqqdifbjdzddxyyliphxl
bhhlggtiznltdllzoobijtzbfppnwwjitznjhttbeeridfbrkyyqnnajomqamccevvijyseioggsddqjiysqqkkgllyjsegy
soouttgjckugussibbojmqioyaakrrejgckeaeeyzzmjqiymciimhhujaomuemmappcjkuacgqqoxxkjuaokiuucffsjegcs
lzzroobkpnrbnddfwwjkztfjphhteerkjztrrllhmmzktfhztppvuuhkdlvhvttjccpknrjpzbblssfkhdlfbffzaankrjzn
djjniivkbpnvfnnbqqdklvbdhrrpyylkvbpljvvdggtkfhdtmaasppclqoscoeegxxklaugkqiiuffslkaussmminnalugia
uqqwvvilemwiwuukddqloskqaccmttgliemgcggabbolskaoekkojjwlcqowgoocrrelmwceissqzzmlwcqmkwwehhulgieu
nbbtqqdmrptdpffhyylmbvhlrjjvggtmlbvttnnjoobmvhjbvrrxwwjmfnxjxvvleermptlrbddnuuhmjfnhdhhbccpmtlbp
fllpkkxmdrpxhppdssfmnxdfjttraanmxdrnlxxfiivmhjfvoccurrensqueqggizzmncwimskkwhhunmcwuuookppcnwikc
wssyxxkngoykywwmffsnqumsceeovvinkgoieiicddqnumcqgmmqllynesqyiqqettgnoyegkuusbbonyesomyygjjwnikgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: occurrensque
Cipher: bppheerafdhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: occurrensque
Cipher: 433131542424513334145451

Extended Methods:
Method #1

Plaintext: occurrensque
method variations:
thhzwwksxvzkynnebbpxcaepdsskgguchfkuixxpmmzhnlpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
o c c u r r e n s q u e 
4 3 3 5 2 2 5 3 3 1 5 5 
3 1 1 4 4 4 1 3 4 4 4 1 
They are then read out in rows:
433522533155311444134441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: occurrensque
Cipher: oxgpczcqtltd

Read more ...
Method #3

Plaintext: occurrensque
method variations:
nlviiylndyyq lviiylndyyqn viiylndyyqnl
iiylndyyqnlv iylndyyqnlvi ylndyyqnlvii
lndyyqnlviiy ndyyqnlviiyl dyyqnlviiyln
yyqnlviiylnd yqnlviiylndy qnlviiylndyy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: occurrensque

first 5040 cipher variations(475687488 total)
occurrensque occurrensqeu occurrensuqe occurrensueq occurrenseuq occurrensequ occurrenqsue occurrenqseu occurrenquse
occurrenques occurrenqeus occurrenqesu occurrenuqse occurrenuqes occurrenusqe occurrenuseq occurrenuesq occurrenueqs
occurrenequs occurreneqsu occurreneuqs occurreneusq occurrenesuq occurrenesqu occurresnque occurresnqeu occurresnuqe
occurresnueq occurresneuq occurresnequ occurresqnue occurresqneu occurresqune occurresquen occurresqeun occurresqenu
occurresuqne occurresuqen occurresunqe occurresuneq occurresuenq occurresueqn occurresequn occurreseqnu occurreseuqn
occurreseunq occurresenuq occurresenqu occurreqsnue occurreqsneu occurreqsune occurreqsuen occurreqseun occurreqsenu
occurreqnsue occurreqnseu occurreqnuse occurreqnues occurreqneus occurreqnesu occurrequnse occurrequnes occurrequsne
occurrequsen occurrequesn occurrequens occurreqenus occurreqensu occurreqeuns occurreqeusn occurreqesun occurreqesnu
occurreusqne occurreusqen occurreusnqe occurreusneq occurreusenq occurreuseqn occurreuqsne occurreuqsen occurreuqnse
occurreuqnes occurreuqens occurreuqesn occurreunqse occurreunqes occurreunsqe occurreunseq occurreunesq occurreuneqs
occurreueqns occurreueqsn occurreuenqs occurreuensq occurreuesnq occurreuesqn occurreesqun occurreesqnu occurreesuqn
occurreesunq occurreesnuq occurreesnqu occurreeqsun occurreeqsnu occurreequsn occurreequns occurreeqnus occurreeqnsu
occurreeuqsn occurreeuqns occurreeusqn occurreeusnq occurreeunsq occurreeunqs occurreenqus occurreenqsu occurreenuqs
occurreenusq occurreensuq occurreensqu occurrnesque occurrnesqeu occurrnesuqe occurrnesueq occurrneseuq occurrnesequ
occurrneqsue occurrneqseu occurrnequse occurrneques occurrneqeus occurrneqesu occurrneuqse occurrneuqes occurrneusqe
occurrneuseq occurrneuesq occurrneueqs occurrneequs occurrneeqsu occurrneeuqs occurrneeusq occurrneesuq occurrneesqu
occurrnseque occurrnseqeu occurrnseuqe occurrnseueq occurrnseeuq occurrnseequ occurrnsqeue occurrnsqeeu occurrnsquee
occurrnsquee occurrnsqeue occurrnsqeeu occurrnsuqee occurrnsuqee occurrnsueqe occurrnsueeq occurrnsueeq occurrnsueqe
occurrnseque occurrnseqeu occurrnseuqe occurrnseueq occurrnseeuq occurrnseequ occurrnqseue occurrnqseeu occurrnqsuee
occurrnqsuee occurrnqseue occurrnqseeu occurrnqesue occurrnqeseu occurrnqeuse occurrnqeues occurrnqeeus occurrnqeesu
occurrnquese occurrnquees occurrnqusee occurrnqusee occurrnquese occurrnquees occurrnqeeus occurrnqeesu occurrnqeues
occurrnqeuse occurrnqesue occurrnqeseu occurrnusqee occurrnusqee occurrnuseqe occurrnuseeq occurrnuseeq occurrnuseqe
occurrnuqsee occurrnuqsee occurrnuqese occurrnuqees occurrnuqees occurrnuqese occurrnueqse occurrnueqes occurrnuesqe
occurrnueseq occurrnueesq occurrnueeqs occurrnueqes occurrnueqse occurrnueeqs occurrnueesq occurrnueseq occurrnuesqe
occurrnesque occurrnesqeu occurrnesuqe occurrnesueq occurrneseuq occurrnesequ occurrneqsue occurrneqseu occurrnequse
occurrneques occurrneqeus occurrneqesu occurrneuqse occurrneuqes occurrneusqe occurrneuseq occurrneuesq occurrneueqs
occurrneequs occurrneeqsu occurrneeuqs occurrneeusq occurrneesuq occurrneesqu occurrsneque occurrsneqeu occurrsneuqe
occurrsneueq occurrsneeuq occurrsneequ occurrsnqeue occurrsnqeeu occurrsnquee occurrsnquee occurrsnqeue occurrsnqeeu
occurrsnuqee occurrsnuqee occurrsnueqe occurrsnueeq occurrsnueeq occurrsnueqe occurrsneque occurrsneqeu occurrsneuqe
occurrsneueq occurrsneeuq occurrsneequ occurrsenque occurrsenqeu occurrsenuqe occurrsenueq occurrseneuq occurrsenequ
occurrseqnue occurrseqneu occurrsequne occurrsequen occurrseqeun occurrseqenu occurrseuqne occurrseuqen occurrseunqe
occurrseuneq occurrseuenq occurrseueqn occurrseequn occurrseeqnu occurrseeuqn occurrseeunq occurrseenuq occurrseenqu
occurrsqenue occurrsqeneu occurrsqeune occurrsqeuen occurrsqeeun occurrsqeenu occurrsqneue occurrsqneeu occurrsqnuee
occurrsqnuee occurrsqneue occurrsqneeu occurrsqunee occurrsqunee occurrsquene occurrsqueen occurrsqueen occurrsquene
occurrsqenue occurrsqeneu occurrsqeune occurrsqeuen occurrsqeeun occurrsqeenu occurrsueqne occurrsueqen occurrsuenqe
occurrsueneq occurrsueenq occurrsueeqn occurrsuqene occurrsuqeen occurrsuqnee occurrsuqnee occurrsuqene occurrsuqeen
occurrsunqee occurrsunqee occurrsuneqe occurrsuneeq occurrsuneeq occurrsuneqe occurrsueqne occurrsueqen occurrsuenqe
occurrsueneq occurrsueenq occurrsueeqn occurrseequn occurrseeqnu occurrseeuqn occurrseeunq occurrseenuq occurrseenqu
occurrseqeun occurrseqenu occurrsequen occurrsequne occurrseqnue occurrseqneu occurrseuqen occurrseuqne occurrseueqn
occurrseuenq occurrseuneq occurrseunqe occurrsenque occurrsenqeu occurrsenuqe occurrsenueq occurrseneuq occurrsenequ
occurrqnseue occurrqnseeu occurrqnsuee occurrqnsuee occurrqnseue occurrqnseeu occurrqnesue occurrqneseu occurrqneuse
occurrqneues occurrqneeus occurrqneesu occurrqnuese occurrqnuees occurrqnusee occurrqnusee occurrqnuese occurrqnuees
occurrqneeus occurrqneesu occurrqneues occurrqneuse occurrqnesue occurrqneseu occurrqsneue occurrqsneeu occurrqsnuee
occurrqsnuee occurrqsneue occurrqsneeu occurrqsenue occurrqseneu occurrqseune occurrqseuen occurrqseeun occurrqseenu
occurrqsuene occurrqsueen occurrqsunee occurrqsunee occurrqsuene occurrqsueen occurrqseeun occurrqseenu occurrqseuen
occurrqseune occurrqsenue occurrqseneu occurrqesnue occurrqesneu occurrqesune occurrqesuen occurrqeseun occurrqesenu
occurrqensue occurrqenseu occurrqenuse occurrqenues occurrqeneus occurrqenesu occurrqeunse occurrqeunes occurrqeusne
occurrqeusen occurrqeuesn occurrqeuens occurrqeenus occurrqeensu occurrqeeuns occurrqeeusn occurrqeesun occurrqeesnu
occurrqusene occurrquseen occurrqusnee occurrqusnee occurrqusene occurrquseen occurrquesne occurrquesen occurrquense
occurrquenes occurrqueens occurrqueesn occurrqunese occurrqunees occurrqunsee occurrqunsee occurrqunese occurrqunees
occurrqueens occurrqueesn occurrquenes occurrquense occurrquesne occurrquesen occurrqeseun occurrqesenu occurrqesuen
occurrqesune occurrqesnue occurrqesneu occurrqeesun occurrqeesnu occurrqeeusn occurrqeeuns occurrqeenus occurrqeensu
occurrqeuesn occurrqeuens occurrqeusen occurrqeusne occurrqeunse occurrqeunes occurrqeneus occurrqenesu occurrqenues
occurrqenuse occurrqensue occurrqenseu occurrunsqee occurrunsqee occurrunseqe occurrunseeq occurrunseeq occurrunseqe
occurrunqsee occurrunqsee occurrunqese occurrunqees occurrunqees occurrunqese occurruneqse occurruneqes occurrunesqe
occurruneseq occurruneesq occurruneeqs occurruneqes occurruneqse occurruneeqs occurruneesq occurruneseq occurrunesqe
occurrusnqee occurrusnqee occurrusneqe occurrusneeq occurrusneeq occurrusneqe occurrusqnee occurrusqnee occurrusqene
