easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

unartificiality

bignesses

vigils

walburn

losito

harton

appellavimusque

classily

unpoison

walrus

woitach

igloos

vocaltones

sialadenitis

zarnich

tolleruntque

oviparity

individualists


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: observer
cipher variations:
pctfswfs qdugtxgt revhuyhu sfwivziv tgxjwajw
uhykxbkx vizlycly wjamzdmz xkbnaena ylcobfob
zmdpcgpc aneqdhqd bofreire cpgsfjsf dqhtgktg
eriuhluh fsjvimvi gtkwjnwj hulxkoxk ivmylpyl
jwnzmqzm kxoanran lypbosbo mzqcptcp nardqudq

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: observer
Cipher: lyhvievi

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: observer
Cipher: ABBAB AAAAB BAAAB AABAA BAAAA BBBAB AABAA BAAAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: observer
cipher variations:
pctfswfsrednamnatgnvicvivixdqsdqxkhlyilyzmrtgytgdqljwejwfsvreure
hufzmkzmjwphuahulyzpcqpcnajxkgxkqdugtxgtsfeobnobuhowjdwjwjyerter
ylimzjmzansuhzuhermkxfkxgtwsfvsfivganlankxqivbivmzaqdrqdobkylhyl
revhuyhutgfpcopcvipxkexkxkzfsufszmjnaknabotviavifsnlyglyhuxtgwtg
jwhbombolyrjwcjwnabresrepclzmizmsfwivzivuhgqdpqdwjqylfylylagtvgt
ankoblobcpuwjbwjgtomzhmzivyuhxuhkxicpncpmzskxdkxobcsftsfqdmanjan
tgxjwajwvihreqrexkrzmgzmzmbhuwhubolpcmpcdqvxkcxkhupnainajwzviyvi
lyjdqodqnatlyelypcdtgutgrenbokbouhykxbkxwjisfrsfylsanhanancivxiv
cpmqdnqderwyldylivqobjobkxawjzwjmzkerperobumzfmzqdeuhvuhsfocplcp
vizlyclyxkjtgstgzmtboibobodjwyjwdqnreorefsxzmezmjwrpckpclybxkaxk
nalfsqfspcvnagnarefviwvitgpdqmdqwjamzdmzylkuhtuhanucpjcpcpekxzkx
erosfpsfgtyanfankxsqdlqdmzcylbylobmgtrgtqdwobhobsfgwjxwjuhqerner
xkbnaenazmlviuvibovdqkdqdqflyalyfsptgqtghuzbogbolytremrenadzmczm
pcnhushurexpcipctghxkyxkvirfsofsylcobfobanmwjvwjcpwerlerergmzbmz
gtquhruhivacphcpmzusfnsfobeandanqdoivtivsfyqdjqduhiylzylwjsgtpgt
zmdpcgpcbonxkwxkdqxfsmfsfshnacnahurvisvijwbdqidqnavtgotgpcfboebo
repjwujwtgzrekrevijzmazmxkthuqhuaneqdhqdcpoylxylerygtngtgtiobdob
ivswjtwjkxcerjerobwuhpuhqdgcpfcpsfqkxvkxuhasflsfwjkanbanyluivriv
bofreiredqpzmyzmfszhuohuhujpcepcjwtxkuxklydfskfspcxviqvirehdqgdq
tgrlywlyvibtgmtgxklbocbozmvjwsjwcpgsfjsferqanzangtaivpivivkqdfqd
kxuylvylmzegtlgtqdywjrwjsfierheruhsmzxmzwjcuhnuhylmcpdcpanwkxtkx
dqhtgktgfsrboabohubjwqjwjwlregrelyvzmwzmnafhumhurezxksxktgjfsifs
vitnaynaxkdviovizmndqedqboxlyulyeriuhluhgtscpbcpivckxrkxkxmsfhsf
mzwanxanobgivnivsfayltyluhkgtjgtwjuobzobylewjpwjanoerfercpymzvmz
fsjvimvihutdqcdqjwdlyslylyntgitgnaxboybopchjwojwtgbzmuzmvilhukhu
xkvpcapczmfxkqxkbopfsgfsdqznawnagtkwjnwjivuerderkxemztmzmzouhjuh
obycpzcpqdikxpkxuhcanvanwjmivlivylwqdbqdangylrylcpqgthgteraobxob
hulxkoxkjwvfsefslyfnaunanapvikvipczdqadqrejlyqlyvidbowboxknjwmjw
zmxrecrebohzmszmdqrhuihufsbpcypcivmylpylkxwgtfgtmzgobvobobqwjlwj
qdaerbersfkmzrmzwjecpxcpylokxnkxanysfdsfcpiantanersivjivgtcqdzqd
jwnzmqzmlyxhughunahpcwpcpcrxkmxkrebfscfstglnasnaxkfdqydqzmplyoly
boztgetgdqjboubofstjwkjwhudrearekxoanranmzyivhivobiqdxqdqdsylnyl
sfcgtdgtuhmobtobylgerzeranqmzpmzcpauhfuherkcpvcpgtukxlkxivesfbsf
lypbosbonazjwijwpcjreyreretzmozmtgdhuehuvinpcupczmhfsafsbornaqna
dqbvigvifsldqwdqhuvlymlyjwftgctgmzqcptcpobakxjkxqdksfzsfsfuanpan
uheivfivwjoqdvqdanigtbgtcpsobrobercwjhwjgtmerxerivwmznmzkxguhduh
nardqudqpcblyklyreltgatgtgvboqbovifjwgjwxkprewrebojhuchudqtpcspc
fsdxkixkhunfsyfsjwxnaonalyhvieviobserverqdcmzlmzsfmuhbuhuhwcprcp
wjgkxhkxylqsfxsfcpkivdiveruqdtqdgteyljylivogtzgtkxyobpobmziwjfwj

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: observer
Cipher: bofreire

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: observer
Cipher: 4321345124155124

Extended Methods:
Method #1

Plaintext: observer
method variations:
tgxkwakwymcpbfpbdrhuglugiwnzmqzm

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
o b s e r v e r 
4 2 3 5 2 1 5 2 
3 1 4 1 4 5 1 4 
They are then read out in rows:
4235215231414514
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: observer
Cipher: ixbkcdyq

Read more ...
Method #3

Plaintext: observer
method variations:
hlyfdzft lyfdzfth yfdzfthl
fdzfthly dzfthlyf zfthlyfd
fthlyfdz thlyfdzf

