easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

goodfellow

anagyrine

pipewort

semiamplitude

humeri

lambkins

paratur

tonsillectomies

tartago

redescend

boatfalls

protoleucocyte

mandiocas

deripasque

devenierunt

dasyproctine

adenanthera

nurseryful


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: nullaque
cipher variations:
ovmmbrvf pwnncswg qxoodtxh ryppeuyi szqqfvzj
tarrgwak ubsshxbl vcttiycm wduujzdn xevvkaeo
yfwwlbfp zgxxmcgq ahyyndhr bizzoeis cjaapfjt
dkbbqgku elccrhlv fmddsimw gneetjnx hoffukoy
ipggvlpz jqhhwmqa kriixnrb lsjjyosc mtkkzptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: nullaque
Cipher: mfoozjfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: nullaque
Cipher: ABBAA BAABB ABABA ABABA AAAAA ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: nullaque
cipher variations:
ovmmbrvfojiibxjnoxeebdxvolaabjldozwwbpzlonssbvntopkkbhpjodggbndr
orccbtrzofyybzfhotuubftpohqqblhxpwnncswgpkjjcykopyffceywpmbbckme
paxxcqampottcwoupqllciqkpehhcoespsddcusapgzzcagipuvvcguqpirrcmiy
qxoodtxhqlkkdzlpqzggdfzxqnccdlnfqbyydrbnqpuudxpvqrmmdjrlqfiidpft
qteedvtbqhaadbhjqvwwdhvrqjssdnjzryppeuyirmlleamqrahhegayroddemog
rczzescorqvveyqwrsnneksmrgjjeqguruffewucribbecikrwxxeiwsrktteoka
szqqfvzjsnmmfbnrsbiifhbzspeefnphsdaaftdpsrwwfzrxstoofltnshkkfrhv
svggfxvdsjccfdjlsxyyfjxtsluufplbtarrgwaktonngcostcjjgicatqffgoqi
tebbgueqtsxxgasytuppgmuotillgsiwtwhhgywetkddgekmtyzzgkyutmvvgqmc
ubsshxblupoohdptudkkhjdburgghprjufcchvfrutyyhbtzuvqqhnvpujmmhtjx
uxiihzxfuleehflnuzaahlzvunwwhrndvcttiycmvqppiequvellikecvshhiqsk
vgddiwgsvuzzicuavwrriowqvknniukyvyjjiaygvmffigmovabbimawvoxxisoe
wduujzdnwrqqjfrvwfmmjlfdwtiijrtlwheejxhtwvaajdvbwxssjpxrwloojvlz
wzkkjbzhwnggjhnpwbccjnbxwpyyjtpfxevvkaeoxsrrkgswxgnnkmgexujjksum
xiffkyiuxwbbkewcxyttkqysxmppkwmaxallkcaixohhkioqxcddkocyxqzzkuqg
yfwwlbfpytsslhtxyhoolnhfyvkkltvnyjgglzjvyxcclfxdyzuulrztynqqlxnb
ybmmldbjypiiljprydeelpdzyraalvrhzgxxmcgqzuttmiuyzippmoigzwllmuwo
zkhhmakwzyddmgyezavvmsauzorrmyoczcnnmeckzqjjmkqszeffmqeazsbbmwsi
ahyyndhravuunjvzajqqnpjhaxmmnvxpaliinblxazeenhzfabwwntbvapssnzpd
adoonfdlarkknlrtafggnrfbatccnxtjbizzoeisbwvvokwabkrroqkibynnowyq
bmjjocmybaffoiagbcxxoucwbqttoaqebeppogembsllomsubghhosgcbuddoyuk
cjaapfjtcxwwplxbclssprljczoopxzrcnkkpdnzcbggpjbhcdyypvdxcruupbrf
cfqqphfnctmmpntvchiipthdcveepzvldkbbqgkudyxxqmycdmttqsmkdappqyas
dollqeoadchhqkcidezzqweydsvvqcsgdgrrqigodunnqouwdijjquiedwffqawm
elccrhlvezyyrnzdenuurtnlebqqrzbtepmmrfpbediirldjefaarxfzetwwrdth
ehssrjhpevoorpvxejkkrvjfexggrbxnfmddsimwfazzsoaefovvsuomfcrrsacu
fqnnsgqcfejjsmekfgbbsygafuxxseuifittskiqfwppsqwyfkllswkgfyhhscyo
gneetjnxgbaatpbfgpwwtvpngdsstbdvgroothrdgfkktnflghcctzhbgvyytfvj
gjuutljrgxqqtrxzglmmtxlhgziitdzphoffukoyhcbbuqcghqxxuwqohettucew
hsppuisehglluogmhidduaichwzzugwkhkvvumkshyrrusyahmnnuymihajjueaq
ipggvlpzidccvrdhiryyvxrpifuuvdfxitqqvjtfihmmvphnijeevbjdixaavhxl
ilwwvnltizssvtzbinoovznjibkkvfbrjqhhwmqajeddwseijszzwysqjgvvwegy
jurrwkugjinnwqiojkffwckejybbwiymjmxxwomujattwuacjoppwaokjcllwgcs
kriixnrbkfeextfjktaaxztrkhwwxfhzkvssxlvhkjooxrjpklggxdlfkzccxjzn
knyyxpnvkbuuxvbdkpqqxbplkdmmxhdtlsjjyosclgffyugklubbyauslixxygia
lwttymwilkppyskqlmhhyemgladdykaolozzyqowlcvvywcelqrrycqmlennyieu
mtkkzptdmhggzvhlmvcczbvtmjyyzhjbmxuuznxjmlqqztlrmniizfnhmbeezlbp
mpaazrpxmdwwzxdfmrsszdrnmfoozjfvnullaquenihhawimnwddacwunkzzaikc
nyvvaoyknmrraumsnojjagoincffamcqnqbbasqynexxayegnsttaesongppakgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: nullaque
Cipher: ahyyndhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: nullaque
Cipher: 3354131311145451

Extended Methods:
Method #1

Plaintext: nullaque
method variations:
szqqfvzkxevvlaepckaaqfkuhpffvlpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
n u l l a q u e 
3 5 1 1 1 1 5 5 
3 4 3 3 1 4 4 1 
They are then read out in rows:
3511115534331441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: nullaque
Cipher: xaazsnqd

Read more ...
Method #3

Plaintext: nullaque
method variations:
xdccayyl dccayylx ccayylxd
cayylxdc ayylxdcc yylxdcca
ylxdccay lxdccayy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: nullaque