occurrusqeen occurrusqeen occurrusqene occurruseqne occurruseqen occurrusenqe occurruseneq occurruseenq occurruseeqn
occurruseqen occurruseqne occurruseeqn occurruseenq occurruseneq occurrusenqe occurruqsnee occurruqsnee occurruqsene
occurruqseen occurruqseen occurruqsene occurruqnsee occurruqnsee occurruqnese occurruqnees occurruqnees occurruqnese
occurruqense occurruqenes occurruqesne occurruqesen occurruqeesn occurruqeens occurruqenes occurruqense occurruqeens
occurruqeesn occurruqesen occurruqesne occurruesqne occurruesqen occurruesnqe occurruesneq occurruesenq occurrueseqn
occurrueqsne occurrueqsen occurrueqnse occurrueqnes occurrueqens occurrueqesn occurruenqse occurruenqes occurruensqe
occurruenseq occurruenesq occurrueneqs occurrueeqns occurrueeqsn occurrueenqs occurrueensq occurrueesnq occurrueesqn
occurruesqen occurruesqne occurrueseqn occurruesenq occurruesneq occurruesnqe occurrueqsen occurrueqsne occurrueqesn
occurrueqens occurrueqnes occurrueqnse occurrueeqsn occurrueeqns occurrueesqn occurrueesnq occurrueensq occurrueenqs
occurruenqes occurruenqse occurrueneqs occurruenesq occurruenseq occurruensqe occurrensque occurrensqeu occurrensuqe
occurrensueq occurrenseuq occurrensequ occurrenqsue occurrenqseu occurrenquse occurrenques occurrenqeus occurrenqesu
occurrenuqse occurrenuqes occurrenusqe occurrenuseq occurrenuesq occurrenueqs occurrenequs occurreneqsu occurreneuqs
occurreneusq occurrenesuq occurrenesqu occurresnque occurresnqeu occurresnuqe occurresnueq occurresneuq occurresnequ
occurresqnue occurresqneu occurresqune occurresquen occurresqeun occurresqenu occurresuqne occurresuqen occurresunqe
occurresuneq occurresuenq occurresueqn occurresequn occurreseqnu occurreseuqn occurreseunq occurresenuq occurresenqu
occurreqsnue occurreqsneu occurreqsune occurreqsuen occurreqseun occurreqsenu occurreqnsue occurreqnseu occurreqnuse
occurreqnues occurreqneus occurreqnesu occurrequnse occurrequnes occurrequsne occurrequsen occurrequesn occurrequens
occurreqenus occurreqensu occurreqeuns occurreqeusn occurreqesun occurreqesnu occurreusqne occurreusqen occurreusnqe
occurreusneq occurreusenq occurreuseqn occurreuqsne occurreuqsen occurreuqnse occurreuqnes occurreuqens occurreuqesn
occurreunqse occurreunqes occurreunsqe occurreunseq occurreunesq occurreuneqs occurreueqns occurreueqsn occurreuenqs
occurreuensq occurreuesnq occurreuesqn occurreesqun occurreesqnu occurreesuqn occurreesunq occurreesnuq occurreesnqu
occurreeqsun occurreeqsnu occurreequsn occurreequns occurreeqnus occurreeqnsu occurreeuqsn occurreeuqns occurreeusqn
occurreeusnq occurreeunsq occurreeunqs occurreenqus occurreenqsu occurreenuqs occurreenusq occurreensuq occurreensqu
occurernsque occurernsqeu occurernsuqe occurernsueq occurernseuq occurernsequ occurernqsue occurernqseu occurernquse
occurernques occurernqeus occurernqesu occurernuqse occurernuqes occurernusqe occurernuseq occurernuesq occurernueqs
occurernequs occurerneqsu occurerneuqs occurerneusq occurernesuq occurernesqu occurersnque occurersnqeu occurersnuqe
occurersnueq occurersneuq occurersnequ occurersqnue occurersqneu occurersqune occurersquen occurersqeun occurersqenu
occurersuqne occurersuqen occurersunqe occurersuneq occurersuenq occurersueqn occurersequn occurerseqnu occurerseuqn
occurerseunq occurersenuq occurersenqu occurerqsnue occurerqsneu occurerqsune occurerqsuen occurerqseun occurerqsenu
occurerqnsue occurerqnseu occurerqnuse occurerqnues occurerqneus occurerqnesu occurerqunse occurerqunes occurerqusne
occurerqusen occurerquesn occurerquens occurerqenus occurerqensu occurerqeuns occurerqeusn occurerqesun occurerqesnu
occurerusqne occurerusqen occurerusnqe occurerusneq occurerusenq occureruseqn occureruqsne occureruqsen occureruqnse
occureruqnes occureruqens occureruqesn occurerunqse occurerunqes occurerunsqe occurerunseq occurerunesq occureruneqs
occurerueqns occurerueqsn occureruenqs occureruensq occureruesnq occureruesqn occureresqun occureresqnu occureresuqn
occureresunq occureresnuq occureresnqu occurereqsun occurereqsnu occurerequsn occurerequns occurereqnus occurereqnsu
occurereuqsn occurereuqns occurereusqn occurereusnq occurereunsq occurereunqs occurerenqus occurerenqsu occurerenuqs
occurerenusq occurerensuq occurerensqu occurenrsque occurenrsqeu occurenrsuqe occurenrsueq occurenrseuq occurenrsequ
occurenrqsue occurenrqseu occurenrquse occurenrques occurenrqeus occurenrqesu occurenruqse occurenruqes occurenrusqe
occurenruseq occurenruesq occurenrueqs occurenrequs occurenreqsu occurenreuqs occurenreusq occurenresuq occurenresqu
occurensrque occurensrqeu occurensruqe occurensrueq occurensreuq occurensrequ occurensqrue occurensqreu occurensqure
occurensquer occurensqeur occurensqeru occurensuqre occurensuqer occurensurqe occurensureq occurensuerq occurensueqr
occurensequr occurenseqru occurenseuqr occurenseurq occurenseruq occurenserqu occurenqsrue occurenqsreu occurenqsure
occurenqsuer occurenqseur occurenqseru occurenqrsue occurenqrseu occurenqruse occurenqrues occurenqreus occurenqresu
occurenqurse occurenqures occurenqusre occurenquser occurenquesr occurenquers occurenqerus occurenqersu occurenqeurs
occurenqeusr occurenqesur occurenqesru occurenusqre occurenusqer occurenusrqe occurenusreq occurenuserq occurenuseqr
occurenuqsre occurenuqser occurenuqrse occurenuqres occurenuqers occurenuqesr occurenurqse occurenurqes occurenursqe
occurenurseq occurenuresq occurenureqs occurenueqrs occurenueqsr occurenuerqs occurenuersq occurenuesrq occurenuesqr
occurenesqur occurenesqru occurenesuqr occurenesurq occurenesruq occurenesrqu occureneqsur occureneqsru occurenequsr
occurenequrs occureneqrus occureneqrsu occureneuqsr occureneuqrs occureneusqr occureneusrq occureneursq occureneurqs
occurenerqus occurenerqsu occureneruqs occurenerusq occurenersuq occurenersqu occuresnrque occuresnrqeu occuresnruqe
occuresnrueq occuresnreuq occuresnrequ occuresnqrue occuresnqreu occuresnqure occuresnquer occuresnqeur occuresnqeru
occuresnuqre occuresnuqer occuresnurqe occuresnureq occuresnuerq occuresnueqr occuresnequr occuresneqru occuresneuqr
occuresneurq occuresneruq occuresnerqu occuresrnque occuresrnqeu occuresrnuqe occuresrnueq occuresrneuq occuresrnequ
occuresrqnue occuresrqneu occuresrqune occuresrquen occuresrqeun occuresrqenu occuresruqne occuresruqen occuresrunqe
occuresruneq occuresruenq occuresrueqn occuresrequn occuresreqnu occuresreuqn occuresreunq occuresrenuq occuresrenqu
occuresqrnue occuresqrneu occuresqrune occuresqruen occuresqreun occuresqrenu occuresqnrue occuresqnreu occuresqnure
occuresqnuer occuresqneur occuresqneru occuresqunre occuresquner occuresqurne occuresquren occuresquern occuresquenr
occuresqenur occuresqenru occuresqeunr occuresqeurn occuresqerun occuresqernu occuresurqne occuresurqen occuresurnqe
occuresurneq occuresurenq occuresureqn occuresuqrne occuresuqren occuresuqnre occuresuqner occuresuqenr occuresuqern
occuresunqre occuresunqer occuresunrqe occuresunreq occuresunerq occuresuneqr occuresueqnr occuresueqrn occuresuenqr
occuresuenrq occuresuernq occuresuerqn occureserqun occureserqnu occureseruqn occureserunq occuresernuq occuresernqu
occureseqrun occureseqrnu occuresequrn occuresequnr occureseqnur occureseqnru occureseuqrn occureseuqnr occureseurqn
occureseurnq occureseunrq occureseunqr occuresenqur occuresenqru occuresenuqr occuresenurq occuresenruq occuresenrqu
occureqnsrue occureqnsreu occureqnsure occureqnsuer occureqnseur occureqnseru occureqnrsue occureqnrseu occureqnruse
occureqnrues occureqnreus occureqnresu occureqnurse occureqnures occureqnusre occureqnuser occureqnuesr occureqnuers
occureqnerus occureqnersu occureqneurs occureqneusr occureqnesur occureqnesru occureqsnrue occureqsnreu occureqsnure
occureqsnuer occureqsneur occureqsneru occureqsrnue occureqsrneu occureqsrune occureqsruen occureqsreun occureqsrenu
occureqsurne occureqsuren occureqsunre occureqsuner occureqsuenr occureqsuern occureqserun occureqsernu occureqseurn
occureqseunr occureqsenur occureqsenru occureqrsnue occureqrsneu occureqrsune occureqrsuen occureqrseun occureqrsenu
occureqrnsue occureqrnseu occureqrnuse occureqrnues occureqrneus occureqrnesu occureqrunse occureqrunes occureqrusne
occureqrusen occureqruesn occureqruens occureqrenus occureqrensu occureqreuns occureqreusn occureqresun occureqresnu
occurequsrne occurequsren occurequsnre occurequsner occurequsenr occurequsern occureqursne occureqursen occurequrnse