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: observer

first 5040 cipher variations(40320 total)
observer observre obserevr obsererv obserrev obserrve obsevrer obsevrre obseverr obseverr obsevrer
obsevrre obseevrr obseevrr obseervr obseerrv obseerrv obseervr observer observre obserevr obsererv
obserrev obserrve obsrever obsrevre obsreevr obsreerv obsrerev obsrerve obsrveer obsrvere obsrveer
obsrvere obsrvree obsrvree obsrever obsrevre obsreevr obsreerv obsrerev obsrerve obsrrvee obsrrvee
obsrreve obsrreev obsrreev obsrreve obsvreer obsvrere obsvreer obsvrere obsvrree obsvrree obsverer
obsverre obsveerr obsveerr obsverer obsverre obsveerr obsveerr obsverer obsverre obsverre obsverer
obsvreer obsvrere obsvreer obsvrere obsvrree obsvrree observer observre obserevr obsererv obserrev
obserrve obsevrer obsevrre obseverr obseverr obsevrer obsevrre obseevrr obseevrr obseervr obseerrv
obseerrv obseervr observer observre obserevr obsererv obserrev obserrve obsrrvee obsrrvee obsrreve
obsrreev obsrreev obsrreve obsrvree obsrvree obsrvere obsrveer obsrveer obsrvere obsrevre obsrever
obsrerve obsrerev obsreerv obsreevr obsrever obsrevre obsreevr obsreerv obsrerev obsrerve obesrver
obesrvre obesrevr obesrerv obesrrev obesrrve obesvrer obesvrre obesverr obesverr obesvrer obesvrre
obesevrr obesevrr obeservr obeserrv obeserrv obeservr obesrver obesrvre obesrevr obesrerv obesrrev
obesrrve obersver obersvre obersevr oberserv obersrev obersrve obervser obervsre obervesr obervers
obervres obervrse oberevsr oberevrs oberesvr oberesrv oberersv oberervs oberrves oberrvse oberrevs
oberresv oberrsev oberrsve obevrser obevrsre obevresr obevrers obevrres obevrrse obevsrer obevsrre
obevserr obevserr obevsrer obevsrre obevesrr obevesrr obeversr obeverrs obeverrs obeversr obevrser
obevrsre obevresr obevrers obevrres obevrrse obeervsr obeervrs obeersvr obeersrv obeerrsv obeerrvs
obeevrsr obeevrrs obeevsrr obeevsrr obeevrsr obeevrrs obeesvrr obeesvrr obeesrvr obeesrrv obeesrrv
obeesrvr obeervsr obeervrs obeersvr obeersrv obeerrsv obeerrvs oberrves oberrvse oberrevs oberresv
oberrsev oberrsve obervres obervrse obervers obervesr obervser obervsre oberevrs oberevsr oberervs
oberersv oberesrv oberesvr obersver obersvre obersevr oberserv obersrev obersrve obresver obresvre
obresevr obreserv obresrev obresrve obrevser obrevsre obrevesr obrevers obrevres obrevrse obreevsr
obreevrs obreesvr obreesrv obreersv obreervs obrerves obrervse obrerevs obreresv obrersev obrersve
obrsever obrsevre obrseevr obrseerv obrserev obrserve obrsveer obrsvere obrsveer obrsvere obrsvree
obrsvree obrsever obrsevre obrseevr obrseerv obrserev obrserve obrsrvee obrsrvee obrsreve obrsreev
obrsreev obrsreve obrvseer obrvsere obrvseer obrvsere obrvsree obrvsree obrveser obrvesre obrveesr
obrveers obrveres obrverse obrveesr obrveers obrveser obrvesre obrverse obrveres obrvrees obrvrese
obrvrees obrvrese obrvrsee obrvrsee obresver obresvre obresevr obreserv obresrev obresrve obrevser
obrevsre obrevesr obrevers obrevres obrevrse obreevsr obreevrs obreesvr obreesrv obreersv obreervs
obrerves obrervse obrerevs obreresv obrersev obrersve obrrsvee obrrsvee obrrseve obrrseev obrrseev
obrrseve obrrvsee obrrvsee obrrvese obrrvees obrrvees obrrvese obrrevse obrreves obrresve obrresev
obrreesv obrreevs obrreves obrrevse obrreevs obrreesv obrresev obrresve obverser obversre obveresr
obverers obverres obverrse obvesrer obvesrre obveserr obveserr obvesrer obvesrre obveesrr obveesrr
obveersr obveerrs obveerrs obveersr obverser obversre obveresr obverers obverres obverrse obvreser
obvresre obvreesr obvreers obvreres obvrerse obvrseer obvrsere obvrseer obvrsere obvrsree obvrsree
obvreser obvresre obvreesr obvreers obvreres obvrerse obvrrsee obvrrsee obvrrese obvrrees obvrrees
obvrrese obvsreer obvsrere obvsreer obvsrere obvsrree obvsrree obvserer obvserre obvseerr obvseerr
obvserer obvserre obvseerr obvseerr obvserer obvserre obvserre obvserer obvsreer obvsrere obvsreer
obvsrere obvsrree obvsrree obverser obversre obveresr obverers obverres obverrse obvesrer obvesrre
obveserr obveserr obvesrer obvesrre obveesrr obveesrr obveersr obveerrs obveerrs obveersr obverser
obversre obveresr obverers obverres obverrse obvrrsee obvrrsee obvrrese obvrrees obvrrees obvrrese
obvrsree obvrsree obvrsere obvrseer obvrseer obvrsere obvresre obvreser obvrerse obvreres obvreers
obvreesr obvreser obvresre obvreesr obvreers obvreres obvrerse obeervsr obeervrs obeersvr obeersrv
obeerrsv obeerrvs obeevrsr obeevrrs obeevsrr obeevsrr obeevrsr obeevrrs obeesvrr obeesvrr obeesrvr
obeesrrv obeesrrv obeesrvr obeervsr obeervrs obeersvr obeersrv obeerrsv obeerrvs oberevsr oberevrs
oberesvr oberesrv oberersv oberervs obervesr obervers obervser obervsre obervrse obervres obersver
obersvre obersevr oberserv obersrev obersrve oberrvse oberrves oberrsve oberrsev oberresv oberrevs
obevresr obevrers obevrser obevrsre obevrrse obevrres obeversr obeverrs obevesrr obevesrr obeversr
obeverrs obevserr obevserr obevsrer obevsrre obevsrre obevsrer obevresr obevrers obevrser obevrsre
obevrrse obevrres obesrver obesrvre obesrevr obesrerv obesrrev obesrrve obesvrer obesvrre obesverr
obesverr obesvrer obesvrre obesevrr obesevrr obeservr obeserrv obeserrv obeservr obesrver obesrvre
obesrevr obesrerv obesrrev obesrrve oberrvse oberrves oberrsve oberrsev oberresv oberrevs obervrse
obervres obervsre obervser obervesr obervers obersvre obersver obersrve obersrev oberserv obersevr
oberevsr oberevrs oberesvr oberesrv oberersv oberervs obrerves obrervse obrerevs obreresv obrersev
obrersve obrevres obrevrse obrevers obrevesr obrevser obrevsre obreevrs obreevsr obreervs obreersv
obreesrv obreesvr obresver obresvre obresevr obreserv obresrev obresrve obrreves obrrevse obrreevs
obrreesv obrresev obrresve obrrvees obrrvese obrrvees obrrvese obrrvsee obrrvsee obrreves obrrevse
obrreevs obrreesv obrresev obrresve obrrsvee obrrsvee obrrseve obrrseev obrrseev obrrseve obrvrees
obrvrese obrvrees obrvrese obrvrsee obrvrsee obrveres obrverse obrveers obrveesr obrveser obrvesre
obrveers obrveesr obrveres obrverse obrvesre obrveser obrvseer obrvsere obrvseer obrvsere obrvsree
obrvsree obrerves obrervse obrerevs obreresv obrersev obrersve obrevres obrevrse obrevers obrevesr
obrevser obrevsre obreevrs obreevsr obreervs obreersv obreesrv obreesvr obresver obresvre obresevr
obreserv obresrev obresrve obrsrvee obrsrvee obrsreve obrsreev obrsreev obrsreve obrsvree obrsvree
obrsvere obrsveer obrsveer obrsvere obrsevre obrsever obrserve obrserev obrseerv obrseevr obrsever
