easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

effertz

nonannexation

toffel

proeo

gorny

inflammative

cucumaria

zillions

oenomaus

triarthrus

gastornis

medulliamque

tridentem

handcrafts

elliot

millage

duprez

compressingly


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: natemusque
cipher variations:
obufnvtrvf pcvgowuswg qdwhpxvtxh rexiqywuyi sfyjrzxvzj
tgzksaywak uhaltbzxbl vibmucaycm wjcnvdbzdn xkdowecaeo
ylepxfdbfp zmfqygecgq angrzhfdhr bohsaigeis cpitbjhfjt
dqjuckigku erkvdljhlv fslwemkimw gtmxfnljnx hunygomkoy
ivozhpnlpz jwpaiqomqa kxqbjrpnrb lyrcksqosc mzsdltrptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: natemusque
Cipher: mzgvnfhjfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: natemusque
Cipher: ABBAA AAAAA BAABA AABAA ABABB BAABB BAAAB ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: natemusque
cipher variations:
obufnvtrvfobgnljdxjnobsvjxndxvobedhlxjldobqlfzhpzlobctdnrvntobajzplhpjobmrxdvndr
obyzvrftrzobkhtfpzfhobwprtzftpobixphjlhxpcvgowuswgpchomkeykopctwkyoeywpcfeimykme
pcrmgaiqampcdueoswoupcbkaqmiqkpcnsyewoespczawsgusapcliugqagipcxqsuaguqpcjyqikmiy
qdwhpxvtxhqdipnlfzlpqduxlzpfzxqdgfjnzlnfqdsnhbjrbnqdevfptxpvqdclbrnjrlqdotzfxpft
qdabxthvtbqdmjvhrbhjqdyrtvbhvrqdkzrjlnjzrexiqywuyirejqomgamqrevymaqgayrehgkoamog
retoickscorefwgquyqwredmcsoksmrepuagyqgurebcyuiwucrenkwiscikrezsuwciwsrelaskmoka
sfyjrzxvzjsfkrpnhbnrsfwznbrhbzsfihlpbnphsfupjdltdpsfgxhrvzrxsfendtpltnsfqvbhzrhv
sfcdzvjxvdsfolxjtdjlsfatvxdjxtsfmbtlnplbtgzksaywaktglsqoicostgxaocsicatgjimqcoqi
tgvqkemueqtghyiswasytgfoeuqmuotgrwciasiwtgdeawkywetgpmykuekmtgbuwyekyutgncumoqmc
uhaltbzxbluhmtrpjdptuhybpdtjdbuhkjnrdprjuhwrlfnvfruhizjtxbtzuhgpfvrnvpuhsxdjbtjx
uhefbxlzxfuhqnzlvflnuhcvxzflzvuhodvnprndvibmucaycmvinusqkequvizcqeukecvilkoseqsk
vixsmgowgsvijakuycuavihqgwsowqvityekcukyvifgcymaygviroamwgmovidwyagmawvipewoqsoe
wjcnvdbzdnwjovtrlfrvwjadrfvlfdwjmlptfrtlwjytnhpxhtwjkblvzdvbwjirhxtpxrwjuzfldvlz
wjghdznbzhwjspbnxhnpwjexzbhnbxwjqfxprtpfxkdowecaeoxkpwusmgswxkbesgwmgexknmqugsum
xkzuoiqyiuxklcmwaewcxkjsiyuqysxkvagmewmaxkhieaocaixktqcoyioqxkfyaciocyxkrgyqsuqg
ylepxfdbfpylqxvtnhtxylcfthxnhfylonrvhtvnylavpjrzjvylmdnxbfxdylktjzvrztylwbhnfxnb
ylijfbpdbjylurdpzjprylgzbdjpdzylshzrtvrhzmfqygecgqzmrywuoiuyzmdguiyoigzmposwiuwo
zmbwqksakwzmneoycgyezmlukawsauzmxciogyoczmjkgcqeckzmvseqakqszmhacekqeazmtiasuwsi
angrzhfdhranszxvpjvzanehvjzpjhanqptxjvxpancxrltblxanofpzdhzfanmvlbxtbvanydjphzpd
anklhdrfdlanwtfrblrtanibdflrfbanujbtvxtjbohsaigeisbotaywqkwabofiwkaqkiborquykwyq
bodysmucmybopgqaeiagbonwmcyucwbozekqiaqebolmiesgemboxugscmsubojcegmsgcbovkcuwyuk
cpitbjhfjtcpubzxrlxbcpgjxlbrljcpsrvzlxzrcpeztnvdnzcpqhrbfjbhcpoxndzvdxcpaflrjbrf
cpmnjfthfncpyvhtdntvcpkdfhnthdcpwldvxzvldqjuckigkudqvcaysmycdqhkymcsmkdqtswamyas
dqfauoweoadqriscgkcidqpyoeaweydqbgmskcsgdqnokguigodqzwiueouwdqlegiouiedqxmewyawm
erkvdljhlverwdbztnzderilzndtnlerutxbnzbtergbvpxfpbersjtdhldjerqzpfbxfzerchntldth
eroplhvjhperaxjvfpvxermfhjpvjferynfxzbxnfslwemkimwfsxecauoaefsjmaoeuomfsvuycoacu
fshcwqygqcfstkueimekfsraqgcygafsdioumeuifspqmiwkiqfsbykwgqwyfsngikqwkgfszogyacyo
gtmxfnljnxgtyfdbvpbfgtknbpfvpngtwvzdpbdvgtidxrzhrdgtulvfjnflgtsbrhdzhbgtejpvnfvj
gtqrnjxljrgtczlxhrxzgtohjlrxlhgtaphzbdzphunygomkoyhuzgecwqcghulocqgwqohuxwaeqcew
hujeysaisehuvmwgkogmhutcsieaichufkqwogwkhursokymkshudamyisyahupikmsymihubqiaceaq
ivozhpnlpzivahfdxrdhivmpdrhxrpivyxbfrdfxivkfztbjtfivwnxhlphnivudtjfbjdivglrxphxl
ivstplznltivebnzjtzbivqjlntznjivcrjbdfbrjwpaiqomqajwbigeyseijwnqesiysqjwzycgsegy
jwlgauckugjwxoyimqiojwveukgckejwhmsyqiymjwtuqmaomujwfcoakuacjwrkmouaokjwdskcegcs
kxqbjrpnrbkxcjhfztfjkxorftjztrkxazdhtfhzkxmhbvdlvhkxypzjnrjpkxwfvlhdlfkxintzrjzn
kxuvrnbpnvkxgdpblvbdkxslnpvbplkxetldfhdtlyrcksqosclydkigaugklypsgukauslybaeiugia
lynicwemwilyzqakoskqlyxgwmiemglyjouaskaolyvwsocqowlyheqcmwcelytmoqwcqmlyfumegieu
mzsdltrptdmzeljhbvhlmzqthvlbvtmzcbfjvhjbmzojdxfnxjmzarblptlrmzyhxnjfnhmzkpvbtlbp
mzwxtpdrpxmzifrdnxdfmzunprxdrnmzgvnfhjfvnatemusquenafmkicwimnaruiwmcwunadcgkwikc
napkeygoyknabscmqumsnaziyokgoinalqwcumcqnaxyuqesqynajgseoyegnavoqsyesonahwogikgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: natemusque
Cipher: angrzhfdhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: natemusque
Cipher: 33114451235434145451

Extended Methods:
Method #1

Plaintext: natemusque
method variations:
sfykrzxvzkxldpwecaepcqiubkhfkuhvozgpnlpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
n a t e m u s q u e 
3 1 4 5 2 5 3 1 5 5 
3 1 4 1 3 4 4 4 4 1 
They are then read out in rows:
31452531553141344441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: natemusque
Cipher: cywczcdstd