occurequrnes occurequrens occurequresn occurequnrse occurequnres occurequnsre occurequnser occurequnesr occurequners
occurequerns occurequersn occurequenrs occurequensr occurequesnr occurequesrn occureqesrun occureqesrnu occureqesurn
occureqesunr occureqesnur occureqesnru occureqersun occureqersnu occureqerusn occureqeruns occureqernus occureqernsu
occureqeursn occureqeurns occureqeusrn occureqeusnr occureqeunsr occureqeunrs occureqenrus occureqenrsu occureqenurs
occureqenusr occureqensur occureqensru occureunsqre occureunsqer occureunsrqe occureunsreq occureunserq occureunseqr
occureunqsre occureunqser occureunqrse occureunqres occureunqers occureunqesr occureunrqse occureunrqes occureunrsqe
occureunrseq occureunresq occureunreqs occureuneqrs occureuneqsr occureunerqs occureunersq occureunesrq occureunesqr
occureusnqre occureusnqer occureusnrqe occureusnreq occureusnerq occureusneqr occureusqnre occureusqner occureusqrne
occureusqren occureusqern occureusqenr occureusrqne occureusrqen occureusrnqe occureusrneq occureusrenq occureusreqn
occureuseqrn occureuseqnr occureuserqn occureusernq occureusenrq occureusenqr occureuqsnre occureuqsner occureuqsrne
occureuqsren occureuqsern occureuqsenr occureuqnsre occureuqnser occureuqnrse occureuqnres occureuqners occureuqnesr
occureuqrnse occureuqrnes occureuqrsne occureuqrsen occureuqresn occureuqrens occureuqenrs occureuqensr occureuqerns
occureuqersn occureuqesrn occureuqesnr occureursqne occureursqen occureursnqe occureursneq occureursenq occureurseqn
occureurqsne occureurqsen occureurqnse occureurqnes occureurqens occureurqesn occureurnqse occureurnqes occureurnsqe
occureurnseq occureurnesq occureurneqs occureureqns occureureqsn occureurenqs occureurensq occureuresnq occureuresqn
occureuesqrn occureuesqnr occureuesrqn occureuesrnq occureuesnrq occureuesnqr occureueqsrn occureueqsnr occureueqrsn
occureueqrns occureueqnrs occureueqnsr occureuerqsn occureuerqns occureuersqn occureuersnq occureuernsq occureuernqs
occureuenqrs occureuenqsr occureuenrqs occureuenrsq occureuensrq occureuensqr occureensqur occureensqru occureensuqr
occureensurq occureensruq occureensrqu occureenqsur occureenqsru occureenqusr occureenqurs occureenqrus occureenqrsu
occureenuqsr occureenuqrs occureenusqr occureenusrq occureenursq occureenurqs occureenrqus occureenrqsu occureenruqs
occureenrusq occureenrsuq occureenrsqu occureesnqur occureesnqru occureesnuqr occureesnurq occureesnruq occureesnrqu
occureesqnur occureesqnru occureesqunr occureesqurn occureesqrun occureesqrnu occureesuqnr occureesuqrn occureesunqr
occureesunrq occureesurnq occureesurqn occureesrqun occureesrqnu occureesruqn occureesrunq occureesrnuq occureesrnqu
occureeqsnur occureeqsnru occureeqsunr occureeqsurn occureeqsrun occureeqsrnu occureeqnsur occureeqnsru occureeqnusr
occureeqnurs occureeqnrus occureeqnrsu occureequnsr occureequnrs occureequsnr occureequsrn occureeqursn occureequrns
occureeqrnus occureeqrnsu occureeqruns occureeqrusn occureeqrsun occureeqrsnu occureeusqnr occureeusqrn occureeusnqr
occureeusnrq occureeusrnq occureeusrqn occureeuqsnr occureeuqsrn occureeuqnsr occureeuqnrs occureeuqrns occureeuqrsn
occureeunqsr occureeunqrs occureeunsqr occureeunsrq occureeunrsq occureeunrqs occureeurqns occureeurqsn occureeurnqs
occureeurnsq occureeursnq occureeursqn occureersqun occureersqnu occureersuqn occureersunq occureersnuq occureersnqu
occureerqsun occureerqsnu occureerqusn occureerquns occureerqnus occureerqnsu occureeruqsn occureeruqns occureerusqn
occureerusnq occureerunsq occureerunqs occureernqus occureernqsu occureernuqs occureernusq occureernsuq occureernsqu
occurnersque occurnersqeu occurnersuqe occurnersueq occurnerseuq occurnersequ occurnerqsue occurnerqseu occurnerquse
occurnerques occurnerqeus occurnerqesu occurneruqse occurneruqes occurnerusqe occurneruseq occurneruesq occurnerueqs
occurnerequs occurnereqsu occurnereuqs occurnereusq occurneresuq occurneresqu occurnesrque occurnesrqeu occurnesruqe
occurnesrueq occurnesreuq occurnesrequ occurnesqrue occurnesqreu occurnesqure occurnesquer occurnesqeur occurnesqeru
occurnesuqre occurnesuqer occurnesurqe occurnesureq occurnesuerq occurnesueqr occurnesequr occurneseqru occurneseuqr
occurneseurq occurneseruq occurneserqu occurneqsrue occurneqsreu occurneqsure occurneqsuer occurneqseur occurneqseru
occurneqrsue occurneqrseu occurneqruse occurneqrues occurneqreus occurneqresu occurnequrse occurnequres occurnequsre
occurnequser occurnequesr occurnequers occurneqerus occurneqersu occurneqeurs occurneqeusr occurneqesur occurneqesru
occurneusqre occurneusqer occurneusrqe occurneusreq occurneuserq occurneuseqr occurneuqsre occurneuqser occurneuqrse
occurneuqres occurneuqers occurneuqesr occurneurqse occurneurqes occurneursqe occurneurseq occurneuresq occurneureqs
occurneueqrs occurneueqsr occurneuerqs occurneuersq occurneuesrq occurneuesqr occurneesqur occurneesqru occurneesuqr
occurneesurq occurneesruq occurneesrqu occurneeqsur occurneeqsru occurneequsr occurneequrs occurneeqrus occurneeqrsu
occurneeuqsr occurneeuqrs occurneeusqr occurneeusrq occurneeursq occurneeurqs occurneerqus occurneerqsu occurneeruqs
occurneerusq occurneersuq occurneersqu occurnresque occurnresqeu occurnresuqe occurnresueq occurnreseuq occurnresequ
occurnreqsue occurnreqseu occurnrequse occurnreques occurnreqeus occurnreqesu occurnreuqse occurnreuqes occurnreusqe
occurnreuseq occurnreuesq occurnreueqs occurnreequs occurnreeqsu occurnreeuqs occurnreeusq occurnreesuq occurnreesqu
occurnrseque occurnrseqeu occurnrseuqe occurnrseueq occurnrseeuq occurnrseequ occurnrsqeue occurnrsqeeu occurnrsquee
occurnrsquee occurnrsqeue occurnrsqeeu occurnrsuqee occurnrsuqee occurnrsueqe occurnrsueeq occurnrsueeq occurnrsueqe
occurnrseque occurnrseqeu occurnrseuqe occurnrseueq occurnrseeuq occurnrseequ occurnrqseue occurnrqseeu occurnrqsuee
occurnrqsuee occurnrqseue occurnrqseeu occurnrqesue occurnrqeseu occurnrqeuse occurnrqeues occurnrqeeus occurnrqeesu
occurnrquese occurnrquees occurnrqusee occurnrqusee occurnrquese occurnrquees occurnrqeeus occurnrqeesu occurnrqeues
occurnrqeuse occurnrqesue occurnrqeseu occurnrusqee occurnrusqee occurnruseqe occurnruseeq occurnruseeq occurnruseqe
occurnruqsee occurnruqsee occurnruqese occurnruqees occurnruqees occurnruqese occurnrueqse occurnrueqes occurnruesqe
occurnrueseq occurnrueesq occurnrueeqs occurnrueqes occurnrueqse occurnrueeqs occurnrueesq occurnrueseq occurnruesqe
occurnresque occurnresqeu occurnresuqe occurnresueq occurnreseuq occurnresequ occurnreqsue occurnreqseu occurnrequse
occurnreques occurnreqeus occurnreqesu occurnreuqse occurnreuqes occurnreusqe occurnreuseq occurnreuesq occurnreueqs
occurnreequs occurnreeqsu occurnreeuqs occurnreeusq occurnreesuq occurnreesqu occurnsreque occurnsreqeu occurnsreuqe
occurnsreueq occurnsreeuq occurnsreequ occurnsrqeue occurnsrqeeu occurnsrquee occurnsrquee occurnsrqeue occurnsrqeeu
occurnsruqee occurnsruqee occurnsrueqe occurnsrueeq occurnsrueeq occurnsrueqe occurnsreque occurnsreqeu occurnsreuqe
occurnsreueq occurnsreeuq occurnsreequ occurnserque occurnserqeu occurnseruqe occurnserueq occurnsereuq occurnserequ
occurnseqrue occurnseqreu occurnsequre occurnsequer occurnseqeur occurnseqeru occurnseuqre occurnseuqer occurnseurqe
occurnseureq occurnseuerq occurnseueqr occurnseequr occurnseeqru occurnseeuqr occurnseeurq occurnseeruq occurnseerqu
occurnsqerue occurnsqereu occurnsqeure occurnsqeuer occurnsqeeur occurnsqeeru occurnsqreue occurnsqreeu occurnsqruee
occurnsqruee occurnsqreue occurnsqreeu occurnsquree occurnsquree occurnsquere occurnsqueer occurnsqueer occurnsquere
occurnsqerue occurnsqereu occurnsqeure occurnsqeuer occurnsqeeur occurnsqeeru occurnsueqre occurnsueqer occurnsuerqe
occurnsuereq occurnsueerq occurnsueeqr occurnsuqere occurnsuqeer occurnsuqree occurnsuqree occurnsuqere occurnsuqeer
occurnsurqee occurnsurqee occurnsureqe occurnsureeq occurnsureeq occurnsureqe occurnsueqre occurnsueqer occurnsuerqe
occurnsuereq occurnsueerq occurnsueeqr occurnseequr occurnseeqru occurnseeuqr occurnseeurq occurnseeruq occurnseerqu
occurnseqeur occurnseqeru occurnsequer occurnsequre occurnseqrue occurnseqreu occurnseuqer occurnseuqre occurnseueqr
occurnseuerq occurnseureq occurnseurqe occurnserque occurnserqeu occurnseruqe occurnserueq occurnsereuq occurnserequ
occurnqrseue occurnqrseeu occurnqrsuee occurnqrsuee occurnqrseue occurnqrseeu occurnqresue occurnqreseu occurnqreuse