obrsevre obrseevr obrseerv obrserev obrserve osberver osbervre osberevr osbererv osberrev osberrve
osbevrer osbevrre osbeverr osbeverr osbevrer osbevrre osbeevrr osbeevrr osbeervr osbeerrv osbeerrv
osbeervr osberver osbervre osberevr osbererv osberrev osberrve osbrever osbrevre osbreevr osbreerv
osbrerev osbrerve osbrveer osbrvere osbrveer osbrvere osbrvree osbrvree osbrever osbrevre osbreevr
osbreerv osbrerev osbrerve osbrrvee osbrrvee osbrreve osbrreev osbrreev osbrreve osbvreer osbvrere
osbvreer osbvrere osbvrree osbvrree osbverer osbverre osbveerr osbveerr osbverer osbverre osbveerr
osbveerr osbverer osbverre osbverre osbverer osbvreer osbvrere osbvreer osbvrere osbvrree osbvrree
osberver osbervre osberevr osbererv osberrev osberrve osbevrer osbevrre osbeverr osbeverr osbevrer
osbevrre osbeevrr osbeevrr osbeervr osbeerrv osbeerrv osbeervr osberver osbervre osberevr osbererv
osberrev osberrve osbrrvee osbrrvee osbrreve osbrreev osbrreev osbrreve osbrvree osbrvree osbrvere
osbrveer osbrveer osbrvere osbrevre osbrever osbrerve osbrerev osbreerv osbreevr osbrever osbrevre
osbreevr osbreerv osbrerev osbrerve osebrver osebrvre osebrevr osebrerv osebrrev osebrrve osebvrer
osebvrre osebverr osebverr osebvrer osebvrre osebevrr osebevrr osebervr oseberrv oseberrv osebervr
osebrver osebrvre osebrevr osebrerv osebrrev osebrrve oserbver oserbvre oserbevr oserberv oserbrev
oserbrve oservber oservbre oservebr oserverb oservreb oservrbe oserevbr oserevrb oserebvr oserebrv
osererbv oserervb oserrveb oserrvbe oserrevb oserrebv oserrbev oserrbve osevrber osevrbre osevrebr
osevrerb osevrreb osevrrbe osevbrer osevbrre osevberr osevberr osevbrer osevbrre osevebrr osevebrr
oseverbr oseverrb oseverrb oseverbr osevrber osevrbre osevrebr osevrerb osevrreb osevrrbe oseervbr
oseervrb oseerbvr oseerbrv oseerrbv oseerrvb oseevrbr oseevrrb oseevbrr oseevbrr oseevrbr oseevrrb
oseebvrr oseebvrr oseebrvr oseebrrv oseebrrv oseebrvr oseervbr oseervrb oseerbvr oseerbrv oseerrbv
oseerrvb oserrveb oserrvbe oserrevb oserrebv oserrbev oserrbve oservreb oservrbe oserverb oservebr
oservber oservbre oserevrb oserevbr oserervb osererbv oserebrv oserebvr oserbver oserbvre oserbevr
oserberv oserbrev oserbrve osrebver osrebvre osrebevr osreberv osrebrev osrebrve osrevber osrevbre
osrevebr osreverb osrevreb osrevrbe osreevbr osreevrb osreebvr osreebrv osreerbv osreervb osrerveb
osrervbe osrerevb osrerebv osrerbev osrerbve osrbever osrbevre osrbeevr osrbeerv osrberev osrberve
osrbveer osrbvere osrbveer osrbvere osrbvree osrbvree osrbever osrbevre osrbeevr osrbeerv osrberev
osrberve osrbrvee osrbrvee osrbreve osrbreev osrbreev osrbreve osrvbeer osrvbere osrvbeer osrvbere
osrvbree osrvbree osrveber osrvebre osrveebr osrveerb osrvereb osrverbe osrveebr osrveerb osrveber
osrvebre osrverbe osrvereb osrvreeb osrvrebe osrvreeb osrvrebe osrvrbee osrvrbee osrebver osrebvre
osrebevr osreberv osrebrev osrebrve osrevber osrevbre osrevebr osreverb osrevreb osrevrbe osreevbr
osreevrb osreebvr osreebrv osreerbv osreervb osrerveb osrervbe osrerevb osrerebv osrerbev osrerbve
osrrbvee osrrbvee osrrbeve osrrbeev osrrbeev osrrbeve osrrvbee osrrvbee osrrvebe osrrveeb osrrveeb
osrrvebe osrrevbe osrreveb osrrebve osrrebev osrreebv osrreevb osrreveb osrrevbe osrreevb osrreebv
osrrebev osrrebve osverber osverbre osverebr osvererb osverreb osverrbe osvebrer osvebrre osveberr
osveberr osvebrer osvebrre osveebrr osveebrr osveerbr osveerrb osveerrb osveerbr osverber osverbre
osverebr osvererb osverreb osverrbe osvreber osvrebre osvreebr osvreerb osvrereb osvrerbe osvrbeer
osvrbere osvrbeer osvrbere osvrbree osvrbree osvreber osvrebre osvreebr osvreerb osvrereb osvrerbe
osvrrbee osvrrbee osvrrebe osvrreeb osvrreeb osvrrebe osvbreer osvbrere osvbreer osvbrere osvbrree
osvbrree osvberer osvberre osvbeerr osvbeerr osvberer osvberre osvbeerr osvbeerr osvberer osvberre
osvberre osvberer osvbreer osvbrere osvbreer osvbrere osvbrree osvbrree osverber osverbre osverebr
osvererb osverreb osverrbe osvebrer osvebrre osveberr osveberr osvebrer osvebrre osveebrr osveebrr
osveerbr osveerrb osveerrb osveerbr osverber osverbre osverebr osvererb osverreb osverrbe osvrrbee
osvrrbee osvrrebe osvrreeb osvrreeb osvrrebe osvrbree osvrbree osvrbere osvrbeer osvrbeer osvrbere
osvrebre osvreber osvrerbe osvrereb osvreerb osvreebr osvreber osvrebre osvreebr osvreerb osvrereb
osvrerbe oseervbr oseervrb oseerbvr oseerbrv oseerrbv oseerrvb oseevrbr oseevrrb oseevbrr oseevbrr
oseevrbr oseevrrb oseebvrr oseebvrr oseebrvr oseebrrv oseebrrv oseebrvr oseervbr oseervrb oseerbvr
oseerbrv oseerrbv oseerrvb oserevbr oserevrb oserebvr oserebrv osererbv oserervb oservebr oserverb
oservber oservbre oservrbe oservreb oserbver oserbvre oserbevr oserberv oserbrev oserbrve oserrvbe
oserrveb oserrbve oserrbev oserrebv oserrevb osevrebr osevrerb osevrber osevrbre osevrrbe osevrreb
oseverbr oseverrb osevebrr osevebrr oseverbr oseverrb osevberr osevberr osevbrer osevbrre osevbrre
osevbrer osevrebr osevrerb osevrber osevrbre osevrrbe osevrreb osebrver osebrvre osebrevr osebrerv
osebrrev osebrrve osebvrer osebvrre osebverr osebverr osebvrer osebvrre osebevrr osebevrr osebervr
oseberrv oseberrv osebervr osebrver osebrvre osebrevr osebrerv osebrrev osebrrve oserrvbe oserrveb
oserrbve oserrbev oserrebv oserrevb oservrbe oservreb oservbre oservber oservebr oserverb oserbvre
oserbver oserbrve oserbrev oserberv oserbevr oserevbr oserevrb oserebvr oserebrv osererbv oserervb
osrerveb osrervbe osrerevb osrerebv osrerbev osrerbve osrevreb osrevrbe osreverb osrevebr osrevber
osrevbre osreevrb osreevbr osreervb osreerbv osreebrv osreebvr osrebver osrebvre osrebevr osreberv
osrebrev osrebrve osrreveb osrrevbe osrreevb osrreebv osrrebev osrrebve osrrveeb osrrvebe osrrveeb
osrrvebe osrrvbee osrrvbee osrreveb osrrevbe osrreevb osrreebv osrrebev osrrebve osrrbvee osrrbvee
osrrbeve osrrbeev osrrbeev osrrbeve osrvreeb osrvrebe osrvreeb osrvrebe osrvrbee osrvrbee osrvereb
osrverbe osrveerb osrveebr osrveber osrvebre osrveerb osrveebr osrvereb osrverbe osrvebre osrveber
osrvbeer osrvbere osrvbeer osrvbere osrvbree osrvbree osrerveb osrervbe osrerevb osrerebv osrerbev
osrerbve osrevreb osrevrbe osreverb osrevebr osrevber osrevbre osreevrb osreevbr osreervb osreerbv
osreebrv osreebvr osrebver osrebvre osrebevr osreberv osrebrev osrebrve osrbrvee osrbrvee osrbreve
osrbreev osrbreev osrbreve osrbvree osrbvree osrbvere osrbveer osrbveer osrbvere osrbevre osrbever