Read more ...
Method #3

Plaintext: natemusque
method variations:
cqyfxodyyl qyfxodyylc yfxodyylcq
fxodyylcqy xodyylcqyf odyylcqyfx
dyylcqyfxo yylcqyfxod ylcqyfxody
lcqyfxodyy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: natemusque

first 5040 cipher variations(3628800 total)
natemusque natemusqeu natemusuqe natemusueq natemuseuq natemusequ natemuqsue natemuqseu natemuquse natemuques natemuqeus
natemuqesu natemuuqse natemuuqes natemuusqe natemuuseq natemuuesq natemuueqs natemuequs natemueqsu natemueuqs natemueusq
natemuesuq natemuesqu natemsuque natemsuqeu natemsuuqe natemsuueq natemsueuq natemsuequ natemsquue natemsqueu natemsquue
natemsqueu natemsqeuu natemsqeuu natemsuque natemsuqeu natemsuuqe natemsuueq natemsueuq natemsuequ natemsequu natemsequu
natemseuqu natemseuuq natemseuuq natemseuqu natemqsuue natemqsueu natemqsuue natemqsueu natemqseuu natemqseuu natemqusue
natemquseu natemquuse natemquues natemqueus natemquesu natemquuse natemquues natemqusue natemquseu natemquesu natemqueus
natemqeuus natemqeusu natemqeuus natemqeusu natemqesuu natemqesuu natemusque natemusqeu natemusuqe natemusueq natemuseuq
natemusequ natemuqsue natemuqseu natemuquse natemuques natemuqeus natemuqesu natemuuqse natemuuqes natemuusqe natemuuseq
natemuuesq natemuueqs natemuequs natemueqsu natemueuqs natemueusq natemuesuq natemuesqu natemesquu natemesquu natemesuqu
natemesuuq natemesuuq natemesuqu natemeqsuu natemeqsuu natemequsu natemequus natemequus natemequsu natemeuqsu natemeuqus
natemeusqu natemeusuq natemeuusq natemeuuqs natemeuqus natemeuqsu natemeuuqs natemeuusq natemeusuq natemeusqu nateumsque
nateumsqeu nateumsuqe nateumsueq nateumseuq nateumsequ nateumqsue nateumqseu nateumquse nateumques nateumqeus nateumqesu
nateumuqse nateumuqes nateumusqe nateumuseq nateumuesq nateumueqs nateumequs nateumeqsu nateumeuqs nateumeusq nateumesuq
nateumesqu nateusmque nateusmqeu nateusmuqe nateusmueq nateusmeuq nateusmequ nateusqmue nateusqmeu nateusqume nateusquem
nateusqeum nateusqemu nateusuqme nateusuqem nateusumqe nateusumeq nateusuemq nateusueqm nateusequm nateuseqmu nateuseuqm
nateuseumq nateusemuq nateusemqu nateuqsmue nateuqsmeu nateuqsume nateuqsuem nateuqseum nateuqsemu nateuqmsue nateuqmseu
nateuqmuse nateuqmues nateuqmeus nateuqmesu nateuqumse nateuqumes nateuqusme nateuqusem nateuquesm nateuquems nateuqemus
nateuqemsu nateuqeums nateuqeusm nateuqesum nateuqesmu nateuusqme nateuusqem nateuusmqe nateuusmeq nateuusemq nateuuseqm
nateuuqsme nateuuqsem nateuuqmse nateuuqmes nateuuqems nateuuqesm nateuumqse nateuumqes nateuumsqe nateuumseq nateuumesq
nateuumeqs nateuueqms nateuueqsm nateuuemqs nateuuemsq nateuuesmq nateuuesqm nateuesqum nateuesqmu nateuesuqm nateuesumq
nateuesmuq nateuesmqu nateueqsum nateueqsmu nateuequsm nateuequms nateueqmus nateueqmsu nateueuqsm nateueuqms nateueusqm
nateueusmq nateueumsq nateueumqs nateuemqus nateuemqsu nateuemuqs nateuemusq nateuemsuq nateuemsqu natesumque natesumqeu
natesumuqe natesumueq natesumeuq natesumequ natesuqmue natesuqmeu natesuqume natesuquem natesuqeum natesuqemu natesuuqme
natesuuqem natesuumqe natesuumeq natesuuemq natesuueqm natesuequm natesueqmu natesueuqm natesueumq natesuemuq natesuemqu
natesmuque natesmuqeu natesmuuqe natesmuueq natesmueuq natesmuequ natesmquue natesmqueu natesmquue natesmqueu natesmqeuu
natesmqeuu natesmuque natesmuqeu natesmuuqe natesmuueq natesmueuq natesmuequ natesmequu natesmequu natesmeuqu natesmeuuq
natesmeuuq natesmeuqu natesqmuue natesqmueu natesqmuue natesqmueu natesqmeuu natesqmeuu natesqumue natesqumeu natesquume
natesquuem natesqueum natesquemu natesquume natesquuem natesqumue natesqumeu natesquemu natesqueum natesqeuum natesqeumu
natesqeuum natesqeumu natesqemuu natesqemuu natesumque natesumqeu natesumuqe natesumueq natesumeuq natesumequ natesuqmue
natesuqmeu natesuqume natesuquem natesuqeum natesuqemu natesuuqme natesuuqem natesuumqe natesuumeq natesuuemq natesuueqm
natesuequm natesueqmu natesueuqm natesueumq natesuemuq natesuemqu natesemquu natesemquu natesemuqu natesemuuq natesemuuq
natesemuqu nateseqmuu nateseqmuu natesequmu natesequum natesequum natesequmu nateseuqmu nateseuqum nateseumqu nateseumuq
nateseuumq nateseuuqm nateseuqum nateseuqmu nateseuuqm nateseuumq nateseumuq nateseumqu natequsmue natequsmeu natequsume
natequsuem natequseum natequsemu natequmsue natequmseu natequmuse natequmues natequmeus natequmesu natequumse natequumes
natequusme natequusem natequuesm natequuems natequemus natequemsu natequeums natequeusm natequesum natequesmu nateqsumue
nateqsumeu nateqsuume nateqsuuem nateqsueum nateqsuemu nateqsmuue nateqsmueu nateqsmuue nateqsmueu nateqsmeuu nateqsmeuu
nateqsumue nateqsumeu nateqsuume nateqsuuem nateqsueum nateqsuemu nateqsemuu nateqsemuu nateqseumu nateqseuum nateqseuum
nateqseumu nateqmsuue nateqmsueu nateqmsuue nateqmsueu nateqmseuu nateqmseuu nateqmusue nateqmuseu nateqmuuse nateqmuues
nateqmueus nateqmuesu nateqmuuse nateqmuues nateqmusue nateqmuseu nateqmuesu nateqmueus nateqmeuus nateqmeusu nateqmeuus
nateqmeusu nateqmesuu nateqmesuu natequsmue natequsmeu natequsume natequsuem natequseum natequsemu natequmsue natequmseu
natequmuse natequmues natequmeus natequmesu natequumse natequumes natequusme natequusem natequuesm natequuems natequemus
natequemsu natequeums natequeusm natequesum natequesmu nateqesmuu nateqesmuu nateqesumu nateqesuum nateqesuum nateqesumu
nateqemsuu nateqemsuu nateqemusu nateqemuus nateqemuus nateqemusu nateqeumsu nateqeumus nateqeusmu nateqeusum nateqeuusm