occurnqreues occurnqreeus occurnqreesu occurnqruese occurnqruees occurnqrusee occurnqrusee occurnqruese occurnqruees
occurnqreeus occurnqreesu occurnqreues occurnqreuse occurnqresue occurnqreseu occurnqsreue occurnqsreeu occurnqsruee
occurnqsruee occurnqsreue occurnqsreeu occurnqserue occurnqsereu occurnqseure occurnqseuer occurnqseeur occurnqseeru
occurnqsuere occurnqsueer occurnqsuree occurnqsuree occurnqsuere occurnqsueer occurnqseeur occurnqseeru occurnqseuer
occurnqseure occurnqserue occurnqsereu occurnqesrue occurnqesreu occurnqesure occurnqesuer occurnqeseur occurnqeseru
occurnqersue occurnqerseu occurnqeruse occurnqerues occurnqereus occurnqeresu occurnqeurse occurnqeures occurnqeusre
occurnqeuser occurnqeuesr occurnqeuers occurnqeerus occurnqeersu occurnqeeurs occurnqeeusr occurnqeesur occurnqeesru
occurnqusere occurnquseer occurnqusree occurnqusree occurnqusere occurnquseer occurnquesre occurnqueser occurnquerse
occurnqueres occurnqueers occurnqueesr occurnqurese occurnqurees occurnqursee occurnqursee occurnqurese occurnqurees
occurnqueers occurnqueesr occurnqueres occurnquerse occurnquesre occurnqueser occurnqeseur occurnqeseru occurnqesuer
occurnqesure occurnqesrue occurnqesreu occurnqeesur occurnqeesru occurnqeeusr occurnqeeurs occurnqeerus occurnqeersu
occurnqeuesr occurnqeuers occurnqeuser occurnqeusre occurnqeurse occurnqeures occurnqereus occurnqeresu occurnqerues
occurnqeruse occurnqersue occurnqerseu occurnursqee occurnursqee occurnurseqe occurnurseeq occurnurseeq occurnurseqe
occurnurqsee occurnurqsee occurnurqese occurnurqees occurnurqees occurnurqese occurnureqse occurnureqes occurnuresqe
occurnureseq occurnureesq occurnureeqs occurnureqes occurnureqse occurnureeqs occurnureesq occurnureseq occurnuresqe
occurnusrqee occurnusrqee occurnusreqe occurnusreeq occurnusreeq occurnusreqe occurnusqree occurnusqree occurnusqere
occurnusqeer occurnusqeer occurnusqere occurnuseqre occurnuseqer occurnuserqe occurnusereq occurnuseerq occurnuseeqr
occurnuseqer occurnuseqre occurnuseeqr occurnuseerq occurnusereq occurnuserqe occurnuqsree occurnuqsree occurnuqsere
occurnuqseer occurnuqseer occurnuqsere occurnuqrsee occurnuqrsee occurnuqrese occurnuqrees occurnuqrees occurnuqrese
occurnuqerse occurnuqeres occurnuqesre occurnuqeser occurnuqeesr occurnuqeers occurnuqeres occurnuqerse occurnuqeers
occurnuqeesr occurnuqeser occurnuqesre occurnuesqre occurnuesqer occurnuesrqe occurnuesreq occurnueserq occurnueseqr
occurnueqsre occurnueqser occurnueqrse occurnueqres occurnueqers occurnueqesr occurnuerqse occurnuerqes occurnuersqe
occurnuerseq occurnueresq occurnuereqs occurnueeqrs occurnueeqsr occurnueerqs occurnueersq occurnueesrq occurnueesqr
occurnuesqer occurnuesqre occurnueseqr occurnueserq occurnuesreq occurnuesrqe occurnueqser occurnueqsre occurnueqesr
occurnueqers occurnueqres occurnueqrse occurnueeqsr occurnueeqrs occurnueesqr occurnueesrq occurnueersq occurnueerqs
occurnuerqes occurnuerqse occurnuereqs occurnueresq occurnuerseq occurnuersqe occurnersque occurnersqeu occurnersuqe
occurnersueq occurnerseuq occurnersequ occurnerqsue occurnerqseu occurnerquse occurnerques occurnerqeus occurnerqesu
occurneruqse occurneruqes occurnerusqe occurneruseq occurneruesq occurnerueqs occurnerequs occurnereqsu occurnereuqs
occurnereusq occurneresuq occurneresqu occurnesrque occurnesrqeu occurnesruqe occurnesrueq occurnesreuq occurnesrequ
occurnesqrue occurnesqreu occurnesqure occurnesquer occurnesqeur occurnesqeru occurnesuqre occurnesuqer occurnesurqe
occurnesureq occurnesuerq occurnesueqr occurnesequr occurneseqru occurneseuqr occurneseurq occurneseruq occurneserqu
occurneqsrue occurneqsreu occurneqsure occurneqsuer occurneqseur occurneqseru occurneqrsue occurneqrseu occurneqruse
occurneqrues occurneqreus occurneqresu occurnequrse occurnequres occurnequsre occurnequser occurnequesr occurnequers
occurneqerus occurneqersu occurneqeurs occurneqeusr occurneqesur occurneqesru occurneusqre occurneusqer occurneusrqe
occurneusreq occurneuserq occurneuseqr occurneuqsre occurneuqser occurneuqrse occurneuqres occurneuqers occurneuqesr
occurneurqse occurneurqes occurneursqe occurneurseq occurneuresq occurneureqs occurneueqrs occurneueqsr occurneuerqs
occurneuersq occurneuesrq occurneuesqr occurneesqur occurneesqru occurneesuqr occurneesurq occurneesruq occurneesrqu
occurneeqsur occurneeqsru occurneequsr occurneequrs occurneeqrus occurneeqrsu occurneeuqsr occurneeuqrs occurneeusqr
occurneeusrq occurneeursq occurneeurqs occurneerqus occurneerqsu occurneeruqs occurneerusq occurneersuq occurneersqu
occursenrque occursenrqeu occursenruqe occursenrueq occursenreuq occursenrequ occursenqrue occursenqreu occursenqure
occursenquer occursenqeur occursenqeru occursenuqre occursenuqer occursenurqe occursenureq occursenuerq occursenueqr
occursenequr occurseneqru occurseneuqr occurseneurq occurseneruq occursenerqu occursernque occursernqeu occursernuqe
occursernueq occurserneuq occursernequ occurserqnue occurserqneu occurserqune occurserquen occurserqeun occurserqenu
occurseruqne occurseruqen occurserunqe occurseruneq occurseruenq occurserueqn occurserequn occursereqnu occursereuqn
occursereunq occurserenuq occurserenqu occurseqrnue occurseqrneu occurseqrune occurseqruen occurseqreun occurseqrenu
occurseqnrue occurseqnreu occurseqnure occurseqnuer occurseqneur occurseqneru occursequnre occursequner occursequrne
occursequren occursequern occursequenr occurseqenur occurseqenru occurseqeunr occurseqeurn occurseqerun occurseqernu
occurseurqne occurseurqen occurseurnqe occurseurneq occurseurenq occurseureqn occurseuqrne occurseuqren occurseuqnre
occurseuqner occurseuqenr occurseuqern occurseunqre occurseunqer occurseunrqe occurseunreq occurseunerq occurseuneqr
occurseueqnr occurseueqrn occurseuenqr occurseuenrq occurseuernq occurseuerqn occurseerqun occurseerqnu occurseeruqn
occurseerunq occurseernuq occurseernqu occurseeqrun occurseeqrnu occurseequrn occurseequnr occurseeqnur occurseeqnru
occurseeuqrn occurseeuqnr occurseeurqn occurseeurnq occurseeunrq occurseeunqr occurseenqur occurseenqru occurseenuqr
occurseenurq occurseenruq occurseenrqu occursnerque occursnerqeu occursneruqe occursnerueq occursnereuq occursnerequ
occursneqrue occursneqreu occursnequre occursnequer occursneqeur occursneqeru occursneuqre occursneuqer occursneurqe
occursneureq occursneuerq occursneueqr occursneequr occursneeqru occursneeuqr occursneeurq occursneeruq occursneerqu
occursnreque occursnreqeu occursnreuqe occursnreueq occursnreeuq occursnreequ occursnrqeue occursnrqeeu occursnrquee
occursnrquee occursnrqeue occursnrqeeu occursnruqee occursnruqee occursnrueqe occursnrueeq occursnrueeq occursnrueqe
occursnreque occursnreqeu occursnreuqe occursnreueq occursnreeuq occursnreequ occursnqreue occursnqreeu occursnqruee
occursnqruee occursnqreue occursnqreeu occursnqerue occursnqereu occursnqeure occursnqeuer occursnqeeur occursnqeeru
occursnquere occursnqueer occursnquree occursnquree occursnquere occursnqueer occursnqeeur occursnqeeru occursnqeuer
occursnqeure occursnqerue occursnqereu occursnurqee occursnurqee occursnureqe occursnureeq occursnureeq occursnureqe
occursnuqree occursnuqree occursnuqere occursnuqeer occursnuqeer occursnuqere occursnueqre occursnueqer occursnuerqe
occursnuereq occursnueerq occursnueeqr occursnueqer occursnueqre occursnueeqr occursnueerq occursnuereq occursnuerqe
occursnerque occursnerqeu occursneruqe occursnerueq occursnereuq occursnerequ occursneqrue occursneqreu occursnequre
occursnequer occursneqeur occursneqeru occursneuqre occursneuqer occursneurqe occursneureq occursneuerq occursneueqr
occursneequr occursneeqru occursneeuqr occursneeurq occursneeruq occursneerqu occursrneque occursrneqeu occursrneuqe
occursrneueq occursrneeuq occursrneequ occursrnqeue occursrnqeeu occursrnquee occursrnquee occursrnqeue occursrnqeeu
occursrnuqee occursrnuqee occursrnueqe occursrnueeq occursrnueeq occursrnueqe occursrneque occursrneqeu occursrneuqe
occursrneueq occursrneeuq occursrneequ occursrenque occursrenqeu occursrenuqe occursrenueq occursreneuq occursrenequ
occursreqnue occursreqneu occursrequne occursrequen occursreqeun occursreqenu occursreuqne occursreuqen occursreunqe
occursreuneq occursreuenq occursreueqn occursreequn occursreeqnu occursreeuqn occursreeunq occursreenuq occursreenqu
occursrqenue occursrqeneu occursrqeune occursrqeuen occursrqeeun occursrqeenu occursrqneue occursrqneeu occursrqnuee