osrberve osrberev osrbeerv osrbeevr osrbever osrbevre osrbeevr osrbeerv osrberev osrberve oesbrver
oesbrvre oesbrevr oesbrerv oesbrrev oesbrrve oesbvrer oesbvrre oesbverr oesbverr oesbvrer oesbvrre
oesbevrr oesbevrr oesbervr oesberrv oesberrv oesbervr oesbrver oesbrvre oesbrevr oesbrerv oesbrrev
oesbrrve oesrbver oesrbvre oesrbevr oesrberv oesrbrev oesrbrve oesrvber oesrvbre oesrvebr oesrverb
oesrvreb oesrvrbe oesrevbr oesrevrb oesrebvr oesrebrv oesrerbv oesrervb oesrrveb oesrrvbe oesrrevb
oesrrebv oesrrbev oesrrbve oesvrber oesvrbre oesvrebr oesvrerb oesvrreb oesvrrbe oesvbrer oesvbrre
oesvberr oesvberr oesvbrer oesvbrre oesvebrr oesvebrr oesverbr oesverrb oesverrb oesverbr oesvrber
oesvrbre oesvrebr oesvrerb oesvrreb oesvrrbe oeservbr oeservrb oeserbvr oeserbrv oeserrbv oeserrvb
oesevrbr oesevrrb oesevbrr oesevbrr oesevrbr oesevrrb oesebvrr oesebvrr oesebrvr oesebrrv oesebrrv
oesebrvr oeservbr oeservrb oeserbvr oeserbrv oeserrbv oeserrvb oesrrveb oesrrvbe oesrrevb oesrrebv
oesrrbev oesrrbve oesrvreb oesrvrbe oesrverb oesrvebr oesrvber oesrvbre oesrevrb oesrevbr oesrervb
oesrerbv oesrebrv oesrebvr oesrbver oesrbvre oesrbevr oesrberv oesrbrev oesrbrve oebsrver oebsrvre
oebsrevr oebsrerv oebsrrev oebsrrve oebsvrer oebsvrre oebsverr oebsverr oebsvrer oebsvrre oebsevrr
oebsevrr oebservr oebserrv oebserrv oebservr oebsrver oebsrvre oebsrevr oebsrerv oebsrrev oebsrrve
oebrsver oebrsvre oebrsevr oebrserv oebrsrev oebrsrve oebrvser oebrvsre oebrvesr oebrvers oebrvres
oebrvrse oebrevsr oebrevrs oebresvr oebresrv oebrersv oebrervs oebrrves oebrrvse oebrrevs oebrresv
oebrrsev oebrrsve oebvrser oebvrsre oebvresr oebvrers oebvrres oebvrrse oebvsrer oebvsrre oebvserr
oebvserr oebvsrer oebvsrre oebvesrr oebvesrr oebversr oebverrs oebverrs oebversr oebvrser oebvrsre
oebvresr oebvrers oebvrres oebvrrse oebervsr oebervrs oebersvr oebersrv oeberrsv oeberrvs oebevrsr
oebevrrs oebevsrr oebevsrr oebevrsr oebevrrs oebesvrr oebesvrr oebesrvr oebesrrv oebesrrv oebesrvr
oebervsr oebervrs oebersvr oebersrv oeberrsv oeberrvs oebrrves oebrrvse oebrrevs oebrresv oebrrsev
oebrrsve oebrvres oebrvrse oebrvers oebrvesr oebrvser oebrvsre oebrevrs oebrevsr oebrervs oebrersv
oebresrv oebresvr oebrsver oebrsvre oebrsevr oebrserv oebrsrev oebrsrve oerbsver oerbsvre oerbsevr
oerbserv oerbsrev oerbsrve oerbvser oerbvsre oerbvesr oerbvers oerbvres oerbvrse oerbevsr oerbevrs
oerbesvr oerbesrv oerbersv oerbervs oerbrves oerbrvse oerbrevs oerbresv oerbrsev oerbrsve oersbver
oersbvre oersbevr oersberv oersbrev oersbrve oersvber oersvbre oersvebr oersverb oersvreb oersvrbe
oersevbr oersevrb oersebvr oersebrv oerserbv oerservb oersrveb oersrvbe oersrevb oersrebv oersrbev
oersrbve oervsber oervsbre oervsebr oervserb oervsreb oervsrbe oervbser oervbsre oervbesr oervbers
oervbres oervbrse oervebsr oervebrs oervesbr oervesrb oerversb oerverbs oervrbes oervrbse oervrebs
oervresb oervrseb oervrsbe oeresvbr oeresvrb oeresbvr oeresbrv oeresrbv oeresrvb oerevsbr oerevsrb
oerevbsr oerevbrs oerevrbs oerevrsb oerebvsr oerebvrs oerebsvr oerebsrv oerebrsv oerebrvs oerervbs
oerervsb oererbvs oererbsv oerersbv oerersvb oerrsveb oerrsvbe oerrsevb oerrsebv oerrsbev oerrsbve
oerrvseb oerrvsbe oerrvesb oerrvebs oerrvbes oerrvbse oerrevsb oerrevbs oerresvb oerresbv oerrebsv
oerrebvs oerrbves oerrbvse oerrbevs oerrbesv oerrbsev oerrbsve oevbrser oevbrsre oevbresr oevbrers
oevbrres oevbrrse oevbsrer oevbsrre oevbserr oevbserr oevbsrer oevbsrre oevbesrr oevbesrr oevbersr
oevberrs oevberrs oevbersr oevbrser oevbrsre oevbresr oevbrers oevbrres oevbrrse oevrbser oevrbsre
oevrbesr oevrbers oevrbres oevrbrse oevrsber oevrsbre oevrsebr oevrserb oevrsreb oevrsrbe oevresbr
oevresrb oevrebsr oevrebrs oevrerbs oevrersb oevrrseb oevrrsbe oevrresb oevrrebs oevrrbes oevrrbse
oevsrber oevsrbre oevsrebr oevsrerb oevsrreb oevsrrbe oevsbrer oevsbrre oevsberr oevsberr oevsbrer
oevsbrre oevsebrr oevsebrr oevserbr oevserrb oevserrb oevserbr oevsrber oevsrbre oevsrebr oevsrerb
oevsrreb oevsrrbe oeversbr oeversrb oeverbsr oeverbrs oeverrbs oeverrsb oevesrbr oevesrrb oevesbrr
oevesbrr oevesrbr oevesrrb oevebsrr oevebsrr oevebrsr oevebrrs oevebrrs oevebrsr oeversbr oeversrb
oeverbsr oeverbrs oeverrbs oeverrsb oevrrseb oevrrsbe oevrresb oevrrebs oevrrbes oevrrbse oevrsreb
oevrsrbe oevrserb oevrsebr oevrsber oevrsbre oevresrb oevresbr oevrersb oevrerbs oevrebrs oevrebsr
oevrbser oevrbsre oevrbesr oevrbers oevrbres oevrbrse oeebrvsr oeebrvrs oeebrsvr oeebrsrv oeebrrsv
oeebrrvs oeebvrsr oeebvrrs oeebvsrr oeebvsrr oeebvrsr oeebvrrs oeebsvrr oeebsvrr oeebsrvr oeebsrrv
oeebsrrv oeebsrvr oeebrvsr oeebrvrs oeebrsvr oeebrsrv oeebrrsv oeebrrvs oeerbvsr oeerbvrs oeerbsvr
oeerbsrv oeerbrsv oeerbrvs oeervbsr oeervbrs oeervsbr oeervsrb oeervrsb oeervrbs oeersvbr oeersvrb
oeersbvr oeersbrv oeersrbv oeersrvb oeerrvsb oeerrvbs oeerrsvb oeerrsbv oeerrbsv oeerrbvs oeevrbsr
oeevrbrs oeevrsbr oeevrsrb oeevrrsb oeevrrbs oeevbrsr oeevbrrs oeevbsrr oeevbsrr oeevbrsr oeevbrrs
oeevsbrr oeevsbrr oeevsrbr oeevsrrb oeevsrrb oeevsrbr oeevrbsr oeevrbrs oeevrsbr oeevrsrb oeevrrsb
oeevrrbs oeesrvbr oeesrvrb oeesrbvr oeesrbrv oeesrrbv oeesrrvb oeesvrbr oeesvrrb oeesvbrr oeesvbrr
oeesvrbr oeesvrrb oeesbvrr oeesbvrr oeesbrvr oeesbrrv oeesbrrv oeesbrvr oeesrvbr oeesrvrb oeesrbvr
oeesrbrv oeesrrbv oeesrrvb oeerrvsb oeerrvbs oeerrsvb oeerrsbv oeerrbsv oeerrbvs oeervrsb oeervrbs
oeervsrb oeervsbr oeervbsr oeervbrs oeersvrb oeersvbr oeersrvb oeersrbv oeersbrv oeersbvr oeerbvsr
oeerbvrs oeerbsvr oeerbsrv oeerbrsv oeerbrvs oerbrves oerbrvse oerbrevs oerbresv oerbrsev oerbrsve
oerbvres oerbvrse oerbvers oerbvesr oerbvser oerbvsre oerbevrs oerbevsr oerbervs oerbersv oerbesrv
oerbesvr oerbsver oerbsvre oerbsevr oerbserv oerbsrev oerbsrve oerrbves oerrbvse oerrbevs oerrbesv
oerrbsev oerrbsve oerrvbes oerrvbse oerrvebs oerrvesb oerrvseb oerrvsbe oerrevbs oerrevsb oerrebvs
oerrebsv oerresbv oerresvb oerrsveb oerrsvbe oerrsevb oerrsebv oerrsbev oerrsbve oervrbes oervrbse
oervrebs oervresb oervrseb oervrsbe oervbres oervbrse oervbers oervbesr oervbser oervbsre oervebrs
oervebsr oerverbs oerversb oervesrb oervesbr oervsber oervsbre oervsebr oervserb oervsreb oervsrbe
oerervbs oerervsb oererbvs oererbsv oerersbv oerersvb oerevrbs oerevrsb oerevbrs oerevbsr oerevsbr
oerevsrb oerebvrs oerebvsr oerebrvs oerebrsv oerebsrv oerebsvr oeresvbr oeresvrb oeresbvr oeresbrv
oeresrbv oeresrvb oersrveb oersrvbe oersrevb oersrebv oersrbev oersrbve oersvreb oersvrbe oersverb
oersvebr oersvber oersvbre oersevrb oersevbr oerservb oerserbv oersebrv oersebvr oersbver oersbvre
