easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

incusaverimusque

wigeo

skylarked

dance

alvada

biotar

organworks

unobservable

scolecid

unwaked

pugnabat

kyklopes

ferdi

disme

spindlage

neotype

postnaris

aftmost


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: norine
cipher variations:
opsjof pqtkpg qrulqh rsvmri stwnsj
tuxotk uvypul vwzqvm wxarwn xybsxo
yzctyp zaduzq abevar bcfwbs cdgxct
dehydu efizev fgjafw ghkbgx hilchy
ijmdiz jkneja klofkb lmpglc mnqhmd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: norine
Cipher: mlirmv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: norine
Cipher: ABBAA ABBAB BAAAA ABAAA ABBAA AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: norine
cipher variations:
opsjoforazonotipovovqfodoxyvolozglotodwrojofehor
ohmxozojunoholcdoponktoxpqtkpgpsbapopujqpwpwrgpe
pyzwpmpahmpupexspkpgfipspinypapkvopipmdepqpolupy
qrulqhqtcbqpqvkrqxqxshqfqzaxqnqbinqvqfytqlqhgjqt
qjozqbqlwpqjqnefqrqpmvqzrsvmrirudcrqrwlsryrytirg
rabyrorcjorwrgzurmrihkrurkparcrmxqrkrofgrsrqnwra
stwnsjsvedsrsxmtszszujshsbczspsdkpsxshavsnsjilsv
slqbsdsnyrslspghstsroxsbtuxotktwfetstynutatavkti
tcdatqtelqtytibwtotkjmtwtmrctetozstmtqhitutspytc
uvypuluxgfutuzovububwlujudeburufmruzujcxupulknux
unsdufupatunurijuvutqzudvwzqvmvyhgvuvapwvcvcxmvk
vefcvsvgnsvavkdyvqvmlovyvotevgvqbuvovsjkvwvurave
wxarwnwzihwvwbqxwdwdynwlwfgdwtwhotwbwlezwrwnmpwz
wpufwhwrcvwpwtklwxwvsbwfxybsxoxajixwxcryxexezoxm
xghexuxipuxcxmfaxsxonqxaxqvgxixsdwxqxulmxyxwtcxg
yzctypybkjyxydszyfyfapynyhifyvyjqvydyngbytyporyb
yrwhyjytexyryvmnyzyxudyhzaduzqzclkzyzetazgzgbqzo
zijgzwzkrwzezohczuzqpszczsxizkzufyzszwnozazyvezi
abevaradmlazafubahahcrapajkhaxalsxafapidavarqtad
atyjalavgzataxopabazwfajbcfwbsbenmbabgvcbibidsbq
bklibybmtybgbqjebwbsrubebuzkbmbwhabubypqbcbaxgbk
cdgxctcfoncbchwdcjcjetcrclmjczcnuzchcrkfcxctsvcf
cvalcncxibcvczqrcdcbyhcldehydudgpodcdixedkdkfuds
dmnkdadovadidslgdydutwdgdwbmdodyjcdwdarsdedczidm
efizevehqpedejyfelelgvetenolebepwbejetmhezevuxeh
excnepezkdexebstefedajenfgjafwfirqfefkzgfmfmhwfu
fopmfcfqxcfkfunifafwvyfifydofqfalefyfctufgfebkfo
ghkbgxgjsrgfglahgngnixgvgpqngdgrydglgvojgbgxwzgj
gzepgrgbmfgzgduvghgfclgphilchyhktshghmbihohojyhw
hqrohehszehmhwpkhchyxahkhafqhshcnghahevwhihgdmhq
ijmdizilutihincjipipkzixirspifitafinixqlidizybil
ibgritidohibifwxijihenirjknejajmvujijodkjqjqlajy
jstqjgjubgjojyrmjejazcjmjchsjujepijcjgxyjkjifojs
klofkbknwvkjkpelkrkrmbkzkturkhkvchkpkzsnkfkbadkn
kditkvkfqjkdkhyzklkjgpktlmpglcloxwlklqfmlslsncla
luvslilwdilqlatolglcbelolejulwlgrklelizalmlkhqlu
mnqhmdmpyxmlmrgnmtmtodmbmvwtmjmxejmrmbupmhmdcfmp
mfkvmxmhslmfmjabmnmlirmvnorinenqzynmnshonunupenc
nwxunknyfknsncvqninedgnqnglwnynitmngnkbcnonmjsnw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: norine
Cipher: abevar

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: norine
Cipher: 334324423351

Extended Methods:
Method #1

Plaintext: norine
method variations:
stwoskxybtxpcdgycuhimdhz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
n o r i n e 
3 4 2 4 3 5 
3 3 4 2 3 1 
They are then read out in rows:
342435334231
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: norine
Cipher: srxnic