occursrqnuee occursrqneue occursrqneeu occursrqunee occursrqunee occursrquene occursrqueen occursrqueen occursrquene
occursrqenue occursrqeneu occursrqeune occursrqeuen occursrqeeun occursrqeenu occursrueqne occursrueqen occursruenqe
occursrueneq occursrueenq occursrueeqn occursruqene occursruqeen occursruqnee occursruqnee occursruqene occursruqeen
occursrunqee occursrunqee occursruneqe occursruneeq occursruneeq occursruneqe occursrueqne occursrueqen occursruenqe
occursrueneq occursrueenq occursrueeqn occursreequn occursreeqnu occursreeuqn occursreeunq occursreenuq occursreenqu
occursreqeun occursreqenu occursrequen occursrequne occursreqnue occursreqneu occursreuqen occursreuqne occursreueqn
occursreuenq occursreuneq occursreunqe occursrenque occursrenqeu occursrenuqe occursrenueq occursreneuq occursrenequ
occursqnreue occursqnreeu occursqnruee occursqnruee occursqnreue occursqnreeu occursqnerue occursqnereu occursqneure
occursqneuer occursqneeur occursqneeru occursqnuere occursqnueer occursqnuree occursqnuree occursqnuere occursqnueer
occursqneeur occursqneeru occursqneuer occursqneure occursqnerue occursqnereu occursqrneue occursqrneeu occursqrnuee
occursqrnuee occursqrneue occursqrneeu occursqrenue occursqreneu occursqreune occursqreuen occursqreeun occursqreenu
occursqruene occursqrueen occursqrunee occursqrunee occursqruene occursqrueen occursqreeun occursqreenu occursqreuen
occursqreune occursqrenue occursqreneu occursqernue occursqerneu occursqerune occursqeruen occursqereun occursqerenu
occursqenrue occursqenreu occursqenure occursqenuer occursqeneur occursqeneru occursqeunre occursqeuner occursqeurne
occursqeuren occursqeuern occursqeuenr occursqeenur occursqeenru occursqeeunr occursqeeurn occursqeerun occursqeernu
occursqurene occursqureen occursqurnee occursqurnee occursqurene occursqureen occursquerne occursqueren occursquenre
occursquener occursqueenr occursqueern occursqunere occursquneer occursqunree occursqunree occursqunere occursquneer
occursqueenr occursqueern occursquener occursquenre occursquerne occursqueren occursqereun occursqerenu occursqeruen
occursqerune occursqernue occursqerneu occursqeerun occursqeernu occursqeeurn occursqeeunr occursqeenur occursqeenru
occursqeuern occursqeuenr occursqeuren occursqeurne occursqeunre occursqeuner occursqeneur occursqeneru occursqenuer
occursqenure occursqenrue occursqenreu occursunrqee occursunrqee occursunreqe occursunreeq occursunreeq occursunreqe
occursunqree occursunqree occursunqere occursunqeer occursunqeer occursunqere occursuneqre occursuneqer occursunerqe
occursunereq occursuneerq occursuneeqr occursuneqer occursuneqre occursuneeqr occursuneerq occursunereq occursunerqe
occursurnqee occursurnqee occursurneqe occursurneeq occursurneeq occursurneqe occursurqnee occursurqnee occursurqene
occursurqeen occursurqeen occursurqene occursureqne occursureqen occursurenqe occursureneq occursureenq occursureeqn
occursureqen occursureqne occursureeqn occursureenq occursureneq occursurenqe occursuqrnee occursuqrnee occursuqrene
occursuqreen occursuqreen occursuqrene occursuqnree occursuqnree occursuqnere occursuqneer occursuqneer occursuqnere
occursuqenre occursuqener occursuqerne occursuqeren occursuqeern occursuqeenr occursuqener occursuqenre occursuqeenr
occursuqeern occursuqeren occursuqerne occursuerqne occursuerqen occursuernqe occursuerneq occursuerenq occursuereqn
occursueqrne occursueqren occursueqnre occursueqner occursueqenr occursueqern occursuenqre occursuenqer occursuenrqe
occursuenreq occursuenerq occursueneqr occursueeqnr occursueeqrn occursueenqr occursueenrq occursueernq occursueerqn
occursuerqen occursuerqne occursuereqn occursuerenq occursuerneq occursuernqe occursueqren occursueqrne occursueqern
occursueqenr occursueqner occursueqnre occursueeqrn occursueeqnr occursueerqn occursueernq occursueenrq occursueenqr
occursuenqer occursuenqre occursueneqr occursuenerq occursuenreq occursuenrqe occursenrque occursenrqeu occursenruqe
occursenrueq occursenreuq occursenrequ occursenqrue occursenqreu occursenqure occursenquer occursenqeur occursenqeru
occursenuqre occursenuqer occursenurqe occursenureq occursenuerq occursenueqr occursenequr occurseneqru occurseneuqr
occurseneurq occurseneruq occursenerqu occursernque occursernqeu occursernuqe occursernueq occurserneuq occursernequ
occurserqnue occurserqneu occurserqune occurserquen occurserqeun occurserqenu occurseruqne occurseruqen occurserunqe
occurseruneq occurseruenq occurserueqn occurserequn occursereqnu occursereuqn occursereunq occurserenuq occurserenqu
occurseqrnue occurseqrneu occurseqrune occurseqruen occurseqreun occurseqrenu occurseqnrue occurseqnreu occurseqnure
occurseqnuer occurseqneur occurseqneru occursequnre occursequner occursequrne occursequren occursequern occursequenr
occurseqenur occurseqenru occurseqeunr occurseqeurn occurseqerun occurseqernu occurseurqne occurseurqen occurseurnqe
occurseurneq occurseurenq occurseureqn occurseuqrne occurseuqren occurseuqnre occurseuqner occurseuqenr occurseuqern
occurseunqre occurseunqer occurseunrqe occurseunreq occurseunerq occurseuneqr occurseueqnr occurseueqrn occurseuenqr
occurseuenrq occurseuernq occurseuerqn occurseerqun occurseerqnu occurseeruqn occurseerunq occurseernuq occurseernqu
occurseeqrun occurseeqrnu occurseequrn occurseequnr occurseeqnur occurseeqnru occurseeuqrn occurseeuqnr occurseeurqn
occurseeurnq occurseeunrq occurseeunqr occurseenqur occurseenqru occurseenuqr occurseenurq occurseenruq occurseenrqu
occurqensrue occurqensreu occurqensure occurqensuer occurqenseur occurqenseru occurqenrsue occurqenrseu occurqenruse
occurqenrues occurqenreus occurqenresu occurqenurse occurqenures occurqenusre occurqenuser occurqenuesr occurqenuers
occurqenerus occurqenersu occurqeneurs occurqeneusr occurqenesur occurqenesru occurqesnrue occurqesnreu occurqesnure
occurqesnuer occurqesneur occurqesneru occurqesrnue occurqesrneu occurqesrune occurqesruen occurqesreun occurqesrenu
occurqesurne occurqesuren occurqesunre occurqesuner occurqesuenr occurqesuern occurqeserun occurqesernu occurqeseurn
occurqeseunr occurqesenur occurqesenru occurqersnue occurqersneu occurqersune occurqersuen occurqerseun occurqersenu
occurqernsue occurqernseu occurqernuse occurqernues occurqerneus occurqernesu occurqerunse occurqerunes occurqerusne
occurqerusen occurqeruesn occurqeruens occurqerenus occurqerensu occurqereuns occurqereusn occurqeresun occurqeresnu
occurqeusrne occurqeusren occurqeusnre occurqeusner occurqeusenr occurqeusern occurqeursne occurqeursen occurqeurnse
occurqeurnes occurqeurens occurqeuresn occurqeunrse occurqeunres occurqeunsre occurqeunser occurqeunesr occurqeuners
occurqeuerns occurqeuersn occurqeuenrs occurqeuensr occurqeuesnr occurqeuesrn occurqeesrun occurqeesrnu occurqeesurn
occurqeesunr occurqeesnur occurqeesnru occurqeersun occurqeersnu occurqeerusn occurqeeruns occurqeernus occurqeernsu
occurqeeursn occurqeeurns occurqeeusrn occurqeeusnr occurqeeunsr occurqeeunrs occurqeenrus occurqeenrsu occurqeenurs
occurqeenusr occurqeensur occurqeensru occurqnesrue occurqnesreu occurqnesure occurqnesuer occurqneseur occurqneseru
occurqnersue occurqnerseu occurqneruse occurqnerues occurqnereus occurqneresu occurqneurse occurqneures occurqneusre
occurqneuser occurqneuesr occurqneuers occurqneerus occurqneersu occurqneeurs occurqneeusr occurqneesur occurqneesru
occurqnserue occurqnsereu occurqnseure occurqnseuer occurqnseeur occurqnseeru occurqnsreue occurqnsreeu occurqnsruee
occurqnsruee occurqnsreue occurqnsreeu occurqnsuree occurqnsuree occurqnsuere occurqnsueer occurqnsueer occurqnsuere
occurqnserue occurqnsereu occurqnseure occurqnseuer occurqnseeur occurqnseeru occurqnrseue occurqnrseeu occurqnrsuee
occurqnrsuee occurqnrseue occurqnrseeu occurqnresue occurqnreseu occurqnreuse occurqnreues occurqnreeus occurqnreesu
occurqnruese occurqnruees occurqnrusee occurqnrusee occurqnruese occurqnruees occurqnreeus occurqnreesu occurqnreues
occurqnreuse occurqnresue occurqnreseu occurqnusree occurqnusree occurqnusere occurqnuseer occurqnuseer occurqnusere
occurqnursee occurqnursee occurqnurese occurqnurees occurqnurees occurqnurese occurqnuerse occurqnueres occurqnuesre
occurqnueser occurqnueesr occurqnueers occurqnueres occurqnuerse occurqnueers occurqnueesr occurqnueser occurqnuesre
occurqnesrue occurqnesreu occurqnesure occurqnesuer occurqneseur occurqneseru occurqnersue occurqnerseu occurqneruse