oersbevr oersberv oersbrev oersbrve orsebver orsebvre orsebevr orseberv orsebrev orsebrve orsevber
orsevbre orsevebr orseverb orsevreb orsevrbe orseevbr orseevrb orseebvr orseebrv orseerbv orseervb
orserveb orservbe orserevb orserebv orserbev orserbve orsbever orsbevre orsbeevr orsbeerv orsberev
orsberve orsbveer orsbvere orsbveer orsbvere orsbvree orsbvree orsbever orsbevre orsbeevr orsbeerv
orsberev orsberve orsbrvee orsbrvee orsbreve orsbreev orsbreev orsbreve orsvbeer orsvbere orsvbeer
orsvbere orsvbree orsvbree orsveber orsvebre orsveebr orsveerb orsvereb orsverbe orsveebr orsveerb
orsveber orsvebre orsverbe orsvereb orsvreeb orsvrebe orsvreeb orsvrebe orsvrbee orsvrbee orsebver
orsebvre orsebevr orseberv orsebrev orsebrve orsevber orsevbre orsevebr orseverb orsevreb orsevrbe
orseevbr orseevrb orseebvr orseebrv orseerbv orseervb orserveb orservbe orserevb orserebv orserbev
orserbve orsrbvee orsrbvee orsrbeve orsrbeev orsrbeev orsrbeve orsrvbee orsrvbee orsrvebe orsrveeb
orsrveeb orsrvebe orsrevbe orsreveb orsrebve orsrebev orsreebv orsreevb orsreveb orsrevbe orsreevb
orsreebv orsrebev orsrebve oresbver oresbvre oresbevr oresberv oresbrev oresbrve oresvber oresvbre
oresvebr oresverb oresvreb oresvrbe oresevbr oresevrb oresebvr oresebrv oreserbv oreservb oresrveb
oresrvbe oresrevb oresrebv oresrbev oresrbve orebsver orebsvre orebsevr orebserv orebsrev orebsrve
orebvser orebvsre orebvesr orebvers orebvres orebvrse orebevsr orebevrs orebesvr orebesrv orebersv
orebervs orebrves orebrvse orebrevs orebresv orebrsev orebrsve orevbser orevbsre orevbesr orevbers
orevbres orevbrse orevsber orevsbre orevsebr orevserb orevsreb orevsrbe orevesbr orevesrb orevebsr
orevebrs oreverbs oreversb orevrseb orevrsbe orevresb orevrebs orevrbes orevrbse oreebvsr oreebvrs
oreebsvr oreebsrv oreebrsv oreebrvs oreevbsr oreevbrs oreevsbr oreevsrb oreevrsb oreevrbs oreesvbr
oreesvrb oreesbvr oreesbrv oreesrbv oreesrvb oreervsb oreervbs oreersvb oreersbv oreerbsv oreerbvs
orerbves orerbvse orerbevs orerbesv orerbsev orerbsve orervbes orervbse orervebs orervesb orervseb
orervsbe orerevbs orerevsb orerebvs orerebsv oreresbv oreresvb orersveb orersvbe orersevb orersebv
orersbev orersbve orbesver orbesvre orbesevr orbeserv orbesrev orbesrve orbevser orbevsre orbevesr
orbevers orbevres orbevrse orbeevsr orbeevrs orbeesvr orbeesrv orbeersv orbeervs orberves orbervse
orberevs orberesv orbersev orbersve orbsever orbsevre orbseevr orbseerv orbserev orbserve orbsveer
orbsvere orbsveer orbsvere orbsvree orbsvree orbsever orbsevre orbseevr orbseerv orbserev orbserve
orbsrvee orbsrvee orbsreve orbsreev orbsreev orbsreve orbvseer orbvsere orbvseer orbvsere orbvsree
orbvsree orbveser orbvesre orbveesr orbveers orbveres orbverse orbveesr orbveers orbveser orbvesre
orbverse orbveres orbvrees orbvrese orbvrees orbvrese orbvrsee orbvrsee orbesver orbesvre orbesevr
orbeserv orbesrev orbesrve orbevser orbevsre orbevesr orbevers orbevres orbevrse orbeevsr orbeevrs
orbeesvr orbeesrv orbeersv orbeervs orberves orbervse orberevs orberesv orbersev orbersve orbrsvee
orbrsvee orbrseve orbrseev orbrseev orbrseve orbrvsee orbrvsee orbrvese orbrvees orbrvees orbrvese
orbrevse orbreves orbresve orbresev orbreesv orbreevs orbreves orbrevse orbreevs orbreesv orbresev
orbresve orvebser orvebsre orvebesr orvebers orvebres orvebrse orvesber orvesbre orvesebr orveserb
orvesreb orvesrbe orveesbr orveesrb orveebsr orveebrs orveerbs orveersb orverseb orversbe orveresb
orverebs orverbes orverbse orvbeser orvbesre orvbeesr orvbeers orvberes orvberse orvbseer orvbsere
orvbseer orvbsere orvbsree orvbsree orvbeser orvbesre orvbeesr orvbeers orvberes orvberse orvbrsee
orvbrsee orvbrese orvbrees orvbrees orvbrese orvsbeer orvsbere orvsbeer orvsbere orvsbree orvsbree
orvseber orvsebre orvseebr orvseerb orvsereb orvserbe orvseebr orvseerb orvseber orvsebre orvserbe
orvsereb orvsreeb orvsrebe orvsreeb orvsrebe orvsrbee orvsrbee orvebser orvebsre orvebesr orvebers
orvebres orvebrse orvesber orvesbre orvesebr orveserb orvesreb orvesrbe orveesbr orveesrb orveebsr
orveebrs orveerbs orveersb orverseb orversbe orveresb orverebs orverbes orverbse orvrbsee orvrbsee
orvrbese orvrbees orvrbees orvrbese orvrsbee orvrsbee orvrsebe orvrseeb orvrseeb orvrsebe orvresbe
orvreseb orvrebse orvrebes orvreebs orvreesb orvreseb orvresbe orvreesb orvreebs orvrebes orvrebse
oreebvsr oreebvrs oreebsvr oreebsrv oreebrsv oreebrvs oreevbsr oreevbrs oreevsbr oreevsrb oreevrsb
oreevrbs oreesvbr oreesvrb oreesbvr oreesbrv oreesrbv oreesrvb oreervsb oreervbs oreersvb oreersbv
oreerbsv oreerbvs orebevsr orebevrs orebesvr orebesrv orebersv orebervs orebvesr orebvers orebvser
orebvsre orebvrse orebvres orebsver orebsvre orebsevr orebserv orebsrev orebsrve orebrvse orebrves
orebrsve orebrsev orebresv orebrevs orevbesr orevbers orevbser orevbsre orevbrse orevbres orevebsr
orevebrs orevesbr orevesrb oreversb oreverbs orevsebr orevserb orevsber orevsbre orevsrbe orevsreb
orevresb orevrebs orevrseb orevrsbe orevrbse orevrbes oresbver oresbvre oresbevr oresberv oresbrev
oresbrve oresvber oresvbre oresvebr oresverb oresvreb oresvrbe oresevbr oresevrb oresebvr oresebrv
oreserbv oreservb oresrveb oresrvbe oresrevb oresrebv oresrbev oresrbve orerbvse orerbves orerbsve
orerbsev orerbesv orerbevs orervbse orervbes orervsbe orervseb orervesb orervebs orersvbe orersveb
orersbve orersbev orersebv orersevb orerevsb orerevbs oreresvb oreresbv orerebsv orerebvs orrebves
orrebvse orrebevs orrebesv orrebsev orrebsve orrevbes orrevbse orrevebs orrevesb orrevseb orrevsbe
orreevbs orreevsb orreebvs orreebsv orreesbv orreesvb orresveb orresvbe orresevb orresebv orresbev
orresbve orrbeves orrbevse orrbeevs orrbeesv orrbesev orrbesve orrbvees orrbvese orrbvees orrbvese
orrbvsee orrbvsee orrbeves orrbevse orrbeevs orrbeesv orrbesev orrbesve orrbsvee orrbsvee orrbseve
orrbseev orrbseev orrbseve orrvbees orrvbese orrvbees orrvbese orrvbsee orrvbsee orrvebes orrvebse
orrveebs orrveesb orrveseb orrvesbe orrveebs orrveesb orrvebes orrvebse orrvesbe orrveseb orrvseeb
orrvsebe orrvseeb orrvsebe orrvsbee orrvsbee orrebves orrebvse orrebevs orrebesv orrebsev orrebsve
orrevbes orrevbse orrevebs orrevesb orrevseb orrevsbe orreevbs orreevsb orreebvs orreebsv orreesbv
orreesvb orresveb orresvbe orresevb orresebv orresbev orresbve orrsbvee orrsbvee orrsbeve orrsbeev
orrsbeev orrsbeve orrsvbee orrsvbee orrsvebe orrsveeb orrsveeb orrsvebe orrsevbe orrseveb orrsebve
orrsebev orrseebv orrseevb orrseveb orrsevbe orrseevb orrseebv orrsebev orrsebve ovserber ovserbre