Read more ...
Method #3

Plaintext: norine
method variations:
shtmxl htmxls tmxlsh
mxlsht xlshtm lshtmx

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: norine

all 720 cipher variations:
norine norien nornie nornei noreni norein noirne noiren noinre noiner noienr
noiern nonire nonier nonrie nonrei noneri noneir noeinr noeirn noenir noenri
noerni noerin nroine nroien nronie nronei nroeni nroein nrione nrioen nrinoe
nrineo nrieno nrieon nrnioe nrnieo nrnoie nrnoei nrneoi nrneio nreino nreion
nrenio nrenoi nreoni nreoin nirone niroen nirnoe nirneo nireno nireon niorne
nioren nionre nioner nioenr nioern ninore ninoer ninroe ninreo ninero nineor
nieonr nieorn nienor nienro nierno nieron nnrioe nnrieo nnroie nnroei nnreoi
nnreio nniroe nnireo nniore nnioer nnieor nniero nnoire nnoier nnorie nnorei
nnoeri nnoeir nneior nneiro nneoir nneori nneroi nnerio nerino nerion nernio
nernoi neroni neroin neirno neiron neinro neinor neionr neiorn neniro nenior
nenrio nenroi nenori nenoir neoinr neoirn neonir neonri neorni neorin onrine
onrien onrnie onrnei onreni onrein onirne oniren oninre oniner onienr oniern
onnire onnier onnrie onnrei onneri onneir oneinr oneirn onenir onenri onerni
onerin ornine ornien ornnie ornnei orneni ornein orinne orinen orinne orinen
orienn orienn ornine ornien ornnie ornnei orneni ornein oreinn oreinn orenin
orenni orenni orenin oirnne oirnen oirnne oirnen oirenn oirenn oinrne oinren
oinnre oinner oinenr oinern oinnre oinner oinrne oinren oinern oinenr oiennr
oienrn oiennr oienrn oiernn oiernn onrine onrien onrnie onrnei onreni onrein
onirne oniren oninre oniner onienr oniern onnire onnier onnrie onnrei onneri
onneir oneinr oneirn onenir onenri onerni onerin oerinn oerinn oernin oernni
oernni oernin oeirnn oeirnn oeinrn oeinnr oeinnr oeinrn oenirn oeninr oenrin
oenrni oennri oennir oeninr oenirn oennir oennri oenrni oenrin ronine ronien
ronnie ronnei roneni ronein roinne roinen roinne roinen roienn roienn ronine
ronien ronnie ronnei roneni ronein roeinn roeinn roenin roenni roenni roenin
rnoine rnoien rnonie rnonei rnoeni rnoein rnione rnioen rninoe rnineo rnieno
rnieon rnnioe rnnieo rnnoie rnnoei rnneoi rnneio rneino rneion rnenio rnenoi
rneoni rneoin rinone rinoen rinnoe rinneo rineno rineon rionne rionen rionne
rionen rioenn rioenn rinone rinoen rinnoe rinneo rineno rineon rieonn rieonn
rienon rienno rienno rienon rnnioe rnnieo rnnoie rnnoei rnneoi rnneio rninoe
rnineo rnione rnioen rnieon rnieno rnoine rnoien rnonie rnonei rnoeni rnoein
rneion rneino rneoin rneoni rnenoi rnenio renino renion rennio rennoi renoni
renoin reinno reinon reinno reinon reionn reionn renino renion rennio rennoi
renoni renoin reoinn reoinn reonin reonni reonni reonin iornne iornen iornne
iornen iorenn iorenn ionrne ionren ionnre ionner ionenr ionern ionnre ionner
ionrne ionren ionern ionenr ioennr ioenrn ioennr ioenrn ioernn ioernn ironne
ironen ironne ironen iroenn iroenn irnone irnoen irnnoe irnneo irneno irneon
irnnoe irnneo irnone irnoen irneon irneno irenno irenon irenno irenon ireonn
ireonn inrone inroen inrnoe inrneo inreno inreon inorne inoren inonre inoner
inoenr inoern innore innoer innroe innreo innero inneor ineonr ineorn inenor
inenro inerno ineron inrnoe inrneo inrone inroen inreon inreno innroe innreo
innore innoer inneor innero inonre inoner inorne inoren inoern inoenr inenor
inenro ineonr ineorn ineron inerno iernno iernon iernno iernon ieronn ieronn
ienrno ienron iennro iennor ienonr ienorn iennro iennor ienrno ienron ienorn
ienonr ieonnr ieonrn ieonnr ieonrn ieornn ieornn norine norien nornie nornei
noreni norein noirne noiren noinre noiner noienr noiern nonire nonier nonrie
nonrei noneri noneir noeinr noeirn noenir noenri noerni noerin nroine nroien
nronie nronei nroeni nroein nrione nrioen nrinoe nrineo nrieno nrieon nrnioe
nrnieo nrnoie nrnoei nrneoi nrneio nreino nreion nrenio nrenoi nreoni nreoin
nirone niroen nirnoe nirneo nireno nireon niorne nioren nionre nioner nioenr
nioern ninore ninoer ninroe ninreo ninero nineor nieonr nieorn nienor nienro
nierno nieron nnrioe nnrieo nnroie nnroei nnreoi nnreio nniroe nnireo nniore
nnioer nnieor nniero nnoire nnoier nnorie nnorei nnoeri nnoeir nneior nneiro
nneoir nneori nneroi nnerio nerino nerion nernio nernoi neroni neroin neirno
neiron neinro neinor neionr neiorn neniro nenior nenrio nenroi nenori nenoir
neoinr neoirn neonir neonri neorni neorin eorinn eorinn eornin eornni eornni
eornin eoirnn eoirnn eoinrn eoinnr eoinnr eoinrn eonirn eoninr eonrin eonrni
eonnri eonnir eoninr eonirn eonnir eonnri eonrni eonrin eroinn eroinn eronin
eronni eronni eronin erionn erionn erinon erinno erinno erinon ernion ernino
ernoin ernoni ernnoi ernnio ernino ernion ernnio ernnoi ernoni ernoin eironn
eironn eirnon eirnno eirnno eirnon eiornn eiornn eionrn eionnr eionnr eionrn
einorn einonr einron einrno einnro einnor einonr einorn einnor einnro einrno
einron enrion enrino enroin enroni enrnoi enrnio eniron enirno eniorn enionr
eninor eninro enoirn enoinr enorin enorni enonri enonir ennior enniro ennoir
ennori ennroi ennrio enrino enrion enrnio enrnoi enroni enroin enirno eniron
eninro eninor enionr eniorn enniro ennior ennrio ennroi ennori ennoir enoinr
enoirn enonir enonri enorni enorin

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us