occurqnerues occurqnereus occurqneresu occurqneurse occurqneures occurqneusre occurqneuser occurqneuesr occurqneuers
occurqneerus occurqneersu occurqneeurs occurqneeusr occurqneesur occurqneesru occurqsnerue occurqsnereu occurqsneure
occurqsneuer occurqsneeur occurqsneeru occurqsnreue occurqsnreeu occurqsnruee occurqsnruee occurqsnreue occurqsnreeu
occurqsnuree occurqsnuree occurqsnuere occurqsnueer occurqsnueer occurqsnuere occurqsnerue occurqsnereu occurqsneure
occurqsneuer occurqsneeur occurqsneeru occurqsenrue occurqsenreu occurqsenure occurqsenuer occurqseneur occurqseneru
occurqsernue occurqserneu occurqserune occurqseruen occurqsereun occurqserenu occurqseurne occurqseuren occurqseunre
occurqseuner occurqseuenr occurqseuern occurqseerun occurqseernu occurqseeurn occurqseeunr occurqseenur occurqseenru
occurqsrenue occurqsreneu occurqsreune occurqsreuen occurqsreeun occurqsreenu occurqsrneue occurqsrneeu occurqsrnuee
occurqsrnuee occurqsrneue occurqsrneeu occurqsrunee occurqsrunee occurqsruene occurqsrueen occurqsrueen occurqsruene
occurqsrenue occurqsreneu occurqsreune occurqsreuen occurqsreeun occurqsreenu occurqsuerne occurqsueren occurqsuenre
occurqsuener occurqsueenr occurqsueern occurqsurene occurqsureen occurqsurnee occurqsurnee occurqsurene occurqsureen
occurqsunree occurqsunree occurqsunere occurqsuneer occurqsuneer occurqsunere occurqsuerne occurqsueren occurqsuenre
occurqsuener occurqsueenr occurqsueern occurqseerun occurqseernu occurqseeurn occurqseeunr occurqseenur occurqseenru
occurqsereun occurqserenu occurqseruen occurqserune occurqsernue occurqserneu occurqseuren occurqseurne occurqseuern
occurqseuenr occurqseuner occurqseunre occurqsenrue occurqsenreu occurqsenure occurqsenuer occurqseneur occurqseneru
occurqrnseue occurqrnseeu occurqrnsuee occurqrnsuee occurqrnseue occurqrnseeu occurqrnesue occurqrneseu occurqrneuse
occurqrneues occurqrneeus occurqrneesu occurqrnuese occurqrnuees occurqrnusee occurqrnusee occurqrnuese occurqrnuees
occurqrneeus occurqrneesu occurqrneues occurqrneuse occurqrnesue occurqrneseu occurqrsneue occurqrsneeu occurqrsnuee
occurqrsnuee occurqrsneue occurqrsneeu occurqrsenue occurqrseneu occurqrseune occurqrseuen occurqrseeun occurqrseenu
occurqrsuene occurqrsueen occurqrsunee occurqrsunee occurqrsuene occurqrsueen occurqrseeun occurqrseenu occurqrseuen
occurqrseune occurqrsenue occurqrseneu occurqresnue occurqresneu occurqresune occurqresuen occurqreseun occurqresenu
occurqrensue occurqrenseu occurqrenuse occurqrenues occurqreneus occurqrenesu occurqreunse occurqreunes occurqreusne
occurqreusen occurqreuesn occurqreuens occurqreenus occurqreensu occurqreeuns occurqreeusn occurqreesun occurqreesnu
occurqrusene occurqruseen occurqrusnee occurqrusnee occurqrusene occurqruseen occurqruesne occurqruesen occurqruense
occurqruenes occurqrueens occurqrueesn occurqrunese occurqrunees occurqrunsee occurqrunsee occurqrunese occurqrunees
occurqrueens occurqrueesn occurqruenes occurqruense occurqruesne occurqruesen occurqreseun occurqresenu occurqresuen
occurqresune occurqresnue occurqresneu occurqreesun occurqreesnu occurqreeusn occurqreeuns occurqreenus occurqreensu
occurqreuesn occurqreuens occurqreusen occurqreusne occurqreunse occurqreunes occurqreneus occurqrenesu occurqrenues
occurqrenuse occurqrensue occurqrenseu occurqunsree occurqunsree occurqunsere occurqunseer occurqunseer occurqunsere
occurqunrsee occurqunrsee occurqunrese occurqunrees occurqunrees occurqunrese occurqunerse occurquneres occurqunesre
occurquneser occurquneesr occurquneers occurquneres occurqunerse occurquneers occurquneesr occurquneser occurqunesre
occurqusnree occurqusnree occurqusnere occurqusneer occurqusneer occurqusnere occurqusrnee occurqusrnee occurqusrene
occurqusreen occurqusreen occurqusrene occurquserne occurquseren occurqusenre occurqusener occurquseenr occurquseern
occurquseren occurquserne occurquseern occurquseenr occurqusener occurqusenre occurqursnee occurqursnee occurqursene
occurqurseen occurqurseen occurqursene occurqurnsee occurqurnsee occurqurnese occurqurnees occurqurnees occurqurnese
occurqurense occurqurenes occurquresne occurquresen occurqureesn occurqureens occurqurenes occurqurense occurqureens
occurqureesn occurquresen occurquresne occurquesrne occurquesren occurquesnre occurquesner occurquesenr occurquesern
occurquersne occurquersen occurquernse occurquernes occurquerens occurqueresn occurquenrse occurquenres occurquensre
occurquenser occurquenesr occurqueners occurqueerns occurqueersn occurqueenrs occurqueensr occurqueesnr occurqueesrn
occurquesren occurquesrne occurquesern occurquesenr occurquesner occurquesnre occurquersen occurquersne occurqueresn
occurquerens occurquernes occurquernse occurqueersn occurqueerns occurqueesrn occurqueesnr occurqueensr occurqueenrs
occurquenres occurquenrse occurqueners occurquenesr occurquenser occurquensre occurqensrue occurqensreu occurqensure
occurqensuer occurqenseur occurqenseru occurqenrsue occurqenrseu occurqenruse occurqenrues occurqenreus occurqenresu
occurqenurse occurqenures occurqenusre occurqenuser occurqenuesr occurqenuers occurqenerus occurqenersu occurqeneurs
occurqeneusr occurqenesur occurqenesru occurqesnrue occurqesnreu occurqesnure occurqesnuer occurqesneur occurqesneru
occurqesrnue occurqesrneu occurqesrune occurqesruen occurqesreun occurqesrenu occurqesurne occurqesuren occurqesunre
occurqesuner occurqesuenr occurqesuern occurqeserun occurqesernu occurqeseurn occurqeseunr occurqesenur occurqesenru
occurqersnue occurqersneu occurqersune occurqersuen occurqerseun occurqersenu occurqernsue occurqernseu occurqernuse
occurqernues occurqerneus occurqernesu occurqerunse occurqerunes occurqerusne occurqerusen occurqeruesn occurqeruens
occurqerenus occurqerensu occurqereuns occurqereusn occurqeresun occurqeresnu occurqeusrne occurqeusren occurqeusnre
occurqeusner occurqeusenr occurqeusern occurqeursne occurqeursen occurqeurnse occurqeurnes occurqeurens occurqeuresn
occurqeunrse occurqeunres occurqeunsre occurqeunser occurqeunesr occurqeuners occurqeuerns occurqeuersn occurqeuenrs
occurqeuensr occurqeuesnr occurqeuesrn occurqeesrun occurqeesrnu occurqeesurn occurqeesunr occurqeesnur occurqeesnru
occurqeersun occurqeersnu occurqeerusn occurqeeruns occurqeernus occurqeernsu occurqeeursn occurqeeurns occurqeeusrn
occurqeeusnr occurqeeunsr occurqeeunrs occurqeenrus occurqeenrsu occurqeenurs occurqeenusr occurqeensur occurqeensru
occuruensqre occuruensqer occuruensrqe occuruensreq occuruenserq occuruenseqr occuruenqsre occuruenqser occuruenqrse
occuruenqres occuruenqers occuruenqesr occuruenrqse occuruenrqes occuruenrsqe occuruenrseq occuruenresq occuruenreqs
occurueneqrs occurueneqsr occuruenerqs occuruenersq occuruenesrq occuruenesqr occuruesnqre occuruesnqer occuruesnrqe
occuruesnreq occuruesnerq occuruesneqr occuruesqnre occuruesqner occuruesqrne occuruesqren occuruesqern occuruesqenr
occuruesrqne occuruesrqen occuruesrnqe occuruesrneq occuruesrenq occuruesreqn occurueseqrn occurueseqnr occurueserqn
occuruesernq occuruesenrq occuruesenqr occurueqsnre occurueqsner occurueqsrne occurueqsren occurueqsern occurueqsenr
occurueqnsre occurueqnser occurueqnrse occurueqnres occurueqners occurueqnesr occurueqrnse occurueqrnes occurueqrsne
occurueqrsen occurueqresn occurueqrens occurueqenrs occurueqensr occurueqerns occurueqersn occurueqesrn occurueqesnr
occuruersqne occuruersqen occuruersnqe occuruersneq occuruersenq occuruerseqn occuruerqsne occuruerqsen occuruerqnse
occuruerqnes occuruerqens occuruerqesn occuruernqse occuruernqes occuruernsqe occuruernseq occuruernesq occuruerneqs
occuruereqns occuruereqsn occuruerenqs occuruerensq occurueresnq occurueresqn occurueesqrn occurueesqnr occurueesrqn
occurueesrnq occurueesnrq occurueesnqr occurueeqsrn occurueeqsnr occurueeqrsn occurueeqrns occurueeqnrs occurueeqnsr
occurueerqsn occurueerqns occurueersqn occurueersnq occurueernsq occurueernqs occurueenqrs occurueenqsr occurueenrqs
occurueenrsq occurueensrq occurueensqr occurunesqre occurunesqer occurunesrqe occurunesreq occuruneserq occuruneseqr
occuruneqsre occuruneqser occuruneqrse occuruneqres occuruneqers occuruneqesr occurunerqse occurunerqes occurunersqe
occurunerseq occuruneresq occurunereqs occuruneeqrs occuruneeqsr occuruneerqs occuruneersq occuruneesrq occuruneesqr
occurunseqre occurunseqer occurunserqe occurunsereq occurunseerq occurunseeqr occurunsqere occurunsqeer occurunsqree