ovserebr ovsererb ovserreb ovserrbe ovsebrer ovsebrre ovseberr ovseberr ovsebrer ovsebrre ovseebrr
ovseebrr ovseerbr ovseerrb ovseerrb ovseerbr ovserber ovserbre ovserebr ovsererb ovserreb ovserrbe
ovsreber ovsrebre ovsreebr ovsreerb ovsrereb ovsrerbe ovsrbeer ovsrbere ovsrbeer ovsrbere ovsrbree
ovsrbree ovsreber ovsrebre ovsreebr ovsreerb ovsrereb ovsrerbe ovsrrbee ovsrrbee ovsrrebe ovsrreeb
ovsrreeb ovsrrebe ovsbreer ovsbrere ovsbreer ovsbrere ovsbrree ovsbrree ovsberer ovsberre ovsbeerr
ovsbeerr ovsberer ovsberre ovsbeerr ovsbeerr ovsberer ovsberre ovsberre ovsberer ovsbreer ovsbrere
ovsbreer ovsbrere ovsbrree ovsbrree ovserber ovserbre ovserebr ovsererb ovserreb ovserrbe ovsebrer
ovsebrre ovseberr ovseberr ovsebrer ovsebrre ovseebrr ovseebrr ovseerbr ovseerrb ovseerrb ovseerbr
ovserber ovserbre ovserebr ovsererb ovserreb ovserrbe ovsrrbee ovsrrbee ovsrrebe ovsrreeb ovsrreeb
ovsrrebe ovsrbree ovsrbree ovsrbere ovsrbeer ovsrbeer ovsrbere ovsrebre ovsreber ovsrerbe ovsrereb
ovsreerb ovsreebr ovsreber ovsrebre ovsreebr ovsreerb ovsrereb ovsrerbe ovesrber ovesrbre ovesrebr
ovesrerb ovesrreb ovesrrbe ovesbrer ovesbrre ovesberr ovesberr ovesbrer ovesbrre ovesebrr ovesebrr
oveserbr oveserrb oveserrb oveserbr ovesrber ovesrbre ovesrebr ovesrerb ovesrreb ovesrrbe oversber
oversbre oversebr overserb oversreb oversrbe overbser overbsre overbesr overbers overbres overbrse
overebsr overebrs overesbr overesrb overersb overerbs overrbes overrbse overrebs overresb overrseb
overrsbe ovebrser ovebrsre ovebresr ovebrers ovebrres ovebrrse ovebsrer ovebsrre ovebserr ovebserr
ovebsrer ovebsrre ovebesrr ovebesrr ovebersr oveberrs oveberrs ovebersr ovebrser ovebrsre ovebresr
ovebrers ovebrres ovebrrse oveerbsr oveerbrs oveersbr oveersrb oveerrsb oveerrbs oveebrsr oveebrrs
oveebsrr oveebsrr oveebrsr oveebrrs oveesbrr oveesbrr oveesrbr oveesrrb oveesrrb oveesrbr oveerbsr
oveerbrs oveersbr oveersrb oveerrsb oveerrbs overrbes overrbse overrebs overresb overrseb overrsbe
overbres overbrse overbers overbesr overbser overbsre overebrs overebsr overerbs overersb overesrb
overesbr oversber oversbre oversebr overserb oversreb oversrbe ovresber ovresbre ovresebr ovreserb
ovresreb ovresrbe ovrebser ovrebsre ovrebesr ovrebers ovrebres ovrebrse ovreebsr ovreebrs ovreesbr
ovreesrb ovreersb ovreerbs ovrerbes ovrerbse ovrerebs ovreresb ovrerseb ovrersbe ovrseber ovrsebre
ovrseebr ovrseerb ovrsereb ovrserbe ovrsbeer ovrsbere ovrsbeer ovrsbere ovrsbree ovrsbree ovrseber
ovrsebre ovrseebr ovrseerb ovrsereb ovrserbe ovrsrbee ovrsrbee ovrsrebe ovrsreeb ovrsreeb ovrsrebe
ovrbseer ovrbsere ovrbseer ovrbsere ovrbsree ovrbsree ovrbeser ovrbesre ovrbeesr ovrbeers ovrberes
ovrberse ovrbeesr ovrbeers ovrbeser ovrbesre ovrberse ovrberes ovrbrees ovrbrese ovrbrees ovrbrese
ovrbrsee ovrbrsee ovresber ovresbre ovresebr ovreserb ovresreb ovresrbe ovrebser ovrebsre ovrebesr
ovrebers ovrebres ovrebrse ovreebsr ovreebrs ovreesbr ovreesrb ovreersb ovreerbs ovrerbes ovrerbse
ovrerebs ovreresb ovrerseb ovrersbe ovrrsbee ovrrsbee ovrrsebe ovrrseeb ovrrseeb ovrrsebe ovrrbsee
ovrrbsee ovrrbese ovrrbees ovrrbees ovrrbese ovrrebse ovrrebes ovrresbe ovrreseb ovrreesb ovrreebs
ovrrebes ovrrebse ovrreebs ovrreesb ovrreseb ovrresbe ovberser ovbersre ovberesr ovberers ovberres
ovberrse ovbesrer ovbesrre ovbeserr ovbeserr ovbesrer ovbesrre ovbeesrr ovbeesrr ovbeersr ovbeerrs
ovbeerrs ovbeersr ovberser ovbersre ovberesr ovberers ovberres ovberrse ovbreser ovbresre ovbreesr
ovbreers ovbreres ovbrerse ovbrseer ovbrsere ovbrseer ovbrsere ovbrsree ovbrsree ovbreser ovbresre
ovbreesr ovbreers ovbreres ovbrerse ovbrrsee ovbrrsee ovbrrese ovbrrees ovbrrees ovbrrese ovbsreer
ovbsrere ovbsreer ovbsrere ovbsrree ovbsrree ovbserer ovbserre ovbseerr ovbseerr ovbserer ovbserre
ovbseerr ovbseerr ovbserer ovbserre ovbserre ovbserer ovbsreer ovbsrere ovbsreer ovbsrere ovbsrree
ovbsrree ovberser ovbersre ovberesr ovberers ovberres ovberrse ovbesrer ovbesrre ovbeserr ovbeserr
ovbesrer ovbesrre ovbeesrr ovbeesrr ovbeersr ovbeerrs ovbeerrs ovbeersr ovberser ovbersre ovberesr
ovberers ovberres ovberrse ovbrrsee ovbrrsee ovbrrese ovbrrees ovbrrees ovbrrese ovbrsree ovbrsree
ovbrsere ovbrseer ovbrseer ovbrsere ovbresre ovbreser ovbrerse ovbreres ovbreers ovbreesr ovbreser
ovbresre ovbreesr ovbreers ovbreres ovbrerse oveerbsr oveerbrs oveersbr oveersrb oveerrsb oveerrbs
oveebrsr oveebrrs oveebsrr oveebsrr oveebrsr oveebrrs oveesbrr oveesbrr oveesrbr oveesrrb oveesrrb
oveesrbr oveerbsr oveerbrs oveersbr oveersrb oveerrsb oveerrbs overebsr overebrs overesbr overesrb
overersb overerbs overbesr overbers overbser overbsre overbrse overbres oversber oversbre oversebr
overserb oversreb oversrbe overrbse overrbes overrsbe overrseb overresb overrebs ovebresr ovebrers
ovebrser ovebrsre ovebrrse ovebrres ovebersr oveberrs ovebesrr ovebesrr ovebersr oveberrs ovebserr
ovebserr ovebsrer ovebsrre ovebsrre ovebsrer ovebresr ovebrers ovebrser ovebrsre ovebrrse ovebrres
ovesrber ovesrbre ovesrebr ovesrerb ovesrreb ovesrrbe ovesbrer ovesbrre ovesberr ovesberr ovesbrer
ovesbrre ovesebrr ovesebrr oveserbr oveserrb oveserrb oveserbr ovesrber ovesrbre ovesrebr ovesrerb
ovesrreb ovesrrbe overrbse overrbes overrsbe overrseb overresb overrebs overbrse overbres overbsre
overbser overbesr overbers oversbre oversber oversrbe oversreb overserb oversebr overebsr overebrs
overesbr overesrb overersb overerbs ovrerbes ovrerbse ovrerebs ovreresb ovrerseb ovrersbe ovrebres
ovrebrse ovrebers ovrebesr ovrebser ovrebsre ovreebrs ovreebsr ovreerbs ovreersb ovreesrb ovreesbr
ovresber ovresbre ovresebr ovreserb ovresreb ovresrbe ovrrebes ovrrebse ovrreebs ovrreesb ovrreseb
ovrresbe ovrrbees ovrrbese ovrrbees ovrrbese ovrrbsee ovrrbsee ovrrebes ovrrebse ovrreebs ovrreesb
ovrreseb ovrresbe ovrrsbee ovrrsbee ovrrsebe ovrrseeb ovrrseeb ovrrsebe ovrbrees ovrbrese ovrbrees
ovrbrese ovrbrsee ovrbrsee ovrberes ovrberse ovrbeers ovrbeesr ovrbeser ovrbesre ovrbeers ovrbeesr
ovrberes ovrberse ovrbesre ovrbeser ovrbseer ovrbsere ovrbseer ovrbsere ovrbsree ovrbsree ovrerbes
ovrerbse ovrerebs ovreresb ovrerseb ovrersbe ovrebres ovrebrse ovrebers ovrebesr ovrebser ovrebsre
ovreebrs ovreebsr ovreerbs ovreersb ovreesrb ovreesbr ovresber ovresbre ovresebr ovreserb ovresreb
ovresrbe ovrsrbee ovrsrbee ovrsrebe ovrsreeb ovrsreeb ovrsrebe ovrsbree ovrsbree ovrsbere ovrsbeer
ovrsbeer ovrsbere ovrsebre ovrseber ovrserbe ovrsereb ovrseerb ovrseebr ovrseber ovrsebre ovrseebr