first 5040 cipher variations(40320 total)
nullaque nullaqeu nullauqe nullaueq nullaeuq nullaequ nullqaue nullqaeu nullquae nullquea nullqeua
nullqeau nulluqae nulluqea nulluaqe nulluaeq nullueaq nullueqa nullequa nulleqau nulleuqa nulleuaq
nulleauq nulleaqu nulalque nulalqeu nulaluqe nulalueq nulaleuq nulalequ nulaqlue nulaqleu nulaqule
nulaquel nulaqeul nulaqelu nulauqle nulauqel nulaulqe nulauleq nulauelq nulaueql nulaequl nulaeqlu
nulaeuql nulaeulq nulaeluq nulaelqu nulqalue nulqaleu nulqaule nulqauel nulqaeul nulqaelu nulqlaue
nulqlaeu nulqluae nulqluea nulqleua nulqleau nulqulae nulqulea nulquale nulquael nulqueal nulquela
nulqelua nulqelau nulqeula nulqeual nulqeaul nulqealu nuluaqle nuluaqel nulualqe nulualeq nuluaelq
nuluaeql nuluqale nuluqael nuluqlae nuluqlea nuluqela nuluqeal nululqae nululqea nululaqe nululaeq
nululeaq nululeqa nulueqla nulueqal nuluelqa nuluelaq nuluealq nulueaql nuleaqul nuleaqlu nuleauql
nuleaulq nulealuq nulealqu nuleqaul nuleqalu nulequal nulequla nuleqlua nuleqlau nuleuqal nuleuqla
nuleuaql nuleualq nuleulaq nuleulqa nulelqua nulelqau nuleluqa nuleluaq nulelauq nulelaqu nullaque
nullaqeu nullauqe nullaueq nullaeuq nullaequ nullqaue nullqaeu nullquae nullquea nullqeua nullqeau
nulluqae nulluqea nulluaqe nulluaeq nullueaq nullueqa nullequa nulleqau nulleuqa nulleuaq nulleauq
nulleaqu nulalque nulalqeu nulaluqe nulalueq nulaleuq nulalequ nulaqlue nulaqleu nulaqule nulaquel
nulaqeul nulaqelu nulauqle nulauqel nulaulqe nulauleq nulauelq nulaueql nulaequl nulaeqlu nulaeuql
nulaeulq nulaeluq nulaelqu nulqalue nulqaleu nulqaule nulqauel nulqaeul nulqaelu nulqlaue nulqlaeu
nulqluae nulqluea nulqleua nulqleau nulqulae nulqulea nulquale nulquael nulqueal nulquela nulqelua
nulqelau nulqeula nulqeual nulqeaul nulqealu nuluaqle nuluaqel nulualqe nulualeq nuluaelq nuluaeql
nuluqale nuluqael nuluqlae nuluqlea nuluqela nuluqeal nululqae nululqea nululaqe nululaeq nululeaq
nululeqa nulueqla nulueqal nuluelqa nuluelaq nuluealq nulueaql nuleaqul nuleaqlu nuleauql nuleaulq
nulealuq nulealqu nuleqaul nuleqalu nulequal nulequla nuleqlua nuleqlau nuleuqal nuleuqla nuleuaql
nuleualq nuleulaq nuleulqa nulelqua nulelqau nuleluqa nuleluaq nulelauq nulelaqu nuallque nuallqeu
nualluqe nuallueq nualleuq nuallequ nualqlue nualqleu nualqule nualquel nualqeul nualqelu nualuqle
nualuqel nualulqe nualuleq nualuelq nualueql nualequl nualeqlu nualeuql nualeulq nualeluq nualelqu
nuallque nuallqeu nualluqe nuallueq nualleuq nuallequ nualqlue nualqleu nualqule nualquel nualqeul
nualqelu nualuqle nualuqel nualulqe nualuleq nualuelq nualueql nualequl nualeqlu nualeuql nualeulq
nualeluq nualelqu nuaqllue nuaqlleu nuaqlule nuaqluel nuaqleul nuaqlelu nuaqllue nuaqlleu nuaqlule
nuaqluel nuaqleul nuaqlelu nuaqulle nuaqulel nuaqulle nuaqulel nuaquell nuaquell nuaqelul nuaqellu
nuaqeull nuaqeull nuaqelul nuaqellu nuaulqle nuaulqel nuaullqe nuaulleq nuaulelq nuauleql nuauqlle
nuauqlel nuauqlle nuauqlel nuauqell nuauqell nuaulqle nuaulqel nuaullqe nuaulleq nuaulelq nuauleql
nuaueqll nuaueqll nuauelql nuauellq nuauellq nuauelql nuaelqul nuaelqlu nuaeluql nuaelulq nuaelluq
nuaellqu nuaeqlul nuaeqllu nuaequll nuaequll nuaeqlul nuaeqllu nuaeuqll nuaeuqll nuaeulql nuaeullq
nuaeullq nuaeulql nuaelqul nuaelqlu nuaeluql nuaelulq nuaelluq nuaellqu nuqlalue nuqlaleu nuqlaule
nuqlauel nuqlaeul nuqlaelu nuqllaue nuqllaeu nuqlluae nuqlluea nuqlleua nuqlleau nuqlulae nuqlulea
nuqluale nuqluael nuqlueal nuqluela nuqlelua nuqlelau nuqleula nuqleual nuqleaul nuqlealu nuqallue
nuqalleu nuqalule nuqaluel nuqaleul nuqalelu nuqallue nuqalleu nuqalule nuqaluel nuqaleul nuqalelu
nuqaulle nuqaulel nuqaulle nuqaulel nuqauell nuqauell nuqaelul nuqaellu nuqaeull nuqaeull nuqaelul
nuqaellu nuqlalue nuqlaleu nuqlaule nuqlauel nuqlaeul nuqlaelu nuqllaue nuqllaeu nuqlluae nuqlluea
nuqlleua nuqlleau nuqlulae nuqlulea nuqluale nuqluael nuqlueal nuqluela nuqlelua nuqlelau nuqleula
nuqleual nuqleaul nuqlealu nuqualle nuqualel nuqualle nuqualel nuquaell nuquaell nuqulale nuqulael
nuqullae nuqullea nuqulela nuquleal nuqullae nuqullea nuqulale nuqulael nuquleal nuqulela nuquella
nuquelal nuquella nuquelal nuqueall nuqueall nuqealul nuqeallu nuqeaull nuqeaull nuqealul nuqeallu
nuqelaul nuqelalu nuqelual nuqelula nuqellua nuqellau nuqeulal nuqeulla nuqeuall nuqeuall nuqeulal
nuqeulla nuqellua nuqellau nuqelula nuqelual nuqelaul nuqelalu nuulaqle nuulaqel nuulalqe nuulaleq
nuulaelq nuulaeql nuulqale nuulqael nuulqlae nuulqlea nuulqela nuulqeal nuullqae nuullqea nuullaqe
nuullaeq nuulleaq nuulleqa nuuleqla nuuleqal nuulelqa nuulelaq nuulealq nuuleaql nuualqle nuualqel
nuuallqe nuualleq nuualelq nuualeql nuuaqlle nuuaqlel nuuaqlle nuuaqlel nuuaqell nuuaqell nuualqle
nuualqel nuuallqe nuualleq nuualelq nuualeql nuuaeqll nuuaeqll nuuaelql nuuaellq nuuaellq nuuaelql
nuuqalle nuuqalel nuuqalle nuuqalel nuuqaell nuuqaell nuuqlale nuuqlael nuuqllae nuuqllea nuuqlela
nuuqleal nuuqllae nuuqllea nuuqlale nuuqlael nuuqleal nuuqlela nuuqella nuuqelal nuuqella nuuqelal
nuuqeall nuuqeall nuulaqle nuulaqel nuulalqe nuulaleq nuulaelq nuulaeql nuulqale nuulqael nuulqlae
nuulqlea nuulqela nuulqeal nuullqae nuullqea nuullaqe nuullaeq nuulleaq nuulleqa nuuleqla nuuleqal
nuulelqa nuulelaq nuulealq nuuleaql nuueaqll nuueaqll nuuealql nuueallq nuueallq nuuealql nuueqall
nuueqall nuueqlal nuueqlla nuueqlla nuueqlal nuuelqal nuuelqla nuuelaql nuuelalq nuuellaq nuuellqa
nuuelqla nuuelqal nuuellqa nuuellaq nuuelalq nuuelaql nuelaqul nuelaqlu nuelauql nuelaulq nuelaluq
nuelalqu nuelqaul nuelqalu nuelqual nuelqula nuelqlua nuelqlau nueluqal nueluqla nueluaql nuelualq
nuelulaq nuelulqa nuellqua nuellqau nuelluqa nuelluaq nuellauq nuellaqu nuealqul nuealqlu nuealuql
nuealulq nuealluq nueallqu nueaqlul nueaqllu nueaqull nueaqull nueaqlul nueaqllu nueauqll nueauqll
nueaulql nueaullq nueaullq nueaulql nuealqul nuealqlu nuealuql nuealulq nuealluq nueallqu nueqalul
nueqallu nueqaull nueqaull nueqalul nueqallu nueqlaul nueqlalu nueqlual nueqlula nueqllua nueqllau
nuequlal nuequlla nuequall nuequall nuequlal nuequlla nueqllua nueqllau nueqlula nueqlual nueqlaul
nueqlalu nueuaqll nueuaqll nueualql nueuallq nueuallq nueualql nueuqall nueuqall nueuqlal nueuqlla
nueuqlla nueuqlal nueulqal nueulqla nueulaql nueulalq nueullaq nueullqa nueulqla nueulqal nueullqa
nueullaq nueulalq nueulaql nuelaqul nuelaqlu nuelauql nuelaulq nuelaluq nuelalqu nuelqaul nuelqalu
nuelqual nuelqula nuelqlua nuelqlau nueluqal nueluqla nueluaql nuelualq nuelulaq nuelulqa nuellqua