occurunsqree occurunsqere occurunsqeer occurunsrqee occurunsrqee occurunsreqe occurunsreeq occurunsreeq occurunsreqe
occurunseqre occurunseqer occurunserqe occurunsereq occurunseerq occurunseeqr occurunqsere occurunqseer occurunqsree
occurunqsree occurunqsere occurunqseer occurunqesre occurunqeser occurunqerse occurunqeres occurunqeers occurunqeesr
occurunqrese occurunqrees occurunqrsee occurunqrsee occurunqrese occurunqrees occurunqeers occurunqeesr occurunqeres
occurunqerse occurunqesre occurunqeser occurunrsqee occurunrsqee occurunrseqe occurunrseeq occurunrseeq occurunrseqe
occurunrqsee occurunrqsee occurunrqese occurunrqees occurunrqees occurunrqese occurunreqse occurunreqes occurunresqe
occurunreseq occurunreesq occurunreeqs occurunreqes occurunreqse occurunreeqs occurunreesq occurunreseq occurunresqe
occurunesqre occurunesqer occurunesrqe occurunesreq occuruneserq occuruneseqr occuruneqsre occuruneqser occuruneqrse
occuruneqres occuruneqers occuruneqesr occurunerqse occurunerqes occurunersqe occurunerseq occuruneresq occurunereqs
occuruneeqrs occuruneeqsr occuruneerqs occuruneersq occuruneesrq occuruneesqr occurusneqre occurusneqer occurusnerqe
occurusnereq occurusneerq occurusneeqr occurusnqere occurusnqeer occurusnqree occurusnqree occurusnqere occurusnqeer
occurusnrqee occurusnrqee occurusnreqe occurusnreeq occurusnreeq occurusnreqe occurusneqre occurusneqer occurusnerqe
occurusnereq occurusneerq occurusneeqr occurusenqre occurusenqer occurusenrqe occurusenreq occurusenerq occuruseneqr
occuruseqnre occuruseqner occuruseqrne occuruseqren occuruseqern occuruseqenr occuruserqne occuruserqen occurusernqe
occuruserneq occuruserenq occurusereqn occuruseeqrn occuruseeqnr occuruseerqn occuruseernq occuruseenrq occuruseenqr
occurusqenre occurusqener occurusqerne occurusqeren occurusqeern occurusqeenr occurusqnere occurusqneer occurusqnree
occurusqnree occurusqnere occurusqneer occurusqrnee occurusqrnee occurusqrene occurusqreen occurusqreen occurusqrene
occurusqenre occurusqener occurusqerne occurusqeren occurusqeern occurusqeenr occurusreqne occurusreqen occurusrenqe
occurusreneq occurusreenq occurusreeqn occurusrqene occurusrqeen occurusrqnee occurusrqnee occurusrqene occurusrqeen
occurusrnqee occurusrnqee occurusrneqe occurusrneeq occurusrneeq occurusrneqe occurusreqne occurusreqen occurusrenqe
occurusreneq occurusreenq occurusreeqn occuruseeqrn occuruseeqnr occuruseerqn occuruseernq occuruseenrq occuruseenqr
occuruseqern occuruseqenr occuruseqren occuruseqrne occuruseqnre occuruseqner occuruserqen occuruserqne occurusereqn
occuruserenq occuruserneq occurusernqe occurusenqre occurusenqer occurusenrqe occurusenreq occurusenerq occuruseneqr
occuruqnsere occuruqnseer occuruqnsree occuruqnsree occuruqnsere occuruqnseer occuruqnesre occuruqneser occuruqnerse
occuruqneres occuruqneers occuruqneesr occuruqnrese occuruqnrees occuruqnrsee occuruqnrsee occuruqnrese occuruqnrees
occuruqneers occuruqneesr occuruqneres occuruqnerse occuruqnesre occuruqneser occuruqsnere occuruqsneer occuruqsnree
occuruqsnree occuruqsnere occuruqsneer occuruqsenre occuruqsener occuruqserne occuruqseren occuruqseern occuruqseenr
occuruqsrene occuruqsreen occuruqsrnee occuruqsrnee occuruqsrene occuruqsreen occuruqseern occuruqseenr occuruqseren
occuruqserne occuruqsenre occuruqsener occuruqesnre occuruqesner occuruqesrne occuruqesren occuruqesern occuruqesenr
occuruqensre occuruqenser occuruqenrse occuruqenres occuruqeners occuruqenesr occuruqernse occuruqernes occuruqersne
occuruqersen occuruqeresn occuruqerens occuruqeenrs occuruqeensr occuruqeerns occuruqeersn occuruqeesrn occuruqeesnr
occuruqrsene occuruqrseen occuruqrsnee occuruqrsnee occuruqrsene occuruqrseen occuruqresne occuruqresen occuruqrense
occuruqrenes occuruqreens occuruqreesn occuruqrnese occuruqrnees occuruqrnsee occuruqrnsee occuruqrnese occuruqrnees
occuruqreens occuruqreesn occuruqrenes occuruqrense occuruqresne occuruqresen occuruqesern occuruqesenr occuruqesren
occuruqesrne occuruqesnre occuruqesner occuruqeesrn occuruqeesnr occuruqeersn occuruqeerns occuruqeenrs occuruqeensr
occuruqeresn occuruqerens occuruqersen occuruqersne occuruqernse occuruqernes occuruqeners occuruqenesr occuruqenres
occuruqenrse occuruqensre occuruqenser occururnsqee occururnsqee occururnseqe occururnseeq occururnseeq occururnseqe
occururnqsee occururnqsee occururnqese occururnqees occururnqees occururnqese occururneqse occururneqes occururnesqe
occururneseq occururneesq occururneeqs occururneqes occururneqse occururneeqs occururneesq occururneseq occururnesqe
occurursnqee occurursnqee occurursneqe occurursneeq occurursneeq occurursneqe occurursqnee occurursqnee occurursqene
occurursqeen occurursqeen occurursqene occururseqne occururseqen occurursenqe occururseneq occururseenq occururseeqn
occururseqen occururseqne occururseeqn occururseenq occururseneq occurursenqe occururqsnee occururqsnee occururqsene
occururqseen occururqseen occururqsene occururqnsee occururqnsee occururqnese occururqnees occururqnees occururqnese
occururqense occururqenes occururqesne occururqesen occururqeesn occururqeens occururqenes occururqense occururqeens
occururqeesn occururqesen occururqesne occururesqne occururesqen occururesnqe occururesneq occururesenq occurureseqn
occurureqsne occurureqsen occurureqnse occurureqnes occurureqens occurureqesn occururenqse occururenqes occururensqe
occururenseq occururenesq occurureneqs occurureeqns occurureeqsn occurureenqs occurureensq occurureesnq occurureesqn
occururesqen occururesqne occurureseqn occururesenq occururesneq occururesnqe occurureqsen occurureqsne occurureqesn
occurureqens occurureqnes occurureqnse occurureeqsn occurureeqns occurureesqn occurureesnq occurureensq occurureenqs
occururenqes occururenqse occurureneqs occururenesq occururenseq occururensqe occuruensqre occuruensqer occuruensrqe
occuruensreq occuruenserq occuruenseqr occuruenqsre occuruenqser occuruenqrse occuruenqres occuruenqers occuruenqesr
occuruenrqse occuruenrqes occuruenrsqe occuruenrseq occuruenresq occuruenreqs occurueneqrs occurueneqsr occuruenerqs
occuruenersq occuruenesrq occuruenesqr occuruesnqre occuruesnqer occuruesnrqe occuruesnreq occuruesnerq occuruesneqr
occuruesqnre occuruesqner occuruesqrne occuruesqren occuruesqern occuruesqenr occuruesrqne occuruesrqen occuruesrnqe
occuruesrneq occuruesrenq occuruesreqn occurueseqrn occurueseqnr occurueserqn occuruesernq occuruesenrq occuruesenqr
occurueqsnre occurueqsner occurueqsrne occurueqsren occurueqsern occurueqsenr occurueqnsre occurueqnser occurueqnrse
occurueqnres occurueqners occurueqnesr occurueqrnse occurueqrnes occurueqrsne occurueqrsen occurueqresn occurueqrens
occurueqenrs occurueqensr occurueqerns occurueqersn occurueqesrn occurueqesnr occuruersqne occuruersqen occuruersnqe
occuruersneq occuruersenq occuruerseqn occuruerqsne occuruerqsen occuruerqnse occuruerqnes occuruerqens occuruerqesn
occuruernqse occuruernqes occuruernsqe occuruernseq occuruernesq occuruerneqs occuruereqns occuruereqsn occuruerenqs
occuruerensq occurueresnq occurueresqn occurueesqrn occurueesqnr occurueesrqn occurueesrnq occurueesnrq occurueesnqr
occurueeqsrn occurueeqsnr occurueeqrsn occurueeqrns occurueeqnrs occurueeqnsr occurueerqsn occurueerqns occurueersqn
occurueersnq occurueernsq occurueernqs occurueenqrs occurueenqsr occurueenrqs occurueenrsq occurueensrq occurueensqr
occureensqur occureensqru occureensuqr occureensurq occureensruq occureensrqu occureenqsur occureenqsru occureenqusr
occureenqurs occureenqrus occureenqrsu occureenuqsr occureenuqrs occureenusqr occureenusrq occureenursq occureenurqs
occureenrqus occureenrqsu occureenruqs occureenrusq occureenrsuq occureenrsqu occureesnqur occureesnqru occureesnuqr
occureesnurq occureesnruq occureesnrqu occureesqnur occureesqnru occureesqunr occureesqurn occureesqrun occureesqrnu
occureesuqnr occureesuqrn occureesunqr occureesunrq occureesurnq occureesurqn occureesrqun occureesrqnu occureesruqn
occureesrunq occureesrnuq occureesrnqu occureeqsnur occureeqsnru occureeqsunr occureeqsurn occureeqsrun occureeqsrnu
occureeqnsur occureeqnsru occureeqnusr occureeqnurs occureeqnrus occureeqnrsu occureequnsr occureequnrs occureequsnr
occureequsrn occureeqursn occureequrns occureeqrnus occureeqrnsu occureeqruns occureeqrusn occureeqrsun occureeqrsnu
occureeusqnr occureeusqrn occureeusnqr occureeusnrq occureeusrnq occureeusrqn occureeuqsnr occureeuqsrn occureeuqnsr