ovrseerb ovrsereb ovrserbe oeservbr oeservrb oeserbvr oeserbrv oeserrbv oeserrvb oesevrbr oesevrrb
oesevbrr oesevbrr oesevrbr oesevrrb oesebvrr oesebvrr oesebrvr oesebrrv oesebrrv oesebrvr oeservbr
oeservrb oeserbvr oeserbrv oeserrbv oeserrvb oesrevbr oesrevrb oesrebvr oesrebrv oesrerbv oesrervb
oesrvebr oesrverb oesrvber oesrvbre oesrvrbe oesrvreb oesrbver oesrbvre oesrbevr oesrberv oesrbrev
oesrbrve oesrrvbe oesrrveb oesrrbve oesrrbev oesrrebv oesrrevb oesvrebr oesvrerb oesvrber oesvrbre
oesvrrbe oesvrreb oesverbr oesverrb oesvebrr oesvebrr oesverbr oesverrb oesvberr oesvberr oesvbrer
oesvbrre oesvbrre oesvbrer oesvrebr oesvrerb oesvrber oesvrbre oesvrrbe oesvrreb oesbrver oesbrvre
oesbrevr oesbrerv oesbrrev oesbrrve oesbvrer oesbvrre oesbverr oesbverr oesbvrer oesbvrre oesbevrr
oesbevrr oesbervr oesberrv oesberrv oesbervr oesbrver oesbrvre oesbrevr oesbrerv oesbrrev oesbrrve
oesrrvbe oesrrveb oesrrbve oesrrbev oesrrebv oesrrevb oesrvrbe oesrvreb oesrvbre oesrvber oesrvebr
oesrverb oesrbvre oesrbver oesrbrve oesrbrev oesrberv oesrbevr oesrevbr oesrevrb oesrebvr oesrebrv
oesrerbv oesrervb oeesrvbr oeesrvrb oeesrbvr oeesrbrv oeesrrbv oeesrrvb oeesvrbr oeesvrrb oeesvbrr
oeesvbrr oeesvrbr oeesvrrb oeesbvrr oeesbvrr oeesbrvr oeesbrrv oeesbrrv oeesbrvr oeesrvbr oeesrvrb
oeesrbvr oeesrbrv oeesrrbv oeesrrvb oeersvbr oeersvrb oeersbvr oeersbrv oeersrbv oeersrvb oeervsbr
oeervsrb oeervbsr oeervbrs oeervrbs oeervrsb oeerbvsr oeerbvrs oeerbsvr oeerbsrv oeerbrsv oeerbrvs
oeerrvbs oeerrvsb oeerrbvs oeerrbsv oeerrsbv oeerrsvb oeevrsbr oeevrsrb oeevrbsr oeevrbrs oeevrrbs
oeevrrsb oeevsrbr oeevsrrb oeevsbrr oeevsbrr oeevsrbr oeevsrrb oeevbsrr oeevbsrr oeevbrsr oeevbrrs
oeevbrrs oeevbrsr oeevrsbr oeevrsrb oeevrbsr oeevrbrs oeevrrbs oeevrrsb oeebrvsr oeebrvrs oeebrsvr
oeebrsrv oeebrrsv oeebrrvs oeebvrsr oeebvrrs oeebvsrr oeebvsrr oeebvrsr oeebvrrs oeebsvrr oeebsvrr
oeebsrvr oeebsrrv oeebsrrv oeebsrvr oeebrvsr oeebrvrs oeebrsvr oeebrsrv oeebrrsv oeebrrvs oeerrvbs
oeerrvsb oeerrbvs oeerrbsv oeerrsbv oeerrsvb oeervrbs oeervrsb oeervbrs oeervbsr oeervsbr oeervsrb
oeerbvrs oeerbvsr oeerbrvs oeerbrsv oeerbsrv oeerbsvr oeersvbr oeersvrb oeersbvr oeersbrv oeersrbv
oeersrvb oeresvbr oeresvrb oeresbvr oeresbrv oeresrbv oeresrvb oerevsbr oerevsrb oerevbsr oerevbrs
oerevrbs oerevrsb oerebvsr oerebvrs oerebsvr oerebsrv oerebrsv oerebrvs oerervbs oerervsb oererbvs
oererbsv oerersbv oerersvb oersevbr oersevrb oersebvr oersebrv oerserbv oerservb oersvebr oersverb
oersvber oersvbre oersvrbe oersvreb oersbver oersbvre oersbevr oersberv oersbrev oersbrve oersrvbe
oersrveb oersrbve oersrbev oersrebv oersrevb oervsebr oervserb oervsber oervsbre oervsrbe oervsreb
oervesbr oervesrb oervebsr oervebrs oerverbs oerversb oervbesr oervbers oervbser oervbsre oervbrse
oervbres oervrebs oervresb oervrbes oervrbse oervrsbe oervrseb oerbsver oerbsvre oerbsevr oerbserv
oerbsrev oerbsrve oerbvser oerbvsre oerbvesr oerbvers oerbvres oerbvrse oerbevsr oerbevrs oerbesvr
oerbesrv oerbersv oerbervs oerbrves oerbrvse oerbrevs oerbresv oerbrsev oerbrsve oerrsvbe oerrsveb
oerrsbve oerrsbev oerrsebv oerrsevb oerrvsbe oerrvseb oerrvbse oerrvbes oerrvebs oerrvesb oerrbvse
oerrbves oerrbsve oerrbsev oerrbesv oerrbevs oerrevbs oerrevsb oerrebvs oerrebsv oerresbv oerresvb
oeversbr oeversrb oeverbsr oeverbrs oeverrbs oeverrsb oevesrbr oevesrrb oevesbrr oevesbrr oevesrbr
oevesrrb oevebsrr oevebsrr oevebrsr oevebrrs oevebrrs oevebrsr oeversbr oeversrb oeverbsr oeverbrs
oeverrbs oeverrsb oevresbr oevresrb oevrebsr oevrebrs oevrerbs oevrersb oevrsebr oevrserb oevrsber
oevrsbre oevrsrbe oevrsreb oevrbser oevrbsre oevrbesr oevrbers oevrbres oevrbrse oevrrsbe oevrrseb
oevrrbse oevrrbes oevrrebs oevrresb oevsrebr oevsrerb oevsrber oevsrbre oevsrrbe oevsrreb oevserbr
oevserrb oevsebrr oevsebrr oevserbr oevserrb oevsberr oevsberr oevsbrer oevsbrre oevsbrre oevsbrer
oevsrebr oevsrerb oevsrber oevsrbre oevsrrbe oevsrreb oevbrser oevbrsre oevbresr oevbrers oevbrres
oevbrrse oevbsrer oevbsrre oevbserr oevbserr oevbsrer oevbsrre oevbesrr oevbesrr oevbersr oevberrs
oevberrs oevbersr oevbrser oevbrsre oevbresr oevbrers oevbrres oevbrrse oevrrsbe oevrrseb oevrrbse
oevrrbes oevrrebs oevrresb oevrsrbe oevrsreb oevrsbre oevrsber oevrsebr oevrserb oevrbsre oevrbser
oevrbrse oevrbres oevrbers oevrbesr oevresbr oevresrb oevrebsr oevrebrs oevrerbs oevrersb oebervsr
oebervrs oebersvr oebersrv oeberrsv oeberrvs oebevrsr oebevrrs oebevsrr oebevsrr oebevrsr oebevrrs
oebesvrr oebesvrr oebesrvr oebesrrv oebesrrv oebesrvr oebervsr oebervrs oebersvr oebersrv oeberrsv
oeberrvs oebrevsr oebrevrs oebresvr oebresrv oebrersv oebrervs oebrvesr oebrvers oebrvser oebrvsre
oebrvrse oebrvres oebrsver oebrsvre oebrsevr oebrserv oebrsrev oebrsrve oebrrvse oebrrves oebrrsve
oebrrsev oebrresv oebrrevs oebvresr oebvrers oebvrser oebvrsre oebvrrse oebvrres oebversr oebverrs
oebvesrr oebvesrr oebversr oebverrs oebvserr oebvserr oebvsrer oebvsrre oebvsrre oebvsrer oebvresr
oebvrers oebvrser oebvrsre oebvrrse oebvrres oebsrver oebsrvre oebsrevr oebsrerv oebsrrev oebsrrve
oebsvrer oebsvrre oebsverr oebsverr oebsvrer oebsvrre oebsevrr oebsevrr oebservr oebserrv oebserrv
oebservr oebsrver oebsrvre oebsrevr oebsrerv oebsrrev oebsrrve oebrrvse oebrrves oebrrsve oebrrsev
oebrresv oebrrevs oebrvrse oebrvres oebrvsre oebrvser oebrvesr oebrvers oebrsvre oebrsver oebrsrve
oebrsrev oebrserv oebrsevr oebrevsr oebrevrs oebresvr oebresrv oebrersv oebrervs oerervbs oerervsb
oererbvs oererbsv oerersbv oerersvb oerevrbs oerevrsb oerevbrs oerevbsr oerevsbr oerevsrb oerebvrs
oerebvsr oerebrvs oerebrsv oerebsrv oerebsvr oeresvbr oeresvrb oeresbvr oeresbrv oeresrbv oeresrvb
oerrevbs oerrevsb oerrebvs oerrebsv oerresbv oerresvb oerrvebs oerrvesb oerrvbes oerrvbse oerrvsbe
oerrvseb oerrbves oerrbvse oerrbevs oerrbesv oerrbsev oerrbsve oerrsvbe oerrsveb oerrsbve oerrsbev
oerrsebv oerrsevb oervrebs oervresb oervrbes oervrbse oervrsbe oervrseb oerverbs oerversb oervebrs
oervebsr oervesbr oervesrb oervbers oervbesr oervbres oervbrse oervbsre oervbser oervsebr oervserb
oervsber oervsbre oervsrbe oervsreb oerbrves oerbrvse oerbrevs oerbresv oerbrsev oerbrsve oerbvres
oerbvrse oerbvers oerbvesr oerbvser oerbvsre oerbevrs oerbevsr oerbervs oerbersv oerbesrv oerbesvr
oerbsver oerbsvre oerbsevr oerbserv oerbsrev oerbsrve oersrvbe oersrveb oersrbve oersrbev oersrebv
oersrevb oersvrbe oersvreb oersvbre oersvber oersvebr oersverb oersbvre oersbver oersbrve oersbrev
oersberv oersbevr oersevbr oersevrb oersebvr oersebrv oerserbv oerservb orserveb orservbe orserevb