nuellqau nuelluqa nuelluaq nuellauq nuellaqu nlulaque nlulaqeu nlulauqe nlulaueq nlulaeuq nlulaequ
nlulqaue nlulqaeu nlulquae nlulquea nlulqeua nlulqeau nluluqae nluluqea nluluaqe nluluaeq nlulueaq
nlulueqa nlulequa nluleqau nluleuqa nluleuaq nluleauq nluleaqu nlualque nlualqeu nlualuqe nlualueq
nlualeuq nlualequ nluaqlue nluaqleu nluaqule nluaquel nluaqeul nluaqelu nluauqle nluauqel nluaulqe
nluauleq nluauelq nluaueql nluaequl nluaeqlu nluaeuql nluaeulq nluaeluq nluaelqu nluqalue nluqaleu
nluqaule nluqauel nluqaeul nluqaelu nluqlaue nluqlaeu nluqluae nluqluea nluqleua nluqleau nluqulae
nluqulea nluquale nluquael nluqueal nluquela nluqelua nluqelau nluqeula nluqeual nluqeaul nluqealu
nluuaqle nluuaqel nluualqe nluualeq nluuaelq nluuaeql nluuqale nluuqael nluuqlae nluuqlea nluuqela
nluuqeal nluulqae nluulqea nluulaqe nluulaeq nluuleaq nluuleqa nluueqla nluueqal nluuelqa nluuelaq
nluuealq nluueaql nlueaqul nlueaqlu nlueauql nlueaulq nluealuq nluealqu nlueqaul nlueqalu nluequal
nluequla nlueqlua nlueqlau nlueuqal nlueuqla nlueuaql nlueualq nlueulaq nlueulqa nluelqua nluelqau
nlueluqa nlueluaq nluelauq nluelaqu nlluaque nlluaqeu nlluauqe nlluaueq nlluaeuq nlluaequ nlluqaue
nlluqaeu nlluquae nlluquea nlluqeua nlluqeau nlluuqae nlluuqea nlluuaqe nlluuaeq nlluueaq nlluueqa
nlluequa nllueqau nllueuqa nllueuaq nllueauq nllueaqu nllauque nllauqeu nllauuqe nllauueq nllaueuq
nllauequ nllaquue nllaqueu nllaquue nllaqueu nllaqeuu nllaqeuu nllauque nllauqeu nllauuqe nllauueq
nllaueuq nllauequ nllaequu nllaequu nllaeuqu nllaeuuq nllaeuuq nllaeuqu nllqauue nllqaueu nllqauue
nllqaueu nllqaeuu nllqaeuu nllquaue nllquaeu nllquuae nllquuea nllqueua nllqueau nllquuae nllquuea
nllquaue nllquaeu nllqueau nllqueua nllqeuua nllqeuau nllqeuua nllqeuau nllqeauu nllqeauu nlluaque
nlluaqeu nlluauqe nlluaueq nlluaeuq nlluaequ nlluqaue nlluqaeu nlluquae nlluquea nlluqeua nlluqeau
nlluuqae nlluuqea nlluuaqe nlluuaeq nlluueaq nlluueqa nlluequa nllueqau nllueuqa nllueuaq nllueauq
nllueaqu nlleaquu nlleaquu nlleauqu nlleauuq nlleauuq nlleauqu nlleqauu nlleqauu nllequau nllequua
nllequua nllequau nlleuqau nlleuqua nlleuaqu nlleuauq nlleuuaq nlleuuqa nlleuqua nlleuqau nlleuuqa
nlleuuaq nlleuauq nlleuaqu nlaluque nlaluqeu nlaluuqe nlaluueq nlalueuq nlaluequ nlalquue nlalqueu
nlalquue nlalqueu nlalqeuu nlalqeuu nlaluque nlaluqeu nlaluuqe nlaluueq nlalueuq nlaluequ nlalequu
nlalequu nlaleuqu nlaleuuq nlaleuuq nlaleuqu nlaulque nlaulqeu nlauluqe nlaulueq nlauleuq nlaulequ
nlauqlue nlauqleu nlauqule nlauquel nlauqeul nlauqelu nlauuqle nlauuqel nlauulqe nlauuleq nlauuelq
nlauueql nlauequl nlaueqlu nlaueuql nlaueulq nlaueluq nlauelqu nlaqulue nlaquleu nlaquule nlaquuel
nlaqueul nlaquelu nlaqluue nlaqlueu nlaqluue nlaqlueu nlaqleuu nlaqleuu nlaqulue nlaquleu nlaquule
nlaquuel nlaqueul nlaquelu nlaqeluu nlaqeluu nlaqeulu nlaqeuul nlaqeuul nlaqeulu nlauuqle nlauuqel
nlauulqe nlauuleq nlauuelq nlauueql nlauqule nlauquel nlauqlue nlauqleu nlauqelu nlauqeul nlaulque
nlaulqeu nlauluqe nlaulueq nlauleuq nlaulequ nlaueqlu nlauequl nlauelqu nlaueluq nlaueulq nlaueuql
nlaeuqul nlaeuqlu nlaeuuql nlaeuulq nlaeuluq nlaeulqu nlaequul nlaequlu nlaequul nlaequlu nlaeqluu
nlaeqluu nlaeuqul nlaeuqlu nlaeuuql nlaeuulq nlaeuluq nlaeulqu nlaelquu nlaelquu nlaeluqu nlaeluuq
nlaeluuq nlaeluqu nlqlauue nlqlaueu nlqlauue nlqlaueu nlqlaeuu nlqlaeuu nlqluaue nlqluaeu nlqluuae
nlqluuea nlqlueua nlqlueau nlqluuae nlqluuea nlqluaue nlqluaeu nlqlueau nlqlueua nlqleuua nlqleuau
nlqleuua nlqleuau nlqleauu nlqleauu nlqaluue nlqalueu nlqaluue nlqalueu nlqaleuu nlqaleuu nlqaulue
nlqauleu nlqauule nlqauuel nlqaueul nlqauelu nlqauule nlqauuel nlqaulue nlqauleu nlqauelu nlqaueul
nlqaeuul nlqaeulu nlqaeuul nlqaeulu nlqaeluu nlqaeluu nlqualue nlqualeu nlquaule nlquauel nlquaeul
nlquaelu nlqulaue nlqulaeu nlquluae nlquluea nlquleua nlquleau nlquulae nlquulea nlquuale nlquuael
nlquueal nlquuela nlquelua nlquelau nlqueula nlqueual nlqueaul nlquealu nlquaule nlquauel nlqualue
nlqualeu nlquaelu nlquaeul nlquuale nlquuael nlquulae nlquulea nlquuela nlquueal nlquluae nlquluea
nlqulaue nlqulaeu nlquleau nlquleua nlqueula nlqueual nlquelua nlquelau nlquealu nlqueaul nlqeauul
nlqeaulu nlqeauul nlqeaulu nlqealuu nlqealuu nlqeuaul nlqeualu nlqeuual nlqeuula nlqeulua nlqeulau
nlqeuual nlqeuula nlqeuaul nlqeualu nlqeulau nlqeulua nlqeluua nlqeluau nlqeluua nlqeluau nlqelauu
nlqelauu nlulaque nlulaqeu nlulauqe nlulaueq nlulaeuq nlulaequ nlulqaue nlulqaeu nlulquae nlulquea
nlulqeua nlulqeau nluluqae nluluqea nluluaqe nluluaeq nlulueaq nlulueqa nlulequa nluleqau nluleuqa
nluleuaq nluleauq nluleaqu nlualque nlualqeu nlualuqe nlualueq nlualeuq nlualequ nluaqlue nluaqleu
nluaqule nluaquel nluaqeul nluaqelu nluauqle nluauqel nluaulqe nluauleq nluauelq nluaueql nluaequl
nluaeqlu nluaeuql nluaeulq nluaeluq nluaelqu nluqalue nluqaleu nluqaule nluqauel nluqaeul nluqaelu
nluqlaue nluqlaeu nluqluae nluqluea nluqleua nluqleau nluqulae nluqulea nluquale nluquael nluqueal
nluquela nluqelua nluqelau nluqeula nluqeual nluqeaul nluqealu nluuaqle nluuaqel nluualqe nluualeq
nluuaelq nluuaeql nluuqale nluuqael nluuqlae nluuqlea nluuqela nluuqeal nluulqae nluulqea nluulaqe
nluulaeq nluuleaq nluuleqa nluueqla nluueqal nluuelqa nluuelaq nluuealq nluueaql nlueaqul nlueaqlu
nlueauql nlueaulq nluealuq nluealqu nlueqaul nlueqalu nluequal nluequla nlueqlua nlueqlau nlueuqal
nlueuqla nlueuaql nlueualq nlueulaq nlueulqa nluelqua nluelqau nlueluqa nlueluaq nluelauq nluelaqu
nlelaquu nlelaquu nlelauqu nlelauuq nlelauuq nlelauqu nlelqauu nlelqauu nlelquau nlelquua nlelquua
nlelquau nleluqau nleluqua nleluaqu nleluauq nleluuaq nleluuqa nleluqua nleluqau nleluuqa nleluuaq
nleluauq nleluaqu nlealquu nlealquu nlealuqu nlealuuq nlealuuq nlealuqu nleaqluu nleaqluu nleaqulu
nleaquul nleaquul nleaqulu nleauqlu nleauqul nleaulqu nleauluq nleauulq nleauuql nleauqul nleauqlu
nleauuql nleauulq nleauluq nleaulqu nleqaluu nleqaluu nleqaulu nleqauul nleqauul nleqaulu nleqlauu
nleqlauu nleqluau nleqluua nleqluua nleqluau nlequlau nlequlua nlequalu nlequaul nlequual nlequula
nlequlua nlequlau nlequula nlequual nlequaul nlequalu nleuaqlu nleuaqul nleualqu nleualuq nleuaulq
nleuauql nleuqalu nleuqaul nleuqlau nleuqlua nleuqula nleuqual nleulqau nleulqua nleulaqu nleulauq
nleuluaq nleuluqa nleuuqla nleuuqal nleuulqa nleuulaq nleuualq nleuuaql nleuaqul nleuaqlu nleuauql
nleuaulq nleualuq nleualqu nleuqaul nleuqalu nleuqual nleuqula nleuqlua nleuqlau nleuuqal nleuuqla
nleuuaql nleuualq nleuulaq nleuulqa nleulqua nleulqau nleuluqa nleuluaq nleulauq nleulaqu nlluaque