nateqeuums nateqeumus nateqeumsu nateqeuums nateqeuusm nateqeusum nateqeusmu nateuusqme nateuusqem nateuusmqe nateuusmeq
nateuusemq nateuuseqm nateuuqsme nateuuqsem nateuuqmse nateuuqmes nateuuqems nateuuqesm nateuumqse nateuumqes nateuumsqe
nateuumseq nateuumesq nateuumeqs nateuueqms nateuueqsm nateuuemqs nateuuemsq nateuuesmq nateuuesqm nateusuqme nateusuqem
nateusumqe nateusumeq nateusuemq nateusueqm nateusqume nateusquem nateusqmue nateusqmeu nateusqemu nateusqeum nateusmque
nateusmqeu nateusmuqe nateusmueq nateusmeuq nateusmequ nateuseqmu nateusequm nateusemqu nateusemuq nateuseumq nateuseuqm
nateuqsume nateuqsuem nateuqsmue nateuqsmeu nateuqsemu nateuqseum nateuqusme nateuqusem nateuqumse nateuqumes nateuquems
nateuquesm nateuqmuse nateuqmues nateuqmsue nateuqmseu nateuqmesu nateuqmeus nateuqeums nateuqeusm nateuqemus nateuqemsu
nateuqesmu nateuqesum nateumsque nateumsqeu nateumsuqe nateumsueq nateumseuq nateumsequ nateumqsue nateumqseu nateumquse
nateumques nateumqeus nateumqesu nateumuqse nateumuqes nateumusqe nateumuseq nateumuesq nateumueqs nateumequs nateumeqsu
nateumeuqs nateumeusq nateumesuq nateumesqu nateuesqmu nateuesqum nateuesmqu nateuesmuq nateuesumq nateuesuqm nateueqsmu
nateueqsum nateueqmsu nateueqmus nateuequms nateuequsm nateuemqsu nateuemqus nateuemsqu nateuemsuq nateuemusq nateuemuqs
nateueuqms nateueuqsm nateueumqs nateueumsq nateueusmq nateueusqm nateeusqum nateeusqmu nateeusuqm nateeusumq nateeusmuq
nateeusmqu nateeuqsum nateeuqsmu nateeuqusm nateeuqums nateeuqmus nateeuqmsu nateeuuqsm nateeuuqms nateeuusqm nateeuusmq
nateeuumsq nateeuumqs nateeumqus nateeumqsu nateeumuqs nateeumusq nateeumsuq nateeumsqu nateesuqum nateesuqmu nateesuuqm
nateesuumq nateesumuq nateesumqu nateesquum nateesqumu nateesquum nateesqumu nateesqmuu nateesqmuu nateesuqum nateesuqmu
nateesuuqm nateesuumq nateesumuq nateesumqu nateesmquu nateesmquu nateesmuqu nateesmuuq nateesmuuq nateesmuqu nateeqsuum
nateeqsumu nateeqsuum nateeqsumu nateeqsmuu nateeqsmuu nateequsum nateequsmu nateequusm nateequums nateequmus nateequmsu
nateequusm nateequums nateequsum nateequsmu nateequmsu nateequmus nateeqmuus nateeqmusu nateeqmuus nateeqmusu nateeqmsuu
nateeqmsuu nateeusqum nateeusqmu nateeusuqm nateeusumq nateeusmuq nateeusmqu nateeuqsum nateeuqsmu nateeuqusm nateeuqums
nateeuqmus nateeuqmsu nateeuuqsm nateeuuqms nateeuusqm nateeuusmq nateeuumsq nateeuumqs nateeumqus nateeumqsu nateeumuqs
nateeumusq nateeumsuq nateeumsqu nateemsquu nateemsquu nateemsuqu nateemsuuq nateemsuuq nateemsuqu nateemqsuu nateemqsuu
nateemqusu nateemquus nateemquus nateemqusu nateemuqsu nateemuqus nateemusqu nateemusuq nateemuusq nateemuuqs nateemuqus
nateemuqsu nateemuuqs nateemuusq nateemusuq nateemusqu natmeusque natmeusqeu natmeusuqe natmeusueq natmeuseuq natmeusequ
natmeuqsue natmeuqseu natmeuquse natmeuques natmeuqeus natmeuqesu natmeuuqse natmeuuqes natmeuusqe natmeuuseq natmeuuesq
natmeuueqs natmeuequs natmeueqsu natmeueuqs natmeueusq natmeuesuq natmeuesqu natmesuque natmesuqeu natmesuuqe natmesuueq
natmesueuq natmesuequ natmesquue natmesqueu natmesquue natmesqueu natmesqeuu natmesqeuu natmesuque natmesuqeu natmesuuqe
natmesuueq natmesueuq natmesuequ natmesequu natmesequu natmeseuqu natmeseuuq natmeseuuq natmeseuqu natmeqsuue natmeqsueu
natmeqsuue natmeqsueu natmeqseuu natmeqseuu natmequsue natmequseu natmequuse natmequues natmequeus natmequesu natmequuse
natmequues natmequsue natmequseu natmequesu natmequeus natmeqeuus natmeqeusu natmeqeuus natmeqeusu natmeqesuu natmeqesuu
natmeusque natmeusqeu natmeusuqe natmeusueq natmeuseuq natmeusequ natmeuqsue natmeuqseu natmeuquse natmeuques natmeuqeus
natmeuqesu natmeuuqse natmeuuqes natmeuusqe natmeuuseq natmeuuesq natmeuueqs natmeuequs natmeueqsu natmeueuqs natmeueusq
natmeuesuq natmeuesqu natmeesquu natmeesquu natmeesuqu natmeesuuq natmeesuuq natmeesuqu natmeeqsuu natmeeqsuu natmeequsu
natmeequus natmeequus natmeequsu natmeeuqsu natmeeuqus natmeeusqu natmeeusuq natmeeuusq natmeeuuqs natmeeuqus natmeeuqsu
natmeeuuqs natmeeuusq natmeeusuq natmeeusqu natmuesque natmuesqeu natmuesuqe natmuesueq natmueseuq natmuesequ natmueqsue
natmueqseu natmuequse natmueques natmueqeus natmueqesu natmueuqse natmueuqes natmueusqe natmueuseq natmueuesq natmueueqs
natmueequs natmueeqsu natmueeuqs natmueeusq natmueesuq natmueesqu natmuseque natmuseqeu natmuseuqe natmuseueq natmuseeuq
natmuseequ natmusqeue natmusqeeu natmusquee natmusquee natmusqeue natmusqeeu natmusuqee natmusuqee natmusueqe natmusueeq
natmusueeq natmusueqe natmuseque natmuseqeu natmuseuqe natmuseueq natmuseeuq natmuseequ natmuqseue natmuqseeu natmuqsuee
natmuqsuee natmuqseue natmuqseeu natmuqesue natmuqeseu natmuqeuse natmuqeues natmuqeeus natmuqeesu natmuquese natmuquees
natmuqusee natmuqusee natmuquese natmuquees natmuqeeus natmuqeesu natmuqeues natmuqeuse natmuqesue natmuqeseu natmuusqee
natmuusqee natmuuseqe natmuuseeq natmuuseeq natmuuseqe natmuuqsee natmuuqsee natmuuqese natmuuqees natmuuqees natmuuqese
natmuueqse natmuueqes natmuuesqe natmuueseq natmuueesq natmuueeqs natmuueqes natmuueqse natmuueeqs natmuueesq natmuueseq
natmuuesqe natmuesque natmuesqeu natmuesuqe natmuesueq natmueseuq natmuesequ natmueqsue natmueqseu natmuequse natmueques
natmueqeus natmueqesu natmueuqse natmueuqes natmueusqe natmueuseq natmueuesq natmueueqs natmueequs natmueeqsu natmueeuqs
natmueeusq natmueesuq natmueesqu natmsueque natmsueqeu natmsueuqe natmsueueq natmsueeuq natmsueequ natmsuqeue natmsuqeeu