orserebv orserbev orserbve orsevreb orsevrbe orseverb orsevebr orsevber orsevbre orseevrb orseevbr
orseervb orseerbv orseebrv orseebvr orsebver orsebvre orsebevr orseberv orsebrev orsebrve orsreveb
orsrevbe orsreevb orsreebv orsrebev orsrebve orsrveeb orsrvebe orsrveeb orsrvebe orsrvbee orsrvbee
orsreveb orsrevbe orsreevb orsreebv orsrebev orsrebve orsrbvee orsrbvee orsrbeve orsrbeev orsrbeev
orsrbeve orsvreeb orsvrebe orsvreeb orsvrebe orsvrbee orsvrbee orsvereb orsverbe orsveerb orsveebr
orsveber orsvebre orsveerb orsveebr orsvereb orsverbe orsvebre orsveber orsvbeer orsvbere orsvbeer
orsvbere orsvbree orsvbree orserveb orservbe orserevb orserebv orserbev orserbve orsevreb orsevrbe
orseverb orsevebr orsevber orsevbre orseevrb orseevbr orseervb orseerbv orseebrv orseebvr orsebver
orsebvre orsebevr orseberv orsebrev orsebrve orsbrvee orsbrvee orsbreve orsbreev orsbreev orsbreve
orsbvree orsbvree orsbvere orsbveer orsbveer orsbvere orsbevre orsbever orsberve orsberev orsbeerv
orsbeevr orsbever orsbevre orsbeevr orsbeerv orsberev orsberve oresrveb oresrvbe oresrevb oresrebv
oresrbev oresrbve oresvreb oresvrbe oresverb oresvebr oresvber oresvbre oresevrb oresevbr oreservb
oreserbv oresebrv oresebvr oresbver oresbvre oresbevr oresberv oresbrev oresbrve orersveb orersvbe
orersevb orersebv orersbev orersbve orervseb orervsbe orervesb orervebs orervbes orervbse orerevsb
orerevbs oreresvb oreresbv orerebsv orerebvs orerbves orerbvse orerbevs orerbesv orerbsev orerbsve
orevrseb orevrsbe orevresb orevrebs orevrbes orevrbse orevsreb orevsrbe orevserb orevsebr orevsber
orevsbre orevesrb orevesbr oreversb oreverbs orevebrs orevebsr orevbser orevbsre orevbesr orevbers
orevbres orevbrse oreervsb oreervbs oreersvb oreersbv oreerbsv oreerbvs oreevrsb oreevrbs oreevsrb
oreevsbr oreevbsr oreevbrs oreesvrb oreesvbr oreesrvb oreesrbv oreesbrv oreesbvr oreebvsr oreebvrs
oreebsvr oreebsrv oreebrsv oreebrvs orebrves orebrvse orebrevs orebresv orebrsev orebrsve orebvres
orebvrse orebvers orebvesr orebvser orebvsre orebevrs orebevsr orebervs orebersv orebesrv orebesvr
orebsver orebsvre orebsevr orebserv orebsrev orebsrve orresveb orresvbe orresevb orresebv orresbev
orresbve orrevseb orrevsbe orrevesb orrevebs orrevbes orrevbse orreevsb orreevbs orreesvb orreesbv
orreebsv orreebvs orrebves orrebvse orrebevs orrebesv orrebsev orrebsve orrseveb orrsevbe orrseevb
orrseebv orrsebev orrsebve orrsveeb orrsvebe orrsveeb orrsvebe orrsvbee orrsvbee orrseveb orrsevbe
orrseevb orrseebv orrsebev orrsebve orrsbvee orrsbvee orrsbeve orrsbeev orrsbeev orrsbeve orrvseeb
orrvsebe orrvseeb orrvsebe orrvsbee orrvsbee orrveseb orrvesbe orrveesb orrveebs orrvebes orrvebse
orrveesb orrveebs orrveseb orrvesbe orrvebse orrvebes orrvbees orrvbese orrvbees orrvbese orrvbsee
orrvbsee orresveb orresvbe orresevb orresebv orresbev orresbve orrevseb orrevsbe orrevesb orrevebs
orrevbes orrevbse orreevsb orreevbs orreesvb orreesbv orreebsv orreebvs orrebves orrebvse orrebevs
orrebesv orrebsev orrebsve orrbsvee orrbsvee orrbseve orrbseev orrbseev orrbseve orrbvsee orrbvsee
orrbvese orrbvees orrbvees orrbvese orrbevse orrbeves orrbesve orrbesev orrbeesv orrbeevs orrbeves
orrbevse orrbeevs orrbeesv orrbesev orrbesve orverseb orversbe orveresb orverebs orverbes orverbse
orvesreb orvesrbe orveserb orvesebr orvesber orvesbre orveesrb orveesbr orveersb orveerbs orveebrs
orveebsr orvebser orvebsre orvebesr orvebers orvebres orvebrse orvreseb orvresbe orvreesb orvreebs
orvrebes orvrebse orvrseeb orvrsebe orvrseeb orvrsebe orvrsbee orvrsbee orvreseb orvresbe orvreesb
orvreebs orvrebes orvrebse orvrbsee orvrbsee orvrbese orvrbees orvrbees orvrbese orvsreeb orvsrebe
orvsreeb orvsrebe orvsrbee orvsrbee orvsereb orvserbe orvseerb orvseebr orvseber orvsebre orvseerb
orvseebr orvsereb orvserbe orvsebre orvseber orvsbeer orvsbere orvsbeer orvsbere orvsbree orvsbree
orverseb orversbe orveresb orverebs orverbes orverbse orvesreb orvesrbe orveserb orvesebr orvesber
orvesbre orveesrb orveesbr orveersb orveerbs orveebrs orveebsr orvebser orvebsre orvebesr orvebers
orvebres orvebrse orvbrsee orvbrsee orvbrese orvbrees orvbrees orvbrese orvbsree orvbsree orvbsere
orvbseer orvbseer orvbsere orvbesre orvbeser orvberse orvberes orvbeers orvbeesr orvbeser orvbesre
orvbeesr orvbeers orvberes orvberse oreervsb oreervbs oreersvb oreersbv oreerbsv oreerbvs oreevrsb
oreevrbs oreevsrb oreevsbr oreevbsr oreevbrs oreesvrb oreesvbr oreesrvb oreesrbv oreesbrv oreesbvr
oreebvsr oreebvrs oreebsvr oreebsrv oreebrsv oreebrvs orerevsb orerevbs oreresvb oreresbv orerebsv
orerebvs orervesb orervebs orervseb orervsbe orervbse orervbes orersveb orersvbe orersevb orersebv
orersbev orersbve orerbvse orerbves orerbsve orerbsev orerbesv orerbevs orevresb orevrebs orevrseb
orevrsbe orevrbse orevrbes oreversb oreverbs orevesrb orevesbr orevebsr orevebrs orevserb orevsebr
orevsreb orevsrbe orevsbre orevsber orevbesr orevbers orevbser orevbsre orevbrse orevbres oresrveb
oresrvbe oresrevb oresrebv oresrbev oresrbve oresvreb oresvrbe oresverb oresvebr oresvber oresvbre
oresevrb oresevbr oreservb oreserbv oresebrv oresebvr oresbver oresbvre oresbevr oresberv oresbrev
oresbrve orebrvse orebrves orebrsve orebrsev orebresv orebrevs orebvrse orebvres orebvsre orebvser
orebvesr orebvers orebsvre orebsver orebsrve orebsrev orebserv orebsevr orebevsr orebevrs orebesvr
orebesrv orebersv orebervs orberves orbervse orberevs orberesv orbersev orbersve orbevres orbevrse
orbevers orbevesr orbevser orbevsre orbeevrs orbeevsr orbeervs orbeersv orbeesrv orbeesvr orbesver
orbesvre orbesevr orbeserv orbesrev orbesrve orbreves orbrevse orbreevs orbreesv orbresev orbresve
orbrvees orbrvese orbrvees orbrvese orbrvsee orbrvsee orbreves orbrevse orbreevs orbreesv orbresev
orbresve orbrsvee orbrsvee orbrseve orbrseev orbrseev orbrseve orbvrees orbvrese orbvrees orbvrese
orbvrsee orbvrsee orbveres orbverse orbveers orbveesr orbveser orbvesre orbveers orbveesr orbveres
orbverse orbvesre orbveser orbvseer orbvsere orbvseer orbvsere orbvsree orbvsree orberves orbervse
orberevs orberesv orbersev orbersve orbevres orbevrse orbevers orbevesr orbevser orbevsre orbeevrs
orbeevsr orbeervs orbeersv orbeesrv orbeesvr orbesver orbesvre orbesevr orbeserv orbesrev orbesrve
orbsrvee orbsrvee orbsreve orbsreev orbsreev orbsreve orbsvree orbsvree orbsvere orbsveer orbsveer
orbsvere orbsevre orbsever orbserve orbserev orbseerv orbseevr orbsever orbsevre orbseevr orbseerv
orbserev orbserve

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us