occureeuqnrs occureeuqrns occureeuqrsn occureeunqsr occureeunqrs occureeunsqr occureeunsrq occureeunrsq occureeunrqs
occureeurqns occureeurqsn occureeurnqs occureeurnsq occureeursnq occureeursqn occureersqun occureersqnu occureersuqn
occureersunq occureersnuq occureersnqu occureerqsun occureerqsnu occureerqusn occureerquns occureerqnus occureerqnsu
occureeruqsn occureeruqns occureerusqn occureerusnq occureerunsq occureerunqs occureernqus occureernqsu occureernuqs
occureernusq occureernsuq occureernsqu occurenesqur occurenesqru occurenesuqr occurenesurq occurenesruq occurenesrqu
occureneqsur occureneqsru occurenequsr occurenequrs occureneqrus occureneqrsu occureneuqsr occureneuqrs occureneusqr
occureneusrq occureneursq occureneurqs occurenerqus occurenerqsu occureneruqs occurenerusq occurenersuq occurenersqu
occurensequr occurenseqru occurenseuqr occurenseurq occurenseruq occurenserqu occurensqeur occurensqeru occurensquer
occurensqure occurensqrue occurensqreu occurensuqer occurensuqre occurensueqr occurensuerq occurensureq occurensurqe
occurensrque occurensrqeu occurensruqe occurensrueq occurensreuq occurensrequ occurenqseur occurenqseru occurenqsuer
occurenqsure occurenqsrue occurenqsreu occurenqesur occurenqesru occurenqeusr occurenqeurs occurenqerus occurenqersu
occurenquesr occurenquers occurenquser occurenqusre occurenqurse occurenqures occurenqreus occurenqresu occurenqrues
occurenqruse occurenqrsue occurenqrseu occurenusqer occurenusqre occurenuseqr occurenuserq occurenusreq occurenusrqe
occurenuqser occurenuqsre occurenuqesr occurenuqers occurenuqres occurenuqrse occurenueqsr occurenueqrs occurenuesqr
occurenuesrq occurenuersq occurenuerqs occurenurqes occurenurqse occurenureqs occurenuresq occurenurseq occurenursqe
occurenrsque occurenrsqeu occurenrsuqe occurenrsueq occurenrseuq occurenrsequ occurenrqsue occurenrqseu occurenrquse
occurenrques occurenrqeus occurenrqesu occurenruqse occurenruqes occurenrusqe occurenruseq occurenruesq occurenrueqs
occurenrequs occurenreqsu occurenreuqs occurenreusq occurenresuq occurenresqu occuresnequr occuresneqru occuresneuqr
occuresneurq occuresneruq occuresnerqu occuresnqeur occuresnqeru occuresnquer occuresnqure occuresnqrue occuresnqreu
occuresnuqer occuresnuqre occuresnueqr occuresnuerq occuresnureq occuresnurqe occuresnrque occuresnrqeu occuresnruqe
occuresnrueq occuresnreuq occuresnrequ occuresenqur occuresenqru occuresenuqr occuresenurq occuresenruq occuresenrqu
occureseqnur occureseqnru occuresequnr occuresequrn occureseqrun occureseqrnu occureseuqnr occureseuqrn occureseunqr
occureseunrq occureseurnq occureseurqn occureserqun occureserqnu occureseruqn occureserunq occuresernuq occuresernqu
occuresqenur occuresqenru occuresqeunr occuresqeurn occuresqerun occuresqernu occuresqneur occuresqneru occuresqnuer
occuresqnure occuresqnrue occuresqnreu occuresquner occuresqunre occuresquenr occuresquern occuresquren occuresqurne
occuresqrnue occuresqrneu occuresqrune occuresqruen occuresqreun occuresqrenu occuresueqnr occuresueqrn occuresuenqr
occuresuenrq occuresuernq occuresuerqn occuresuqenr occuresuqern occuresuqner occuresuqnre occuresuqrne occuresuqren
occuresunqer occuresunqre occuresuneqr occuresunerq occuresunreq occuresunrqe occuresurqne occuresurqen occuresurnqe
occuresurneq occuresurenq occuresureqn occuresrequn occuresreqnu occuresreuqn occuresreunq occuresrenuq occuresrenqu
occuresrqeun occuresrqenu occuresrquen occuresrqune occuresrqnue occuresrqneu occuresruqen occuresruqne occuresrueqn
occuresruenq occuresruneq occuresrunqe occuresrnque occuresrnqeu occuresrnuqe occuresrnueq occuresrneuq occuresrnequ
occureqnseur occureqnseru occureqnsuer occureqnsure occureqnsrue occureqnsreu occureqnesur occureqnesru occureqneusr
occureqneurs occureqnerus occureqnersu occureqnuesr occureqnuers occureqnuser occureqnusre occureqnurse occureqnures
occureqnreus occureqnresu occureqnrues occureqnruse occureqnrsue occureqnrseu occureqsneur occureqsneru occureqsnuer
occureqsnure occureqsnrue occureqsnreu occureqsenur occureqsenru occureqseunr occureqseurn occureqserun occureqsernu
occureqsuenr occureqsuern occureqsuner occureqsunre occureqsurne occureqsuren occureqsreun occureqsrenu occureqsruen
occureqsrune occureqsrnue occureqsrneu occureqesnur occureqesnru occureqesunr occureqesurn occureqesrun occureqesrnu
occureqensur occureqensru occureqenusr occureqenurs occureqenrus occureqenrsu occureqeunsr occureqeunrs occureqeusnr
occureqeusrn occureqeursn occureqeurns occureqernus occureqernsu occureqeruns occureqerusn occureqersun occureqersnu
occurequsenr occurequsern occurequsner occurequsnre occurequsrne occurequsren occurequesnr occurequesrn occurequensr
occurequenrs occurequerns occurequersn occurequnesr occurequners occurequnser occurequnsre occurequnrse occurequnres
occurequrens occurequresn occurequrnes occurequrnse occureqursne occureqursen occureqrseun occureqrsenu occureqrsuen
occureqrsune occureqrsnue occureqrsneu occureqresun occureqresnu occureqreusn occureqreuns occureqrenus occureqrensu
occureqruesn occureqruens occureqrusen occureqrusne occureqrunse occureqrunes occureqrneus occureqrnesu occureqrnues
occureqrnuse occureqrnsue occureqrnseu occureunsqer occureunsqre occureunseqr occureunserq occureunsreq occureunsrqe
occureunqser occureunqsre occureunqesr occureunqers occureunqres occureunqrse occureuneqsr occureuneqrs occureunesqr
occureunesrq occureunersq occureunerqs occureunrqes occureunrqse occureunreqs occureunresq occureunrseq occureunrsqe
occureusnqer occureusnqre occureusneqr occureusnerq occureusnreq occureusnrqe occureusqner occureusqnre occureusqenr
occureusqern occureusqren occureusqrne occureuseqnr occureuseqrn occureusenqr occureusenrq occureusernq occureuserqn
occureusrqen occureusrqne occureusreqn occureusrenq occureusrneq occureusrnqe occureuqsner occureuqsnre occureuqsenr
occureuqsern occureuqsren occureuqsrne occureuqnser occureuqnsre occureuqnesr occureuqners occureuqnres occureuqnrse
occureuqensr occureuqenrs occureuqesnr occureuqesrn occureuqersn occureuqerns occureuqrnes occureuqrnse occureuqrens
occureuqresn occureuqrsen occureuqrsne occureuesqnr occureuesqrn occureuesnqr occureuesnrq occureuesrnq occureuesrqn
occureueqsnr occureueqsrn occureueqnsr occureueqnrs occureueqrns occureueqrsn occureuenqsr occureuenqrs occureuensqr
occureuensrq occureuenrsq occureuenrqs occureuerqns occureuerqsn occureuernqs occureuernsq occureuersnq occureuersqn
occureursqen occureursqne occureurseqn occureursenq occureursneq occureursnqe occureurqsen occureurqsne occureurqesn
occureurqens occureurqnes occureurqnse occureureqsn occureureqns occureuresqn occureuresnq occureurensq occureurenqs
occureurnqes occureurnqse occureurneqs occureurnesq occureurnseq occureurnsqe occurernsque occurernsqeu occurernsuqe
occurernsueq occurernseuq occurernsequ occurernqsue occurernqseu occurernquse occurernques occurernqeus occurernqesu
occurernuqse occurernuqes occurernusqe occurernuseq occurernuesq occurernueqs occurernequs occurerneqsu occurerneuqs
occurerneusq occurernesuq occurernesqu occurersnque occurersnqeu occurersnuqe occurersnueq occurersneuq occurersnequ
occurersqnue occurersqneu occurersqune occurersquen occurersqeun occurersqenu occurersuqne occurersuqen occurersunqe
occurersuneq occurersuenq occurersueqn occurersequn occurerseqnu occurerseuqn occurerseunq occurersenuq occurersenqu
occurerqsnue occurerqsneu occurerqsune occurerqsuen occurerqseun occurerqsenu occurerqnsue occurerqnseu occurerqnuse
occurerqnues occurerqneus occurerqnesu occurerqunse occurerqunes occurerqusne occurerqusen occurerquesn occurerquens
occurerqenus occurerqensu occurerqeuns occurerqeusn occurerqesun occurerqesnu occurerusqne occurerusqen occurerusnqe
occurerusneq occurerusenq occureruseqn occureruqsne occureruqsen occureruqnse occureruqnes occureruqens occureruqesn
occurerunqse occurerunqes occurerunsqe occurerunseq occurerunesq occureruneqs occurerueqns occurerueqsn occureruenqs
occureruensq occureruesnq occureruesqn occureresqun occureresqnu occureresuqn occureresunq occureresnuq occureresnqu
occurereqsun occurereqsnu occurerequsn occurerequns occurereqnus occurereqnsu occurereuqsn occurereuqns occurereusqn
occurereusnq occurereunsq occurereunqs occurerenqus occurerenqsu occurerenuqs occurerenusq occurerensuq occurerensqu

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us