nlluaqeu nlluauqe nlluaueq nlluaeuq nlluaequ nlluqaue nlluqaeu nlluquae nlluquea nlluqeua nlluqeau
nlluuqae nlluuqea nlluuaqe nlluuaeq nlluueaq nlluueqa nlluequa nllueqau nllueuqa nllueuaq nllueauq
nllueaqu nllauque nllauqeu nllauuqe nllauueq nllaueuq nllauequ nllaquue nllaqueu nllaquue nllaqueu
nllaqeuu nllaqeuu nllauque nllauqeu nllauuqe nllauueq nllaueuq nllauequ nllaequu nllaequu nllaeuqu
nllaeuuq nllaeuuq nllaeuqu nllqauue nllqaueu nllqauue nllqaueu nllqaeuu nllqaeuu nllquaue nllquaeu
nllquuae nllquuea nllqueua nllqueau nllquuae nllquuea nllquaue nllquaeu nllqueau nllqueua nllqeuua
nllqeuau nllqeuua nllqeuau nllqeauu nllqeauu nlluaque nlluaqeu nlluauqe nlluaueq nlluaeuq nlluaequ
nlluqaue nlluqaeu nlluquae nlluquea nlluqeua nlluqeau nlluuqae nlluuqea nlluuaqe nlluuaeq nlluueaq
nlluueqa nlluequa nllueqau nllueuqa nllueuaq nllueauq nllueaqu nlleaquu nlleaquu nlleauqu nlleauuq
nlleauuq nlleauqu nlleqauu nlleqauu nllequau nllequua nllequua nllequau nlleuqau nlleuqua nlleuaqu
nlleuauq nlleuuaq nlleuuqa nlleuqua nlleuqau nlleuuqa nlleuuaq nlleuauq nlleuaqu nlulaque nlulaqeu
nlulauqe nlulaueq nlulaeuq nlulaequ nlulqaue nlulqaeu nlulquae nlulquea nlulqeua nlulqeau nluluqae
nluluqea nluluaqe nluluaeq nlulueaq nlulueqa nlulequa nluleqau nluleuqa nluleuaq nluleauq nluleaqu
nlualque nlualqeu nlualuqe nlualueq nlualeuq nlualequ nluaqlue nluaqleu nluaqule nluaquel nluaqeul
nluaqelu nluauqle nluauqel nluaulqe nluauleq nluauelq nluaueql nluaequl nluaeqlu nluaeuql nluaeulq
nluaeluq nluaelqu nluqalue nluqaleu nluqaule nluqauel nluqaeul nluqaelu nluqlaue nluqlaeu nluqluae
nluqluea nluqleua nluqleau nluqulae nluqulea nluquale nluquael nluqueal nluquela nluqelua nluqelau
nluqeula nluqeual nluqeaul nluqealu nluuaqle nluuaqel nluualqe nluualeq nluuaelq nluuaeql nluuqale
nluuqael nluuqlae nluuqlea nluuqela nluuqeal nluulqae nluulqea nluulaqe nluulaeq nluuleaq nluuleqa
nluueqla nluueqal nluuelqa nluuelaq nluuealq nluueaql nlueaqul nlueaqlu nlueauql nlueaulq nluealuq
nluealqu nlueqaul nlueqalu nluequal nluequla nlueqlua nlueqlau nlueuqal nlueuqla nlueuaql nlueualq
nlueulaq nlueulqa nluelqua nluelqau nlueluqa nlueluaq nluelauq nluelaqu nlaulque nlaulqeu nlauluqe
nlaulueq nlauleuq nlaulequ nlauqlue nlauqleu nlauqule nlauquel nlauqeul nlauqelu nlauuqle nlauuqel
nlauulqe nlauuleq nlauuelq nlauueql nlauequl nlaueqlu nlaueuql nlaueulq nlaueluq nlauelqu nlaluque
nlaluqeu nlaluuqe nlaluueq nlalueuq nlaluequ nlalquue nlalqueu nlalquue nlalqueu nlalqeuu nlalqeuu
nlaluque nlaluqeu nlaluuqe nlaluueq nlalueuq nlaluequ nlalequu nlalequu nlaleuqu nlaleuuq nlaleuuq
nlaleuqu nlaqluue nlaqlueu nlaqluue nlaqlueu nlaqleuu nlaqleuu nlaqulue nlaquleu nlaquule nlaquuel
nlaqueul nlaquelu nlaquule nlaquuel nlaqulue nlaquleu nlaquelu nlaqueul nlaqeuul nlaqeulu nlaqeuul
nlaqeulu nlaqeluu nlaqeluu nlaulque nlaulqeu nlauluqe nlaulueq nlauleuq nlaulequ nlauqlue nlauqleu
nlauqule nlauquel nlauqeul nlauqelu nlauuqle nlauuqel nlauulqe nlauuleq nlauuelq nlauueql nlauequl
nlaueqlu nlaueuql nlaueulq nlaueluq nlauelqu nlaelquu nlaelquu nlaeluqu nlaeluuq nlaeluuq nlaeluqu
nlaeqluu nlaeqluu nlaequlu nlaequul nlaequul nlaequlu nlaeuqlu nlaeuqul nlaeulqu nlaeuluq nlaeuulq
nlaeuuql nlaeuqul nlaeuqlu nlaeuuql nlaeuulq nlaeuluq nlaeulqu nlqualue nlqualeu nlquaule nlquauel
nlquaeul nlquaelu nlqulaue nlqulaeu nlquluae nlquluea nlquleua nlquleau nlquulae nlquulea nlquuale
nlquuael nlquueal nlquuela nlquelua nlquelau nlqueula nlqueual nlqueaul nlquealu nlqaulue nlqauleu
nlqauule nlqauuel nlqaueul nlqauelu nlqaluue nlqalueu nlqaluue nlqalueu nlqaleuu nlqaleuu nlqaulue
nlqauleu nlqauule nlqauuel nlqaueul nlqauelu nlqaeluu nlqaeluu nlqaeulu nlqaeuul nlqaeuul nlqaeulu
nlqlauue nlqlaueu nlqlauue nlqlaueu nlqlaeuu nlqlaeuu nlqluaue nlqluaeu nlqluuae nlqluuea nlqlueua
nlqlueau nlqluuae nlqluuea nlqluaue nlqluaeu nlqlueau nlqlueua nlqleuua nlqleuau nlqleuua nlqleuau
nlqleauu nlqleauu nlqualue nlqualeu nlquaule nlquauel nlquaeul nlquaelu nlqulaue nlqulaeu nlquluae
nlquluea nlquleua nlquleau nlquulae nlquulea nlquuale nlquuael nlquueal nlquuela nlquelua nlquelau
nlqueula nlqueual nlqueaul nlquealu nlqealuu nlqealuu nlqeaulu nlqeauul nlqeauul nlqeaulu nlqelauu
nlqelauu nlqeluau nlqeluua nlqeluua nlqeluau nlqeulau nlqeulua nlqeualu nlqeuaul nlqeuual nlqeuula
nlqeulua nlqeulau nlqeuula nlqeuual nlqeuaul nlqeualu nluuaqle nluuaqel nluualqe nluualeq nluuaelq
nluuaeql nluuqale nluuqael nluuqlae nluuqlea nluuqela nluuqeal nluulqae nluulqea nluulaqe nluulaeq
nluuleaq nluuleqa nluueqla nluueqal nluuelqa nluuelaq nluuealq nluueaql nluauqle nluauqel nluaulqe
nluauleq nluauelq nluaueql nluaqule nluaquel nluaqlue nluaqleu nluaqelu nluaqeul nlualque nlualqeu
nlualuqe nlualueq nlualeuq nlualequ nluaeqlu nluaequl nluaelqu nluaeluq nluaeulq nluaeuql nluqaule
nluqauel nluqalue nluqaleu nluqaelu nluqaeul nluquale nluquael nluqulae nluqulea nluquela nluqueal
nluqluae nluqluea nluqlaue nluqlaeu nluqleau nluqleua nluqeula nluqeual nluqelua nluqelau nluqealu
nluqeaul nlulaque nlulaqeu nlulauqe nlulaueq nlulaeuq nlulaequ nlulqaue nlulqaeu nlulquae nlulquea
nlulqeua nlulqeau nluluqae nluluqea nluluaqe nluluaeq nlulueaq nlulueqa nlulequa nluleqau nluleuqa
nluleuaq nluleauq nluleaqu nlueaqlu nlueaqul nluealqu nluealuq nlueaulq nlueauql nlueqalu nlueqaul
nlueqlau nlueqlua nluequla nluequal nluelqau nluelqua nluelaqu nluelauq nlueluaq nlueluqa nlueuqla
nlueuqal nlueulqa nlueulaq nlueualq nlueuaql nleuaqul nleuaqlu nleuauql nleuaulq nleualuq nleualqu
nleuqaul nleuqalu nleuqual nleuqula nleuqlua nleuqlau nleuuqal nleuuqla nleuuaql nleuualq nleuulaq
nleuulqa nleulqua nleulqau nleuluqa nleuluaq nleulauq nleulaqu nleauqul nleauqlu nleauuql nleauulq
nleauluq nleaulqu nleaquul nleaqulu nleaquul nleaqulu nleaqluu nleaqluu nleauqul nleauqlu nleauuql
nleauulq nleauluq nleaulqu nlealquu nlealquu nlealuqu nlealuuq nlealuuq nlealuqu nleqauul nleqaulu
nleqauul nleqaulu nleqaluu nleqaluu nlequaul nlequalu nlequual nlequula nlequlua nlequlau nlequual
nlequula nlequaul nlequalu nlequlau nlequlua nleqluua nleqluau nleqluua nleqluau nleqlauu nleqlauu
nleuaqul nleuaqlu nleuauql nleuaulq nleualuq nleualqu nleuqaul nleuqalu nleuqual nleuqula nleuqlua
nleuqlau nleuuqal nleuuqla nleuuaql nleuualq nleuulaq nleuulqa nleulqua nleulqau nleuluqa nleuluaq
nleulauq nleulaqu nlelaquu nlelaquu nlelauqu nlelauuq nlelauuq nlelauqu nlelqauu nlelqauu nlelquau
nlelquua nlelquua nlelquau nleluqau nleluqua nleluaqu nleluauq nleluuaq nleluuqa nleluqua nleluqau