natmsuquee natmsuquee natmsuqeue natmsuqeeu natmsuuqee natmsuuqee natmsuueqe natmsuueeq natmsuueeq natmsuueqe natmsueque
natmsueqeu natmsueuqe natmsueueq natmsueeuq natmsueequ natmseuque natmseuqeu natmseuuqe natmseuueq natmseueuq natmseuequ
natmsequue natmsequeu natmsequue natmsequeu natmseqeuu natmseqeuu natmseuque natmseuqeu natmseuuqe natmseuueq natmseueuq
natmseuequ natmseequu natmseequu natmseeuqu natmseeuuq natmseeuuq natmseeuqu natmsqeuue natmsqeueu natmsqeuue natmsqeueu
natmsqeeuu natmsqeeuu natmsqueue natmsqueeu natmsquuee natmsquuee natmsqueue natmsqueeu natmsquuee natmsquuee natmsqueue
natmsqueeu natmsqueeu natmsqueue natmsqeuue natmsqeueu natmsqeuue natmsqeueu natmsqeeuu natmsqeeuu natmsueque natmsueqeu
natmsueuqe natmsueueq natmsueeuq natmsueequ natmsuqeue natmsuqeeu natmsuquee natmsuquee natmsuqeue natmsuqeeu natmsuuqee
natmsuuqee natmsuueqe natmsuueeq natmsuueeq natmsuueqe natmsueque natmsueqeu natmsueuqe natmsueueq natmsueeuq natmsueequ
natmseequu natmseequu natmseeuqu natmseeuuq natmseeuuq natmseeuqu natmseqeuu natmseqeuu natmsequeu natmsequue natmsequue
natmsequeu natmseuqeu natmseuque natmseuequ natmseueuq natmseuueq natmseuuqe natmseuque natmseuqeu natmseuuqe natmseuueq
natmseueuq natmseuequ natmquseue natmquseeu natmqusuee natmqusuee natmquseue natmquseeu natmquesue natmqueseu natmqueuse
natmqueues natmqueeus natmqueesu natmquuese natmquuees natmquusee natmquusee natmquuese natmquuees natmqueeus natmqueesu
natmqueues natmqueuse natmquesue natmqueseu natmqsueue natmqsueeu natmqsuuee natmqsuuee natmqsueue natmqsueeu natmqseuue
natmqseueu natmqseuue natmqseueu natmqseeuu natmqseeuu natmqsueue natmqsueeu natmqsuuee natmqsuuee natmqsueue natmqsueeu
natmqseeuu natmqseeuu natmqseueu natmqseuue natmqseuue natmqseueu natmqesuue natmqesueu natmqesuue natmqesueu natmqeseuu
natmqeseuu natmqeusue natmqeuseu natmqeuuse natmqeuues natmqeueus natmqeuesu natmqeuuse natmqeuues natmqeusue natmqeuseu
natmqeuesu natmqeueus natmqeeuus natmqeeusu natmqeeuus natmqeeusu natmqeesuu natmqeesuu natmquseue natmquseeu natmqusuee
natmqusuee natmquseue natmquseeu natmquesue natmqueseu natmqueuse natmqueues natmqueeus natmqueesu natmquuese natmquuees
natmquusee natmquusee natmquuese natmquuees natmqueeus natmqueesu natmqueues natmqueuse natmquesue natmqueseu natmqeseuu
natmqeseuu natmqesueu natmqesuue natmqesuue natmqesueu natmqeesuu natmqeesuu natmqeeusu natmqeeuus natmqeeuus natmqeeusu
natmqeuesu natmqeueus natmqeuseu natmqeusue natmqeuuse natmqeuues natmqeueus natmqeuesu natmqeuues natmqeuuse natmqeusue
natmqeuseu natmuusqee natmuusqee natmuuseqe natmuuseeq natmuuseeq natmuuseqe natmuuqsee natmuuqsee natmuuqese natmuuqees
natmuuqees natmuuqese natmuueqse natmuueqes natmuuesqe natmuueseq natmuueesq natmuueeqs natmuueqes natmuueqse natmuueeqs
natmuueesq natmuueseq natmuuesqe natmusuqee natmusuqee natmusueqe natmusueeq natmusueeq natmusueqe natmusquee natmusquee
natmusqeue natmusqeeu natmusqeeu natmusqeue natmuseque natmuseqeu natmuseuqe natmuseueq natmuseeuq natmuseequ natmuseqeu
natmuseque natmuseequ natmuseeuq natmuseueq natmuseuqe natmuqsuee natmuqsuee natmuqseue natmuqseeu natmuqseeu natmuqseue
natmuqusee natmuqusee natmuquese natmuquees natmuquees natmuquese natmuqeuse natmuqeues natmuqesue natmuqeseu natmuqeesu
natmuqeeus natmuqeues natmuqeuse natmuqeeus natmuqeesu natmuqeseu natmuqesue natmuesque natmuesqeu natmuesuqe natmuesueq
natmueseuq natmuesequ natmueqsue natmueqseu natmuequse natmueques natmueqeus natmueqesu natmueuqse natmueuqes natmueusqe
natmueuseq natmueuesq natmueueqs natmueequs natmueeqsu natmueeuqs natmueeusq natmueesuq natmueesqu natmuesqeu natmuesque
natmuesequ natmueseuq natmuesueq natmuesuqe natmueqseu natmueqsue natmueqesu natmueqeus natmueques natmuequse natmueeqsu
natmueequs natmueesqu natmueesuq natmueeusq natmueeuqs natmueuqes natmueuqse natmueueqs natmueuesq natmueuseq natmueusqe
natmeusque natmeusqeu natmeusuqe natmeusueq natmeuseuq natmeusequ natmeuqsue natmeuqseu natmeuquse natmeuques natmeuqeus
natmeuqesu natmeuuqse natmeuuqes natmeuusqe natmeuuseq natmeuuesq natmeuueqs natmeuequs natmeueqsu natmeueuqs natmeueusq
natmeuesuq natmeuesqu natmesuque natmesuqeu natmesuuqe natmesuueq natmesueuq natmesuequ natmesquue natmesqueu natmesquue
natmesqueu natmesqeuu natmesqeuu natmesuque natmesuqeu natmesuuqe natmesuueq natmesueuq natmesuequ natmesequu natmesequu
natmeseuqu natmeseuuq natmeseuuq natmeseuqu natmeqsuue natmeqsueu natmeqsuue natmeqsueu natmeqseuu natmeqseuu natmequsue
natmequseu natmequuse natmequues natmequeus natmequesu natmequuse natmequues natmequsue natmequseu natmequesu natmequeus
natmeqeuus natmeqeusu natmeqeuus natmeqeusu natmeqesuu natmeqesuu natmeusque natmeusqeu natmeusuqe natmeusueq natmeuseuq
natmeusequ natmeuqsue natmeuqseu natmeuquse natmeuques natmeuqeus natmeuqesu natmeuuqse natmeuuqes natmeuusqe natmeuuseq
natmeuuesq natmeuueqs natmeuequs natmeueqsu natmeueuqs natmeueusq natmeuesuq natmeuesqu natmeesquu natmeesquu natmeesuqu
natmeesuuq natmeesuuq natmeesuqu natmeeqsuu natmeeqsuu natmeequsu natmeequus natmeequus natmeequsu natmeeuqsu natmeeuqus
natmeeusqu natmeeusuq natmeeuusq natmeeuuqs natmeeuqus natmeeuqsu natmeeuuqs natmeeuusq natmeeusuq natmeeusqu natumesque
natumesqeu natumesuqe natumesueq natumeseuq natumesequ natumeqsue natumeqseu natumequse natumeques natumeqeus natumeqesu
natumeuqse natumeuqes natumeusqe natumeuseq natumeuesq natumeueqs natumeequs natumeeqsu natumeeuqs natumeeusq natumeesuq