nleluuqa nleluuaq nleluauq nleluaqu nalluque nalluqeu nalluuqe nalluueq nallueuq nalluequ nallquue
nallqueu nallquue nallqueu nallqeuu nallqeuu nalluque nalluqeu nalluuqe nalluueq nallueuq nalluequ
nallequu nallequu nalleuqu nalleuuq nalleuuq nalleuqu nalulque nalulqeu naluluqe nalulueq naluleuq
nalulequ naluqlue naluqleu naluqule naluquel naluqeul naluqelu naluuqle naluuqel naluulqe naluuleq
naluuelq naluueql naluequl nalueqlu nalueuql nalueulq nalueluq naluelqu nalqulue nalquleu nalquule
nalquuel nalqueul nalquelu nalqluue nalqlueu nalqluue nalqlueu nalqleuu nalqleuu nalqulue nalquleu
nalquule nalquuel nalqueul nalquelu nalqeluu nalqeluu nalqeulu nalqeuul nalqeuul nalqeulu naluuqle
naluuqel naluulqe naluuleq naluuelq naluueql naluqule naluquel naluqlue naluqleu naluqelu naluqeul
nalulque nalulqeu naluluqe nalulueq naluleuq nalulequ nalueqlu naluequl naluelqu nalueluq nalueulq
nalueuql naleuqul naleuqlu naleuuql naleuulq naleuluq naleulqu nalequul nalequlu nalequul nalequlu
naleqluu naleqluu naleuqul naleuqlu naleuuql naleuulq naleuluq naleulqu nalelquu nalelquu naleluqu
naleluuq naleluuq naleluqu nalluque nalluqeu nalluuqe nalluueq nallueuq nalluequ nallquue nallqueu
nallquue nallqueu nallqeuu nallqeuu nalluque nalluqeu nalluuqe nalluueq nallueuq nalluequ nallequu
nallequu nalleuqu nalleuuq nalleuuq nalleuqu nalulque nalulqeu naluluqe nalulueq naluleuq nalulequ
naluqlue naluqleu naluqule naluquel naluqeul naluqelu naluuqle naluuqel naluulqe naluuleq naluuelq
naluueql naluequl nalueqlu nalueuql nalueulq nalueluq naluelqu nalqulue nalquleu nalquule nalquuel
nalqueul nalquelu nalqluue nalqlueu nalqluue nalqlueu nalqleuu nalqleuu nalqulue nalquleu nalquule
nalquuel nalqueul nalquelu nalqeluu nalqeluu nalqeulu nalqeuul nalqeuul nalqeulu naluuqle naluuqel
naluulqe naluuleq naluuelq naluueql naluqule naluquel naluqlue naluqleu naluqelu naluqeul nalulque
nalulqeu naluluqe nalulueq naluleuq nalulequ nalueqlu naluequl naluelqu nalueluq nalueulq nalueuql
naleuqul naleuqlu naleuuql naleuulq naleuluq naleulqu nalequul nalequlu nalequul nalequlu naleqluu
naleqluu naleuqul naleuqlu naleuuql naleuulq naleuluq naleulqu nalelquu nalelquu naleluqu naleluuq
naleluuq naleluqu naullque naullqeu naulluqe naullueq naulleuq naullequ naulqlue naulqleu naulqule
naulquel naulqeul naulqelu nauluqle nauluqel naululqe naululeq nauluelq naulueql naulequl nauleqlu
nauleuql nauleulq nauleluq naulelqu naullque naullqeu naulluqe naullueq naulleuq naullequ naulqlue
naulqleu naulqule naulquel naulqeul naulqelu nauluqle nauluqel naululqe naululeq nauluelq naulueql
naulequl nauleqlu nauleuql nauleulq nauleluq naulelqu nauqllue nauqlleu nauqlule nauqluel nauqleul
nauqlelu nauqllue nauqlleu nauqlule nauqluel nauqleul nauqlelu nauqulle nauqulel nauqulle nauqulel
nauquell nauquell nauqelul nauqellu nauqeull nauqeull nauqelul nauqellu nauulqle nauulqel nauullqe
nauulleq nauulelq nauuleql nauuqlle nauuqlel nauuqlle nauuqlel nauuqell nauuqell nauulqle nauulqel
nauullqe nauulleq nauulelq nauuleql nauueqll nauueqll nauuelql nauuellq nauuellq nauuelql nauelqul
nauelqlu naueluql nauelulq nauelluq nauellqu naueqlul naueqllu nauequll nauequll naueqlul naueqllu
naueuqll naueuqll naueulql naueullq naueullq naueulql nauelqul nauelqlu naueluql nauelulq nauelluq
nauellqu naqlulue naqluleu naqluule naqluuel naqlueul naqluelu naqlluue naqllueu naqlluue naqllueu
naqlleuu naqlleuu naqlulue naqluleu naqluule naqluuel naqlueul naqluelu naqleluu naqleluu naqleulu
naqleuul naqleuul naqleulu naqullue naqulleu naqulule naquluel naquleul naqulelu naqullue naqulleu
naqulule naquluel naquleul naqulelu naquulle naquulel naquulle naquulel naquuell naquuell naquelul
naquellu naqueull naqueull naquelul naquellu naqlulue naqluleu naqluule naqluuel naqlueul naqluelu
naqlluue naqllueu naqlluue naqllueu naqlleuu naqlleuu naqlulue naqluleu naqluule naqluuel naqlueul
naqluelu naqleluu naqleluu naqleulu naqleuul naqleuul naqleulu naquulle naquulel naquulle naquulel
naquuell naquuell naqulule naquluel naqullue naqulleu naqulelu naquleul naqullue naqulleu naqulule
naquluel naquleul naqulelu naquellu naquelul naquellu naquelul naqueull naqueull naqeulul naqeullu
naqeuull naqeuull naqeulul naqeullu naqeluul naqelulu naqeluul naqelulu naqelluu naqelluu naqeulul
naqeullu naqeuull naqeuull naqeulul naqeullu naqelluu naqelluu naqelulu naqeluul naqeluul naqelulu
nauluqle nauluqel naululqe naululeq nauluelq naulueql naulqule naulquel naulqlue naulqleu naulqelu
naulqeul naullque naullqeu naulluqe naullueq naulleuq naullequ nauleqlu naulequl naulelqu nauleluq
nauleulq nauleuql nauulqle nauulqel nauullqe nauulleq nauulelq nauuleql nauuqlle nauuqlel nauuqlle
nauuqlel nauuqell nauuqell nauulqle nauulqel nauullqe nauulleq nauulelq nauuleql nauueqll nauueqll
nauuelql nauuellq nauuellq nauuelql nauqulle nauqulel nauqulle nauqulel nauquell nauquell nauqlule
nauqluel nauqllue nauqlleu nauqlelu nauqleul nauqllue nauqlleu nauqlule nauqluel nauqleul nauqlelu
nauqellu nauqelul nauqellu nauqelul nauqeull nauqeull nauluqle nauluqel naululqe naululeq nauluelq
naulueql naulqule naulquel naulqlue naulqleu naulqelu naulqeul naullque naullqeu naulluqe naullueq
naulleuq naullequ nauleqlu naulequl naulelqu nauleluq nauleulq nauleuql naueuqll naueuqll naueulql
naueullq naueullq naueulql nauequll nauequll naueqlul naueqllu naueqllu naueqlul nauelqul nauelqlu
naueluql nauelulq nauelluq nauellqu nauelqlu nauelqul nauellqu nauelluq nauelulq naueluql naeluqul
naeluqlu naeluuql naeluulq naeluluq naelulqu naelquul naelqulu naelquul naelqulu naelqluu naelqluu
naeluqul naeluqlu naeluuql naeluulq naeluluq naelulqu naellquu naellquu naelluqu naelluuq naelluuq
naelluqu naeulqul naeulqlu naeuluql naeululq naeulluq naeullqu naeuqlul naeuqllu naeuqull naeuqull
naeuqlul naeuqllu naeuuqll naeuuqll naeuulql naeuullq naeuullq naeuulql naeulqul naeulqlu naeuluql
naeululq naeulluq naeullqu naequlul naequllu naequull naequull naequlul naequllu naeqluul naeqlulu
naeqluul naeqlulu naeqlluu naeqlluu naequlul naequllu naequull naequull naequlul naequllu naeqlluu
naeqlluu naeqlulu naeqluul naeqluul naeqlulu naeuuqll naeuuqll naeuulql naeuullq naeuullq naeuulql
naeuqull naeuqull naeuqlul naeuqllu naeuqllu naeuqlul naeulqul naeulqlu naeuluql naeululq naeulluq
naeullqu naeulqlu naeulqul naeullqu naeulluq naeululq naeuluql naeluqul naeluqlu naeluuql naeluulq
naeluluq naelulqu naelquul naelqulu naelquul naelqulu naelqluu naelqluu naeluqul naeluqlu naeluuql
naeluulq naeluluq naelulqu naellquu naellquu naelluqu naelluuq naelluuq naelluqu nqllauue nqllaueu
nqllauue nqllaueu nqllaeuu nqllaeuu nqlluaue nqlluaeu nqlluuae nqlluuea nqllueua nqllueau nqlluuae
nqlluuea nqlluaue nqlluaeu nqllueau nqllueua nqlleuua nqlleuau nqlleuua nqlleuau nqlleauu nqlleauu
nqlaluue nqlalueu nqlaluue nqlalueu nqlaleuu nqlaleuu nqlaulue nqlauleu nqlauule nqlauuel nqlaueul
nqlauelu nqlauule nqlauuel nqlaulue nqlauleu nqlauelu nqlaueul nqlaeuul nqlaeulu nqlaeuul nqlaeulu
nqlaeluu nqlaeluu nqlualue nqlualeu nqluaule nqluauel nqluaeul nqluaelu nqlulaue nqlulaeu nqluluae
nqluluea nqluleua nqluleau nqluulae nqluulea nqluuale nqluuael nqluueal nqluuela nqluelua nqluelau
nqlueula nqlueual nqlueaul nqluealu nqluaule nqluauel nqlualue nqlualeu nqluaelu nqluaeul nqluuale
nqluuael nqluulae nqluulea nqluuela nqluueal nqluluae nqluluea nqlulaue nqlulaeu nqluleau nqluleua
nqlueula nqlueual nqluelua nqluelau nqluealu nqlueaul nqleauul nqleaulu nqleauul nqleaulu nqlealuu
nqlealuu nqleuaul nqleualu nqleuual nqleuula nqleulua nqleulau nqleuual nqleuula nqleuaul nqleualu
nqleulau nqleulua nqleluua nqleluau nqleluua nqleluau nqlelauu nqlelauu nqllauue nqllaueu nqllauue
nqllaueu nqllaeuu nqllaeuu nqlluaue nqlluaeu nqlluuae nqlluuea nqllueua nqllueau nqlluuae nqlluuea
nqlluaue nqlluaeu nqllueau nqllueua nqlleuua nqlleuau nqlleuua nqlleuau nqlleauu nqlleauu nqlaluue
nqlalueu nqlaluue nqlalueu nqlaleuu nqlaleuu nqlaulue nqlauleu nqlauule nqlauuel nqlaueul nqlauelu
nqlauule nqlauuel nqlaulue nqlauleu nqlauelu nqlaueul nqlaeuul nqlaeulu nqlaeuul nqlaeulu nqlaeluu
nqlaeluu nqlualue nqlualeu nqluaule nqluauel nqluaeul nqluaelu nqlulaue nqlulaeu nqluluae nqluluea
nqluleua nqluleau nqluulae nqluulea nqluuale nqluuael nqluueal nqluuela nqluelua nqluelau nqlueula
nqlueual nqlueaul nqluealu nqluaule nqluauel nqlualue nqlualeu nqluaelu nqluaeul nqluuale nqluuael
nqluulae nqluulea nqluuela nqluueal nqluluae nqluluea nqlulaue nqlulaeu nqluleau nqluleua nqlueula
nqlueual nqluelua nqluelau nqluealu nqlueaul nqleauul nqleaulu nqleauul nqleaulu nqlealuu nqlealuu
nqleuaul nqleualu nqleuual nqleuula nqleulua nqleulau nqleuual nqleuula nqleuaul nqleualu nqleulau
nqleulua nqleluua nqleluau nqleluua nqleluau nqlelauu nqlelauu nqalluue nqallueu nqalluue nqallueu
nqalleuu nqalleuu nqalulue nqaluleu nqaluule nqaluuel nqalueul nqaluelu nqaluule nqaluuel nqalulue
nqaluleu nqaluelu nqalueul nqaleuul nqaleulu nqaleuul nqaleulu nqaleluu nqaleluu nqalluue nqallueu
nqalluue nqallueu nqalleuu nqalleuu nqalulue nqaluleu nqaluule nqaluuel nqalueul nqaluelu nqaluule
nqaluuel nqalulue nqaluleu nqaluelu nqalueul nqaleuul nqaleulu nqaleuul nqaleulu nqaleluu nqaleluu
nqaullue nqaulleu nqaulule nqauluel nqauleul nqaulelu nqaullue nqaulleu nqaulule nqauluel nqauleul
nqaulelu nqauulle nqauulel nqauulle nqauulel nqauuell nqauuell nqauelul nqauellu nqaueull nqaueull
nqauelul nqauellu nqaulule nqauluel nqaullue nqaulleu nqaulelu nqauleul nqauulle nqauulel nqauulle
nqauulel nqauuell nqauuell nqaulule nqauluel nqaullue nqaulleu nqaulelu nqauleul nqaueull nqaueull
nqauelul nqauellu nqauellu nqauelul nqaeluul nqaelulu nqaeluul nqaelulu nqaelluu nqaelluu nqaeulul
nqaeullu nqaeuull nqaeuull nqaeulul nqaeullu nqaeuull nqaeuull nqaeulul nqaeullu nqaeullu nqaeulul
nqaeluul nqaelulu nqaeluul nqaelulu nqaelluu nqaelluu nqulalue nqulaleu nqulaule nqulauel nqulaeul
nqulaelu nqullaue nqullaeu nqulluae nqulluea nqulleua nqulleau nqululae nqululea nquluale nquluael
nqulueal nquluela nqulelua nqulelau nquleula nquleual nquleaul nqulealu nquallue nqualleu nqualule
nqualuel nqualeul nqualelu nquallue nqualleu nqualule nqualuel nqualeul nqualelu nquaulle nquaulel
nquaulle nquaulel nquauell nquauell nquaelul nquaellu nquaeull nquaeull nquaelul nquaellu nqulalue
nqulaleu nqulaule nqulauel nqulaeul nqulaelu nqullaue nqullaeu nqulluae nqulluea nqulleua nqulleau
nqululae nqululea nquluale nquluael nqulueal nquluela nqulelua nqulelau nquleula nquleual nquleaul
nqulealu nquualle nquualel nquualle nquualel nquuaell nquuaell nquulale nquulael nquullae nquullea
nquulela nquuleal nquullae nquullea nquulale nquulael nquuleal nquulela nquuella nquuelal nquuella
nquuelal nquueall nquueall nquealul nqueallu nqueaull nqueaull nquealul nqueallu nquelaul nquelalu
nquelual nquelula nquellua nquellau nqueulal nqueulla nqueuall nqueuall nqueulal nqueulla nquellua
nquellau nquelula nquelual nquelaul nquelalu nqulaule nqulauel nqulalue nqulaleu nqulaelu nqulaeul
nquluale nquluael nqululae nqululea nquluela nqulueal nqulluae nqulluea nqullaue nqullaeu nqulleau
nqulleua nquleula nquleual nqulelua nqulelau nqulealu nquleaul nqualule nqualuel nquallue nqualleu
nqualelu nqualeul nquaulle nquaulel nquaulle nquaulel nquauell nquauell nqualule nqualuel nquallue
nqualleu nqualelu nqualeul nquaeull nquaeull nquaelul nquaellu nquaellu nquaelul nquualle nquualel
nquualle nquualel nquuaell nquuaell nquulale nquulael nquullae nquullea nquulela nquuleal nquullae
nquullea nquulale nquulael nquuleal nquulela nquuella nquuelal nquuella nquuelal nquueall nquueall
nqulaule nqulauel nqulalue nqulaleu nqulaelu nqulaeul nquluale nquluael nqululae nqululea nquluela
nqulueal nqulluae nqulluea nqullaue nqullaeu nqulleau nqulleua nquleula nquleual nqulelua nqulelau
nqulealu nquleaul nqueaull nqueaull nquealul nqueallu nqueallu nquealul nqueuall nqueuall nqueulal
nqueulla nqueulla nqueulal nquelual nquelula nquelaul nquelalu nquellau nquellua nquelula nquelual
nquellua nquellau nquelalu nquelaul nqelauul nqelaulu nqelauul nqelaulu nqelaluu nqelaluu nqeluaul
nqelualu nqeluual nqeluula nqelulua nqelulau nqeluual nqeluula nqeluaul nqelualu nqelulau nqelulua
nqelluua nqelluau nqelluua nqelluau nqellauu nqellauu nqealuul nqealulu nqealuul nqealulu nqealluu
nqealluu nqeaulul nqeaullu nqeauull nqeauull nqeaulul nqeaullu nqeauull nqeauull nqeaulul nqeaullu
nqeaullu nqeaulul nqealuul nqealulu nqealuul nqealulu nqealluu nqealluu nqeualul nqeuallu nqeuaull
nqeuaull nqeualul nqeuallu nqeulaul nqeulalu nqeulual nqeulula nqeullua nqeullau nqeuulal nqeuulla
nqeuuall nqeuuall nqeuulal nqeuulla nqeullua nqeullau nqeulula nqeulual nqeulaul nqeulalu nqeuaull
nqeuaull nqeualul nqeuallu nqeuallu nqeualul nqeuuall nqeuuall nqeuulal nqeuulla nqeuulla nqeuulal
nqeulual nqeulula nqeulaul nqeulalu nqeullau nqeullua nqeulula nqeulual nqeullua nqeullau nqeulalu
nqeulaul nqelauul nqelaulu nqelauul nqelaulu nqelaluu nqelaluu nqeluaul nqelualu nqeluual nqeluula
nqelulua nqelulau nqeluual nqeluula nqeluaul nqelualu nqelulau nqelulua nqelluua nqelluau nqelluua
nqelluau nqellauu nqellauu nullaque nullaqeu nullauqe nullaueq nullaeuq nullaequ nullqaue nullqaeu