natumeesqu natumseque natumseqeu natumseuqe natumseueq natumseeuq natumseequ natumsqeue natumsqeeu natumsquee natumsquee
natumsqeue natumsqeeu natumsuqee natumsuqee natumsueqe natumsueeq natumsueeq natumsueqe natumseque natumseqeu natumseuqe
natumseueq natumseeuq natumseequ natumqseue natumqseeu natumqsuee natumqsuee natumqseue natumqseeu natumqesue natumqeseu
natumqeuse natumqeues natumqeeus natumqeesu natumquese natumquees natumqusee natumqusee natumquese natumquees natumqeeus
natumqeesu natumqeues natumqeuse natumqesue natumqeseu natumusqee natumusqee natumuseqe natumuseeq natumuseeq natumuseqe
natumuqsee natumuqsee natumuqese natumuqees natumuqees natumuqese natumueqse natumueqes natumuesqe natumueseq natumueesq
natumueeqs natumueqes natumueqse natumueeqs natumueesq natumueseq natumuesqe natumesque natumesqeu natumesuqe natumesueq
natumeseuq natumesequ natumeqsue natumeqseu natumequse natumeques natumeqeus natumeqesu natumeuqse natumeuqes natumeusqe
natumeuseq natumeuesq natumeueqs natumeequs natumeeqsu natumeeuqs natumeeusq natumeesuq natumeesqu natuemsque natuemsqeu
natuemsuqe natuemsueq natuemseuq natuemsequ natuemqsue natuemqseu natuemquse natuemques natuemqeus natuemqesu natuemuqse
natuemuqes natuemusqe natuemuseq natuemuesq natuemueqs natuemequs natuemeqsu natuemeuqs natuemeusq natuemesuq natuemesqu
natuesmque natuesmqeu natuesmuqe natuesmueq natuesmeuq natuesmequ natuesqmue natuesqmeu natuesqume natuesquem natuesqeum
natuesqemu natuesuqme natuesuqem natuesumqe natuesumeq natuesuemq natuesueqm natuesequm natueseqmu natueseuqm natueseumq
natuesemuq natuesemqu natueqsmue natueqsmeu natueqsume natueqsuem natueqseum natueqsemu natueqmsue natueqmseu natueqmuse
natueqmues natueqmeus natueqmesu natuequmse natuequmes natuequsme natuequsem natuequesm natuequems natueqemus natueqemsu
natueqeums natueqeusm natueqesum natueqesmu natueusqme natueusqem natueusmqe natueusmeq natueusemq natueuseqm natueuqsme
natueuqsem natueuqmse natueuqmes natueuqems natueuqesm natueumqse natueumqes natueumsqe natueumseq natueumesq natueumeqs
natueueqms natueueqsm natueuemqs natueuemsq natueuesmq natueuesqm natueesqum natueesqmu natueesuqm natueesumq natueesmuq
natueesmqu natueeqsum natueeqsmu natueequsm natueequms natueeqmus natueeqmsu natueeuqsm natueeuqms natueeusqm natueeusmq
natueeumsq natueeumqs natueemqus natueemqsu natueemuqs natueemusq natueemsuq natueemsqu natusemque natusemqeu natusemuqe
natusemueq natusemeuq natusemequ natuseqmue natuseqmeu natusequme natusequem natuseqeum natuseqemu natuseuqme natuseuqem
natuseumqe natuseumeq natuseuemq natuseueqm natuseequm natuseeqmu natuseeuqm natuseeumq natuseemuq natuseemqu natusmeque
natusmeqeu natusmeuqe natusmeueq natusmeeuq natusmeequ natusmqeue natusmqeeu natusmquee natusmquee natusmqeue natusmqeeu
natusmuqee natusmuqee natusmueqe natusmueeq natusmueeq natusmueqe natusmeque natusmeqeu natusmeuqe natusmeueq natusmeeuq
natusmeequ natusqmeue natusqmeeu natusqmuee natusqmuee natusqmeue natusqmeeu natusqemue natusqemeu natusqeume natusqeuem
natusqeeum natusqeemu natusqueme natusqueem natusqumee natusqumee natusqueme natusqueem natusqeeum natusqeemu natusqeuem
natusqeume natusqemue natusqemeu natusumqee natusumqee natusumeqe natusumeeq natusumeeq natusumeqe natusuqmee natusuqmee
natusuqeme natusuqeem natusuqeem natusuqeme natusueqme natusueqem natusuemqe natusuemeq natusueemq natusueeqm natusueqem
natusueqme natusueeqm natusueemq natusuemeq natusuemqe natusemque natusemqeu natusemuqe natusemueq natusemeuq natusemequ
natuseqmue natuseqmeu natusequme natusequem natuseqeum natuseqemu natuseuqme natuseuqem natuseumqe natuseumeq natuseuemq
natuseueqm natuseequm natuseeqmu natuseeuqm natuseeumq natuseemuq natuseemqu natuqesmue natuqesmeu natuqesume natuqesuem
natuqeseum natuqesemu natuqemsue natuqemseu natuqemuse natuqemues natuqemeus natuqemesu natuqeumse natuqeumes natuqeusme
natuqeusem natuqeuesm natuqeuems natuqeemus natuqeemsu natuqeeums natuqeeusm natuqeesum natuqeesmu natuqsemue natuqsemeu
natuqseume natuqseuem natuqseeum natuqseemu natuqsmeue natuqsmeeu natuqsmuee natuqsmuee natuqsmeue natuqsmeeu natuqsumee
natuqsumee natuqsueme natuqsueem natuqsueem natuqsueme natuqsemue natuqsemeu natuqseume natuqseuem natuqseeum natuqseemu
natuqmseue natuqmseeu natuqmsuee natuqmsuee natuqmseue natuqmseeu natuqmesue natuqmeseu natuqmeuse natuqmeues natuqmeeus
natuqmeesu natuqmuese natuqmuees natuqmusee natuqmusee natuqmuese natuqmuees natuqmeeus natuqmeesu natuqmeues natuqmeuse
natuqmesue natuqmeseu natuqusmee natuqusmee natuquseme natuquseem natuquseem natuquseme natuqumsee natuqumsee natuqumese
natuqumees natuqumees natuqumese natuquemse natuquemes natuquesme natuquesem natuqueesm natuqueems natuquemes natuquemse
natuqueems natuqueesm natuquesem natuquesme natuqesmue natuqesmeu natuqesume natuqesuem natuqeseum natuqesemu natuqemsue
natuqemseu natuqemuse natuqemues natuqemeus natuqemesu natuqeumse natuqeumes natuqeusme natuqeusem natuqeuesm natuqeuems
natuqeemus natuqeemsu natuqeeums natuqeeusm natuqeesum natuqeesmu natuuesqme natuuesqem natuuesmqe natuuesmeq natuuesemq
natuueseqm natuueqsme natuueqsem natuueqmse natuueqmes natuueqems natuueqesm natuuemqse natuuemqes natuuemsqe natuuemseq
natuuemesq natuuemeqs natuueeqms natuueeqsm natuueemqs natuueemsq natuueesmq natuueesqm natuuseqme natuuseqem natuusemqe
natuusemeq natuuseemq natuuseeqm natuusqeme natuusqeem natuusqmee natuusqmee natuusqeme natuusqeem natuusmqee natuusmqee
natuusmeqe natuusmeeq natuusmeeq natuusmeqe natuuseqme natuuseqem natuusemqe natuusemeq natuuseemq natuuseeqm natuuqseme
natuuqseem natuuqsmee natuuqsmee natuuqseme natuuqseem natuuqesme natuuqesem natuuqemse natuuqemes natuuqeems natuuqeesm
natuuqmese natuuqmees natuuqmsee natuuqmsee natuuqmese natuuqmees natuuqeems natuuqeesm natuuqemes natuuqemse natuuqesme
natuuqesem natuumsqee natuumsqee natuumseqe natuumseeq natuumseeq natuumseqe natuumqsee natuumqsee natuumqese natuumqees
natuumqees natuumqese natuumeqse natuumeqes natuumesqe natuumeseq natuumeesq natuumeeqs natuumeqes natuumeqse natuumeeqs
natuumeesq natuumeseq natuumesqe natuuesqme natuuesqem natuuesmqe natuuesmeq natuuesemq natuueseqm natuueqsme natuueqsem
natuueqmse natuueqmes natuueqems natuueqesm natuuemqse natuuemqes natuuemsqe natuuemseq natuuemesq natuuemeqs natuueeqms
natuueeqsm natuueemqs natuueemsq natuueesmq natuueesqm natueesqum natueesqmu natueesuqm natueesumq natueesmuq natueesmqu
natueeqsum natueeqsmu natueequsm natueequms natueeqmus natueeqmsu natueeuqsm natueeuqms natueeusqm natueeusmq natueeumsq
natueeumqs natueemqus natueemqsu natueemuqs natueemusq natueemsuq natueemsqu natuesequm natueseqmu natueseuqm natueseumq
natuesemuq natuesemqu natuesqeum natuesqemu natuesquem natuesqume natuesqmue natuesqmeu natuesuqem natuesuqme natuesueqm
natuesuemq natuesumeq natuesumqe natuesmque natuesmqeu natuesmuqe natuesmueq natuesmeuq natuesmequ natueqseum natueqsemu
natueqsuem natueqsume natueqsmue natueqsmeu natueqesum natueqesmu natueqeusm natueqeums natueqemus natueqemsu natuequesm
natuequems natuequsem natuequsme natuequmse natuequmes natueqmeus natueqmesu natueqmues natueqmuse natueqmsue natueqmseu
natueusqem natueusqme natueuseqm natueusemq natueusmeq natueusmqe natueuqsem natueuqsme natueuqesm natueuqems natueuqmes
natueuqmse natueueqsm natueueqms natueuesqm natueuesmq natueuemsq natueuemqs natueumqes natueumqse natueumeqs natueumesq
natueumseq natueumsqe natuemsque natuemsqeu natuemsuqe natuemsueq natuemseuq natuemsequ natuemqsue natuemqseu natuemquse
natuemques natuemqeus natuemqesu natuemuqse natuemuqes natuemusqe natuemuseq natuemuesq natuemueqs natuemequs natuemeqsu
natuemeuqs natuemeusq natuemesuq natuemesqu natsmueque natsmueqeu natsmueuqe natsmueueq natsmueeuq natsmueequ natsmuqeue
natsmuqeeu natsmuquee natsmuquee natsmuqeue natsmuqeeu natsmuuqee natsmuuqee natsmuueqe natsmuueeq natsmuueeq natsmuueqe
natsmueque natsmueqeu natsmueuqe natsmueueq natsmueeuq natsmueequ natsmeuque natsmeuqeu natsmeuuqe natsmeuueq natsmeueuq
natsmeuequ natsmequue natsmequeu natsmequue natsmequeu natsmeqeuu natsmeqeuu natsmeuque natsmeuqeu natsmeuuqe natsmeuueq
natsmeueuq natsmeuequ natsmeequu natsmeequu natsmeeuqu natsmeeuuq natsmeeuuq natsmeeuqu natsmqeuue natsmqeueu natsmqeuue
natsmqeueu natsmqeeuu natsmqeeuu natsmqueue natsmqueeu natsmquuee natsmquuee natsmqueue natsmqueeu natsmquuee natsmquuee
natsmqueue natsmqueeu natsmqueeu natsmqueue natsmqeuue natsmqeueu natsmqeuue natsmqeueu natsmqeeuu natsmqeeuu natsmueque
natsmueqeu natsmueuqe natsmueueq natsmueeuq natsmueequ natsmuqeue natsmuqeeu natsmuquee natsmuquee natsmuqeue natsmuqeeu
natsmuuqee natsmuuqee natsmuueqe natsmuueeq natsmuueeq natsmuueqe natsmueque natsmueqeu natsmueuqe natsmueueq natsmueeuq
natsmueequ natsmeequu natsmeequu natsmeeuqu natsmeeuuq natsmeeuuq natsmeeuqu natsmeqeuu natsmeqeuu natsmequeu natsmequue
natsmequue natsmequeu natsmeuqeu natsmeuque natsmeuequ natsmeueuq natsmeuueq natsmeuuqe natsmeuque natsmeuqeu natsmeuuqe
natsmeuueq natsmeueuq natsmeuequ natsumeque natsumeqeu natsumeuqe natsumeueq natsumeeuq natsumeequ natsumqeue natsumqeeu
natsumquee natsumquee natsumqeue natsumqeeu natsumuqee natsumuqee natsumueqe natsumueeq natsumueeq natsumueqe natsumeque
natsumeqeu natsumeuqe natsumeueq natsumeeuq natsumeequ natsuemque natsuemqeu natsuemuqe natsuemueq natsuemeuq natsuemequ
natsueqmue natsueqmeu natsuequme natsuequem natsueqeum natsueqemu natsueuqme natsueuqem natsueumqe natsueumeq natsueuemq
natsueueqm natsueequm natsueeqmu natsueeuqm natsueeumq natsueemuq natsueemqu natsuqemue natsuqemeu natsuqeume natsuqeuem
natsuqeeum natsuqeemu natsuqmeue natsuqmeeu natsuqmuee natsuqmuee natsuqmeue natsuqmeeu natsuqumee natsuqumee natsuqueme
natsuqueem natsuqueem natsuqueme natsuqemue natsuqemeu natsuqeume natsuqeuem natsuqeeum natsuqeemu natsuueqme natsuueqem
natsuuemqe natsuuemeq natsuueemq natsuueeqm natsuuqeme natsuuqeem natsuuqmee natsuuqmee natsuuqeme natsuuqeem natsuumqee
natsuumqee natsuumeqe natsuumeeq natsuumeeq natsuumeqe natsuueqme natsuueqem natsuuemqe natsuuemeq natsuueemq natsuueeqm
natsueequm natsueeqmu natsueeuqm natsueeumq natsueemuq natsueemqu natsueqeum natsueqemu natsuequem natsuequme natsueqmue
natsueqmeu natsueuqem natsueuqme natsueueqm natsueuemq natsueumeq natsueumqe natsuemque natsuemqeu natsuemuqe natsuemueq
natsuemeuq natsuemequ natseumque natseumqeu natseumuqe natseumueq natseumeuq natseumequ natseuqmue natseuqmeu natseuqume
natseuquem natseuqeum natseuqemu natseuuqme natseuuqem natseuumqe natseuumeq natseuuemq natseuueqm natseuequm natseueqmu
natseueuqm natseueumq natseuemuq natseuemqu natsemuque natsemuqeu natsemuuqe natsemuueq natsemueuq natsemuequ natsemquue
natsemqueu natsemquue natsemqueu natsemqeuu natsemqeuu natsemuque natsemuqeu natsemuuqe natsemuueq natsemueuq natsemuequ
natsemequu natsemequu natsemeuqu natsemeuuq natsemeuuq natsemeuqu natseqmuue natseqmueu natseqmuue natseqmueu natseqmeuu
natseqmeuu natsequmue natsequmeu natsequume natsequuem natsequeum natsequemu natsequume natsequuem natsequmue natsequmeu