nullquae nullquea nullqeua nullqeau nulluqae nulluqea nulluaqe nulluaeq nullueaq nullueqa nullequa
nulleqau nulleuqa nulleuaq nulleauq nulleaqu nulalque nulalqeu nulaluqe nulalueq nulaleuq nulalequ
nulaqlue nulaqleu nulaqule nulaquel nulaqeul nulaqelu nulauqle nulauqel nulaulqe nulauleq nulauelq
nulaueql nulaequl nulaeqlu nulaeuql nulaeulq nulaeluq nulaelqu nulqalue nulqaleu nulqaule nulqauel
nulqaeul nulqaelu nulqlaue nulqlaeu nulqluae nulqluea nulqleua nulqleau nulqulae nulqulea nulquale
nulquael nulqueal nulquela nulqelua nulqelau nulqeula nulqeual nulqeaul nulqealu nuluaqle nuluaqel
nulualqe nulualeq nuluaelq nuluaeql nuluqale nuluqael nuluqlae nuluqlea nuluqela nuluqeal nululqae
nululqea nululaqe nululaeq nululeaq nululeqa nulueqla nulueqal nuluelqa nuluelaq nuluealq nulueaql
nuleaqul nuleaqlu nuleauql nuleaulq nulealuq nulealqu nuleqaul nuleqalu nulequal nulequla nuleqlua
nuleqlau nuleuqal nuleuqla nuleuaql nuleualq nuleulaq nuleulqa nulelqua nulelqau nuleluqa nuleluaq
nulelauq nulelaqu nullaque nullaqeu nullauqe nullaueq nullaeuq nullaequ nullqaue nullqaeu nullquae
nullquea nullqeua nullqeau nulluqae nulluqea nulluaqe nulluaeq nullueaq nullueqa nullequa nulleqau
nulleuqa nulleuaq nulleauq nulleaqu nulalque nulalqeu nulaluqe nulalueq nulaleuq nulalequ nulaqlue
nulaqleu nulaqule nulaquel nulaqeul nulaqelu nulauqle nulauqel nulaulqe nulauleq nulauelq nulaueql
nulaequl nulaeqlu nulaeuql nulaeulq nulaeluq nulaelqu nulqalue nulqaleu nulqaule nulqauel nulqaeul
nulqaelu nulqlaue nulqlaeu nulqluae nulqluea nulqleua nulqleau nulqulae nulqulea nulquale nulquael
nulqueal nulquela nulqelua nulqelau nulqeula nulqeual nulqeaul nulqealu nuluaqle nuluaqel nulualqe
nulualeq nuluaelq nuluaeql nuluqale nuluqael nuluqlae nuluqlea nuluqela nuluqeal nululqae nululqea
nululaqe nululaeq nululeaq nululeqa nulueqla nulueqal nuluelqa nuluelaq nuluealq nulueaql nuleaqul
nuleaqlu nuleauql nuleaulq nulealuq nulealqu nuleqaul nuleqalu nulequal nulequla nuleqlua nuleqlau
nuleuqal nuleuqla nuleuaql nuleualq nuleulaq nuleulqa nulelqua nulelqau nuleluqa nuleluaq nulelauq
nulelaqu nuallque nuallqeu nualluqe nuallueq nualleuq nuallequ nualqlue nualqleu nualqule nualquel
nualqeul nualqelu nualuqle nualuqel nualulqe nualuleq nualuelq nualueql nualequl nualeqlu nualeuql
nualeulq nualeluq nualelqu nuallque nuallqeu nualluqe nuallueq nualleuq nuallequ nualqlue nualqleu
nualqule nualquel nualqeul nualqelu nualuqle nualuqel nualulqe nualuleq nualuelq nualueql nualequl
nualeqlu nualeuql nualeulq nualeluq nualelqu nuaqllue nuaqlleu nuaqlule nuaqluel nuaqleul nuaqlelu
nuaqllue nuaqlleu nuaqlule nuaqluel nuaqleul nuaqlelu nuaqulle nuaqulel nuaqulle nuaqulel nuaquell
nuaquell nuaqelul nuaqellu nuaqeull nuaqeull nuaqelul nuaqellu nuaulqle nuaulqel nuaullqe nuaulleq
nuaulelq nuauleql nuauqlle nuauqlel nuauqlle nuauqlel nuauqell nuauqell nuaulqle nuaulqel nuaullqe
nuaulleq nuaulelq nuauleql nuaueqll nuaueqll nuauelql nuauellq nuauellq nuauelql nuaelqul nuaelqlu
nuaeluql nuaelulq nuaelluq nuaellqu nuaeqlul nuaeqllu nuaequll nuaequll nuaeqlul nuaeqllu nuaeuqll
nuaeuqll nuaeulql nuaeullq nuaeullq nuaeulql nuaelqul nuaelqlu nuaeluql nuaelulq nuaelluq nuaellqu
nuqlalue nuqlaleu nuqlaule nuqlauel nuqlaeul nuqlaelu nuqllaue nuqllaeu nuqlluae nuqlluea nuqlleua
nuqlleau nuqlulae nuqlulea nuqluale nuqluael nuqlueal nuqluela nuqlelua nuqlelau nuqleula nuqleual
nuqleaul nuqlealu nuqallue nuqalleu nuqalule nuqaluel nuqaleul nuqalelu nuqallue nuqalleu nuqalule
nuqaluel nuqaleul nuqalelu nuqaulle nuqaulel nuqaulle nuqaulel nuqauell nuqauell nuqaelul nuqaellu
nuqaeull nuqaeull nuqaelul nuqaellu nuqlalue nuqlaleu nuqlaule nuqlauel nuqlaeul nuqlaelu nuqllaue
nuqllaeu nuqlluae nuqlluea nuqlleua nuqlleau nuqlulae nuqlulea nuqluale nuqluael nuqlueal nuqluela
nuqlelua nuqlelau nuqleula nuqleual nuqleaul nuqlealu nuqualle nuqualel nuqualle nuqualel nuquaell
nuquaell nuqulale nuqulael nuqullae nuqullea nuqulela nuquleal nuqullae nuqullea nuqulale nuqulael
nuquleal nuqulela nuquella nuquelal nuquella nuquelal nuqueall nuqueall nuqealul nuqeallu nuqeaull
nuqeaull nuqealul nuqeallu nuqelaul nuqelalu nuqelual nuqelula nuqellua nuqellau nuqeulal nuqeulla
nuqeuall nuqeuall nuqeulal nuqeulla nuqellua nuqellau nuqelula nuqelual nuqelaul nuqelalu nuulaqle
nuulaqel nuulalqe nuulaleq nuulaelq nuulaeql nuulqale nuulqael nuulqlae nuulqlea nuulqela nuulqeal
nuullqae nuullqea nuullaqe nuullaeq nuulleaq nuulleqa nuuleqla nuuleqal nuulelqa nuulelaq nuulealq
nuuleaql nuualqle nuualqel nuuallqe nuualleq nuualelq nuualeql nuuaqlle nuuaqlel nuuaqlle nuuaqlel
nuuaqell nuuaqell nuualqle nuualqel nuuallqe nuualleq nuualelq nuualeql nuuaeqll nuuaeqll nuuaelql
nuuaellq nuuaellq nuuaelql nuuqalle nuuqalel nuuqalle nuuqalel nuuqaell nuuqaell nuuqlale nuuqlael
nuuqllae nuuqllea nuuqlela nuuqleal nuuqllae nuuqllea nuuqlale nuuqlael nuuqleal nuuqlela nuuqella
nuuqelal nuuqella nuuqelal nuuqeall nuuqeall nuulaqle nuulaqel nuulalqe nuulaleq nuulaelq nuulaeql
nuulqale nuulqael nuulqlae nuulqlea nuulqela nuulqeal nuullqae nuullqea nuullaqe nuullaeq nuulleaq
nuulleqa nuuleqla nuuleqal nuulelqa nuulelaq nuulealq nuuleaql nuueaqll nuueaqll nuuealql nuueallq
nuueallq nuuealql nuueqall nuueqall nuueqlal nuueqlla nuueqlla nuueqlal nuuelqal nuuelqla nuuelaql
nuuelalq nuuellaq nuuellqa nuuelqla nuuelqal nuuellqa nuuellaq nuuelalq nuuelaql nuelaqul nuelaqlu
nuelauql nuelaulq nuelaluq nuelalqu nuelqaul nuelqalu nuelqual nuelqula nuelqlua nuelqlau nueluqal
nueluqla nueluaql nuelualq nuelulaq nuelulqa nuellqua nuellqau nuelluqa nuelluaq nuellauq nuellaqu
nuealqul nuealqlu nuealuql nuealulq nuealluq nueallqu nueaqlul nueaqllu nueaqull nueaqull nueaqlul
nueaqllu nueauqll nueauqll nueaulql nueaullq nueaullq nueaulql nuealqul nuealqlu nuealuql nuealulq
nuealluq nueallqu nueqalul nueqallu nueqaull nueqaull nueqalul nueqallu nueqlaul nueqlalu nueqlual
nueqlula nueqllua nueqllau nuequlal nuequlla nuequall nuequall nuequlal nuequlla nueqllua nueqllau
nueqlula nueqlual nueqlaul nueqlalu nueuaqll nueuaqll nueualql nueuallq nueuallq nueualql nueuqall
nueuqall nueuqlal nueuqlla nueuqlla nueuqlal nueulqal nueulqla nueulaql nueulalq nueullaq nueullqa
nueulqla nueulqal nueullqa nueullaq nueulalq nueulaql nuelaqul nuelaqlu nuelauql nuelaulq nuelaluq
nuelalqu nuelqaul nuelqalu nuelqual nuelqula nuelqlua nuelqlau nueluqal nueluqla nueluaql nuelualq
nuelulaq nuelulqa nuellqua nuellqau nuelluqa nuelluaq nuellauq nuellaqu nellaquu nellaquu nellauqu