natsequemu natsequeum natseqeuum natseqeumu natseqeuum natseqeumu natseqemuu natseqemuu natseumque natseumqeu natseumuqe
natseumueq natseumeuq natseumequ natseuqmue natseuqmeu natseuqume natseuquem natseuqeum natseuqemu natseuuqme natseuuqem
natseuumqe natseuumeq natseuuemq natseuueqm natseuequm natseueqmu natseueuqm natseueumq natseuemuq natseuemqu natseemquu
natseemquu natseemuqu natseemuuq natseemuuq natseemuqu natseeqmuu natseeqmuu natseequmu natseequum natseequum natseequmu
natseeuqmu natseeuqum natseeumqu natseeumuq natseeuumq natseeuuqm natseeuqum natseeuqmu natseeuuqm natseeuumq natseeumuq
natseeumqu natsquemue natsquemeu natsqueume natsqueuem natsqueeum natsqueemu natsqumeue natsqumeeu natsqumuee natsqumuee
natsqumeue natsqumeeu natsquumee natsquumee natsquueme natsquueem natsquueem natsquueme natsquemue natsquemeu natsqueume
natsqueuem natsqueeum natsqueemu natsqeumue natsqeumeu natsqeuume natsqeuuem natsqeueum natsqeuemu natsqemuue natsqemueu
natsqemuue natsqemueu natsqemeuu natsqemeuu natsqeumue natsqeumeu natsqeuume natsqeuuem natsqeueum natsqeuemu natsqeemuu
natsqeemuu natsqeeumu natsqeeuum natsqeeuum natsqeeumu natsqmeuue natsqmeueu natsqmeuue natsqmeueu natsqmeeuu natsqmeeuu
natsqmueue natsqmueeu natsqmuuee natsqmuuee natsqmueue natsqmueeu natsqmuuee natsqmuuee natsqmueue natsqmueeu natsqmueeu
natsqmueue natsqmeuue natsqmeueu natsqmeuue natsqmeueu natsqmeeuu natsqmeeuu natsquemue natsquemeu natsqueume natsqueuem
natsqueeum natsqueemu natsqumeue natsqumeeu natsqumuee natsqumuee natsqumeue natsqumeeu natsquumee natsquumee natsquueme
natsquueem natsquueem natsquueme natsquemue natsquemeu natsqueume natsqueuem natsqueeum natsqueemu natsqeemuu natsqeemuu
natsqeeumu natsqeeuum natsqeeuum natsqeeumu natsqemeuu natsqemeuu natsqemueu natsqemuue natsqemuue natsqemueu natsqeumeu
natsqeumue natsqeuemu natsqeueum natsqeuuem natsqeuume natsqeumue natsqeumeu natsqeuume natsqeuuem natsqeueum natsqeuemu
natsuueqme natsuueqem natsuuemqe natsuuemeq natsuueemq natsuueeqm natsuuqeme natsuuqeem natsuuqmee natsuuqmee natsuuqeme
natsuuqeem natsuumqee natsuumqee natsuumeqe natsuumeeq natsuumeeq natsuumeqe natsuueqme natsuueqem natsuuemqe natsuuemeq
natsuueemq natsuueeqm natsueuqme natsueuqem natsueumqe natsueumeq natsueuemq natsueueqm natsuequme natsuequem natsueqmue
natsueqmeu natsueqemu natsueqeum natsuemque natsuemqeu natsuemuqe natsuemueq natsuemeuq natsuemequ natsueeqmu natsueequm
natsueemqu natsueemuq natsueeumq natsueeuqm natsuqeume natsuqeuem natsuqemue natsuqemeu natsuqeemu natsuqeeum natsuqueme
natsuqueem natsuqumee natsuqumee natsuqueme natsuqueem natsuqmuee natsuqmuee natsuqmeue natsuqmeeu natsuqmeeu natsuqmeue
natsuqeume natsuqeuem natsuqemue natsuqemeu natsuqeemu natsuqeeum natsumeque natsumeqeu natsumeuqe natsumeueq natsumeeuq
natsumeequ natsumqeue natsumqeeu natsumquee natsumquee natsumqeue natsumqeeu natsumuqee natsumuqee natsumueqe natsumueeq
natsumueeq natsumueqe natsumeque natsumeqeu natsumeuqe natsumeueq natsumeeuq natsumeequ natsueeqmu natsueequm natsueemqu
natsueemuq natsueeumq natsueeuqm natsueqemu natsueqeum natsueqmeu natsueqmue natsuequme natsuequem natsuemqeu natsuemque
natsuemequ natsuemeuq natsuemueq natsuemuqe natsueuqme natsueuqem natsueumqe natsueumeq natsueuemq natsueueqm natseuequm
natseueqmu natseueuqm natseueumq natseuemuq natseuemqu natseuqeum natseuqemu natseuquem natseuqume natseuqmue natseuqmeu
natseuuqem natseuuqme natseuueqm natseuuemq natseuumeq natseuumqe natseumque natseumqeu natseumuqe natseumueq natseumeuq
natseumequ natseeuqum natseeuqmu natseeuuqm natseeuumq natseeumuq natseeumqu natseequum natseequmu natseequum natseequmu
natseeqmuu natseeqmuu natseeuqum natseeuqmu natseeuuqm natseeuumq natseeumuq natseeumqu natseemquu natseemquu natseemuqu
natseemuuq natseemuuq natseemuqu natseqeuum natseqeumu natseqeuum natseqeumu natseqemuu natseqemuu natsequeum natsequemu
natsequuem natsequume natsequmue natsequmeu natsequuem natsequume natsequeum natsequemu natsequmeu natsequmue natseqmuue
natseqmueu natseqmuue natseqmueu natseqmeuu natseqmeuu natseuequm natseueqmu natseueuqm natseueumq natseuemuq natseuemqu
natseuqeum natseuqemu natseuquem natseuqume natseuqmue natseuqmeu natseuuqem natseuuqme natseuueqm natseuuemq natseuumeq
natseuumqe natseumque natseumqeu natseumuqe natseumueq natseumeuq natseumequ natsemequu natsemequu natsemeuqu natsemeuuq
natsemeuuq natsemeuqu natsemqeuu natsemqeuu natsemqueu natsemquue natsemquue natsemqueu natsemuqeu natsemuque natsemuequ
natsemueuq natsemuueq natsemuuqe natsemuque natsemuqeu natsemuuqe natsemuueq natsemueuq natsemuequ natqmuseue natqmuseeu
natqmusuee natqmusuee natqmuseue natqmuseeu natqmuesue natqmueseu natqmueuse natqmueues natqmueeus natqmueesu natqmuuese
natqmuuees natqmuusee natqmuusee natqmuuese natqmuuees natqmueeus natqmueesu natqmueues natqmueuse natqmuesue natqmueseu
natqmsueue natqmsueeu natqmsuuee natqmsuuee natqmsueue natqmsueeu natqmseuue natqmseueu natqmseuue natqmseueu natqmseeuu
natqmseeuu natqmsueue natqmsueeu natqmsuuee natqmsuuee natqmsueue natqmsueeu natqmseeuu natqmseeuu natqmseueu natqmseuue
natqmseuue natqmseueu natqmesuue natqmesueu natqmesuue natqmesueu natqmeseuu natqmeseuu natqmeusue natqmeuseu natqmeuuse
natqmeuues natqmeueus natqmeuesu natqmeuuse natqmeuues natqmeusue natqmeuseu natqmeuesu natqmeueus natqmeeuus natqmeeusu
natqmeeuus natqmeeusu natqmeesuu natqmeesuu natqmuseue natqmuseeu natqmusuee natqmusuee natqmuseue natqmuseeu natqmuesue