nellauuq nellauuq nellauqu nellqauu nellqauu nellquau nellquua nellquua nellquau nelluqau nelluqua
nelluaqu nelluauq nelluuaq nelluuqa nelluqua nelluqau nelluuqa nelluuaq nelluauq nelluaqu nelalquu
nelalquu nelaluqu nelaluuq nelaluuq nelaluqu nelaqluu nelaqluu nelaqulu nelaquul nelaquul nelaqulu
nelauqlu nelauqul nelaulqu nelauluq nelauulq nelauuql nelauqul nelauqlu nelauuql nelauulq nelauluq
nelaulqu nelqaluu nelqaluu nelqaulu nelqauul nelqauul nelqaulu nelqlauu nelqlauu nelqluau nelqluua
nelqluua nelqluau nelqulau nelqulua nelqualu nelquaul nelquual nelquula nelqulua nelqulau nelquula
nelquual nelquaul nelqualu neluaqlu neluaqul nelualqu nelualuq neluaulq neluauql neluqalu neluqaul
neluqlau neluqlua neluqula neluqual nelulqau nelulqua nelulaqu nelulauq neluluaq neluluqa neluuqla
neluuqal neluulqa neluulaq neluualq neluuaql neluaqul neluaqlu neluauql neluaulq nelualuq nelualqu
neluqaul neluqalu neluqual neluqula neluqlua neluqlau neluuqal neluuqla neluuaql neluualq neluulaq
neluulqa nelulqua nelulqau neluluqa neluluaq nelulauq nelulaqu nellaquu nellaquu nellauqu nellauuq
nellauuq nellauqu nellqauu nellqauu nellquau nellquua nellquua nellquau nelluqau nelluqua nelluaqu
nelluauq nelluuaq nelluuqa nelluqua nelluqau nelluuqa nelluuaq nelluauq nelluaqu nelalquu nelalquu
nelaluqu nelaluuq nelaluuq nelaluqu nelaqluu nelaqluu nelaqulu nelaquul nelaquul nelaqulu nelauqlu
nelauqul nelaulqu nelauluq nelauulq nelauuql nelauqul nelauqlu nelauuql nelauulq nelauluq nelaulqu
nelqaluu nelqaluu nelqaulu nelqauul nelqauul nelqaulu nelqlauu nelqlauu nelqluau nelqluua nelqluua
nelqluau nelqulau nelqulua nelqualu nelquaul nelquual nelquula nelqulua nelqulau nelquula nelquual
nelquaul nelqualu neluaqlu neluaqul nelualqu nelualuq neluaulq neluauql neluqalu neluqaul neluqlau
neluqlua neluqula neluqual nelulqau nelulqua nelulaqu nelulauq neluluaq neluluqa neluuqla neluuqal
neluulqa neluulaq neluualq neluuaql neluaqul neluaqlu neluauql neluaulq nelualuq nelualqu neluqaul
neluqalu neluqual neluqula neluqlua neluqlau neluuqal neluuqla neluuaql neluualq neluulaq neluulqa
nelulqua nelulqau neluluqa neluluaq nelulauq nelulaqu neallquu neallquu nealluqu nealluuq nealluuq
nealluqu nealqluu nealqluu nealqulu nealquul nealquul nealqulu nealuqlu nealuqul nealulqu nealuluq
nealuulq nealuuql nealuqul nealuqlu nealuuql nealuulq nealuluq nealulqu neallquu neallquu nealluqu
nealluuq nealluuq nealluqu nealqluu nealqluu nealqulu nealquul nealquul nealqulu nealuqlu nealuqul
nealulqu nealuluq nealuulq nealuuql nealuqul nealuqlu nealuuql nealuulq nealuluq nealulqu neaqlluu
neaqlluu neaqlulu neaqluul neaqluul neaqlulu neaqlluu neaqlluu neaqlulu neaqluul neaqluul neaqlulu
neaqullu neaqulul neaqullu neaqulul neaquull neaquull neaqulul neaqullu neaquull neaquull neaqulul
neaqullu neaulqlu neaulqul neaullqu neaulluq neaululq neauluql neauqllu neauqlul neauqllu neauqlul
neauqull neauqull neaulqlu neaulqul neaullqu neaulluq neaululq neauluql neauuqll neauuqll neauulql
neauullq neauullq neauulql neaulqul neaulqlu neauluql neaululq neaulluq neaullqu neauqlul neauqllu
neauqull neauqull neauqlul neauqllu neauuqll neauuqll neauulql neauullq neauullq neauulql neaulqul
neaulqlu neauluql neaululq neaulluq neaullqu neqlaluu neqlaluu neqlaulu neqlauul neqlauul neqlaulu
neqllauu neqllauu neqlluau neqlluua neqlluua neqlluau neqlulau neqlulua neqlualu neqluaul neqluual
neqluula neqlulua neqlulau neqluula neqluual neqluaul neqlualu neqalluu neqalluu neqalulu neqaluul
neqaluul neqalulu neqalluu neqalluu neqalulu neqaluul neqaluul neqalulu neqaullu neqaulul neqaullu
neqaulul neqauull neqauull neqaulul neqaullu neqauull neqauull neqaulul neqaullu neqlaluu neqlaluu
neqlaulu neqlauul neqlauul neqlaulu neqllauu neqllauu neqlluau neqlluua neqlluua neqlluau neqlulau
neqlulua neqlualu neqluaul neqluual neqluula neqlulua neqlulau neqluula neqluual neqluaul neqlualu
nequallu nequalul nequallu nequalul nequaull nequaull nequlalu nequlaul nequllau nequllua nequlula
nequlual nequllau nequllua nequlalu nequlaul nequlual nequlula nequulla nequulal nequulla nequulal
nequuall nequuall nequalul nequallu nequaull nequaull nequalul nequallu nequlaul nequlalu nequlual
nequlula nequllua nequllau nequulal nequulla nequuall nequuall nequulal nequulla nequllua nequllau
nequlula nequlual nequlaul nequlalu neulaqlu neulaqul neulalqu neulaluq neulaulq neulauql neulqalu
neulqaul neulqlau neulqlua neulqula neulqual neullqau neullqua neullaqu neullauq neulluaq neulluqa
neuluqla neuluqal neululqa neululaq neulualq neuluaql neualqlu neualqul neuallqu neualluq neualulq
neualuql neuaqllu neuaqlul neuaqllu neuaqlul neuaqull neuaqull neualqlu neualqul neuallqu neualluq
neualulq neualuql neuauqll neuauqll neuaulql neuaullq neuaullq neuaulql neuqallu neuqalul neuqallu
neuqalul neuqaull neuqaull neuqlalu neuqlaul neuqllau neuqllua neuqlula neuqlual neuqllau neuqllua
neuqlalu neuqlaul neuqlual neuqlula neuqulla neuqulal neuqulla neuqulal neuquall neuquall neulaqlu
neulaqul neulalqu neulaluq neulaulq neulauql neulqalu neulqaul neulqlau neulqlua neulqula neulqual
neullqau neullqua neullaqu neullauq neulluaq neulluqa neuluqla neuluqal neululqa neululaq neulualq
neuluaql neuuaqll neuuaqll neuualql neuuallq neuuallq neuualql neuuqall neuuqall neuuqlal neuuqlla
neuuqlla neuuqlal neuulqal neuulqla neuulaql neuulalq neuullaq neuullqa neuulqla neuulqal neuullqa
neuullaq neuulalq neuulaql neulaqul neulaqlu neulauql neulaulq neulaluq neulalqu neulqaul neulqalu
neulqual neulqula neulqlua neulqlau neuluqal neuluqla neuluaql neulualq neululaq neululqa neullqua
neullqau neulluqa neulluaq neullauq neullaqu neualqul neualqlu neualuql neualulq neualluq neuallqu
neuaqlul neuaqllu neuaqull neuaqull neuaqlul neuaqllu neuauqll neuauqll neuaulql neuaullq neuaullq
neuaulql neualqul neualqlu neualuql neualulq neualluq neuallqu neuqalul neuqallu neuqaull neuqaull
neuqalul neuqallu neuqlaul neuqlalu neuqlual neuqlula neuqllua neuqllau neuqulal neuqulla neuquall
neuquall neuqulal neuqulla neuqllua neuqllau neuqlula neuqlual neuqlaul neuqlalu neuuaqll neuuaqll
neuualql neuuallq neuuallq neuualql neuuqall neuuqall neuuqlal neuuqlla neuuqlla neuuqlal neuulqal
neuulqla neuulaql neuulalq neuullaq neuullqa neuulqla neuulqal neuullqa neuullaq neuulalq neuulaql
neulaqul neulaqlu neulauql neulaulq neulaluq neulalqu neulqaul neulqalu neulqual neulqula neulqlua
neulqlau neuluqal neuluqla neuluaql neulualq neululaq neululqa neullqua neullqau neulluqa neulluaq
neullauq neullaqu

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us