natqmueseu natqmueuse natqmueues natqmueeus natqmueesu natqmuuese natqmuuees natqmuusee natqmuusee natqmuuese natqmuuees
natqmueeus natqmueesu natqmueues natqmueuse natqmuesue natqmueseu natqmeseuu natqmeseuu natqmesueu natqmesuue natqmesuue
natqmesueu natqmeesuu natqmeesuu natqmeeusu natqmeeuus natqmeeuus natqmeeusu natqmeuesu natqmeueus natqmeuseu natqmeusue
natqmeuuse natqmeuues natqmeueus natqmeuesu natqmeuues natqmeuuse natqmeusue natqmeuseu natqumseue natqumseeu natqumsuee
natqumsuee natqumseue natqumseeu natqumesue natqumeseu natqumeuse natqumeues natqumeeus natqumeesu natqumuese natqumuees
natqumusee natqumusee natqumuese natqumuees natqumeeus natqumeesu natqumeues natqumeuse natqumesue natqumeseu natqusmeue
natqusmeeu natqusmuee natqusmuee natqusmeue natqusmeeu natqusemue natqusemeu natquseume natquseuem natquseeum natquseemu
natqusueme natqusueem natqusumee natqusumee natqusueme natqusueem natquseeum natquseemu natquseuem natquseume natqusemue
natqusemeu natquesmue natquesmeu natquesume natquesuem natqueseum natquesemu natquemsue natquemseu natquemuse natquemues
natquemeus natquemesu natqueumse natqueumes natqueusme natqueusem natqueuesm natqueuems natqueemus natqueemsu natqueeums
natqueeusm natqueesum natqueesmu natquuseme natquuseem natquusmee natquusmee natquuseme natquuseem natquuesme natquuesem
natquuemse natquuemes natquueems natquueesm natquumese natquumees natquumsee natquumsee natquumese natquumees natquueems
natquueesm natquuemes natquuemse natquuesme natquuesem natqueseum natquesemu natquesuem natquesume natquesmue natquesmeu
natqueesum natqueesmu natqueeusm natqueeums natqueemus natqueemsu natqueuesm natqueuems natqueusem natqueusme natqueumse
natqueumes natquemeus natquemesu natquemues natquemuse natquemsue natquemseu natqsumeue natqsumeeu natqsumuee natqsumuee
natqsumeue natqsumeeu natqsuemue natqsuemeu natqsueume natqsueuem natqsueeum natqsueemu natqsuueme natqsuueem natqsuumee
natqsuumee natqsuueme natqsuueem natqsueeum natqsueemu natqsueuem natqsueume natqsuemue natqsuemeu natqsmueue natqsmueeu
natqsmuuee natqsmuuee natqsmueue natqsmueeu natqsmeuue natqsmeueu natqsmeuue natqsmeueu natqsmeeuu natqsmeeuu natqsmueue
natqsmueeu natqsmuuee natqsmuuee natqsmueue natqsmueeu natqsmeeuu natqsmeeuu natqsmeueu natqsmeuue natqsmeuue natqsmeueu
natqsemuue natqsemueu natqsemuue natqsemueu natqsemeuu natqsemeuu natqseumue natqseumeu natqseuume natqseuuem natqseueum
natqseuemu natqseuume natqseuuem natqseumue natqseumeu natqseuemu natqseueum natqseeuum natqseeumu natqseeuum natqseeumu
natqseemuu natqseemuu natqsumeue natqsumeeu natqsumuee natqsumuee natqsumeue natqsumeeu natqsuemue natqsuemeu natqsueume
natqsueuem natqsueeum natqsueemu natqsuueme natqsuueem natqsuumee natqsuumee natqsuueme natqsuueem natqsueeum natqsueemu
natqsueuem natqsueume natqsuemue natqsuemeu natqsemeuu natqsemeuu natqsemueu natqsemuue natqsemuue natqsemueu natqseemuu
natqseemuu natqseeumu natqseeuum natqseeuum natqseeumu natqseuemu natqseueum natqseumeu natqseumue natqseuume natqseuuem
natqseueum natqseuemu natqseuuem natqseuume natqseumue natqseumeu natqeusmue natqeusmeu natqeusume natqeusuem natqeuseum
natqeusemu natqeumsue natqeumseu natqeumuse natqeumues natqeumeus natqeumesu natqeuumse natqeuumes natqeuusme natqeuusem
natqeuuesm natqeuuems natqeuemus natqeuemsu natqeueums natqeueusm natqeuesum natqeuesmu natqesumue natqesumeu natqesuume
natqesuuem natqesueum natqesuemu natqesmuue natqesmueu natqesmuue natqesmueu natqesmeuu natqesmeuu natqesumue natqesumeu
natqesuume natqesuuem natqesueum natqesuemu natqesemuu natqesemuu natqeseumu natqeseuum natqeseuum natqeseumu natqemsuue
natqemsueu natqemsuue natqemsueu natqemseuu natqemseuu natqemusue natqemuseu natqemuuse natqemuues natqemueus natqemuesu
natqemuuse natqemuues natqemusue natqemuseu natqemuesu natqemueus natqemeuus natqemeusu natqemeuus natqemeusu natqemesuu
natqemesuu natqeusmue natqeusmeu natqeusume natqeusuem natqeuseum natqeusemu natqeumsue natqeumseu natqeumuse natqeumues
natqeumeus natqeumesu natqeuumse natqeuumes natqeuusme natqeuusem natqeuuesm natqeuuems natqeuemus natqeuemsu natqeueums
natqeueusm natqeuesum natqeuesmu natqeesmuu natqeesmuu natqeesumu natqeesuum natqeesuum natqeesumu natqeemsuu natqeemsuu
natqeemusu natqeemuus natqeemuus natqeemusu natqeeumsu natqeeumus natqeeusmu natqeeusum natqeeuusm natqeeuums natqeeumus
natqeeumsu natqeeuums natqeeuusm natqeeusum natqeeusmu natquuseme natquuseem natquusmee natquusmee natquuseme natquuseem
natquuesme natquuesem natquuemse natquuemes natquueems natquueesm natquumese natquumees natquumsee natquumsee natquumese
natquumees natquueems natquueesm natquuemes natquuemse natquuesme natquuesem natqusueme natqusueem natqusumee natqusumee
natqusueme natqusueem natquseume natquseuem natqusemue natqusemeu natquseemu natquseeum natqusmeue natqusmeeu natqusmuee
natqusmuee natqusmeue natqusmeeu natquseemu natquseeum natqusemeu natqusemue natquseume natquseuem natquesume natquesuem
natquesmue natquesmeu natquesemu natqueseum natqueusme natqueusem natqueumse natqueumes natqueuems natqueuesm natquemuse
natquemues natquemsue natquemseu natquemesu natquemeus natqueeums natqueeusm natqueemus natqueemsu natqueesmu natqueesum
natqumseue natqumseeu natqumsuee natqumsuee natqumseue natqumseeu natqumesue natqumeseu natqumeuse natqumeues natqumeeus
natqumeesu natqumuese natqumuees natqumusee natqumusee natqumuese natqumuees natqumeeus natqumeesu natqumeues natqumeuse
natqumesue natqumeseu natquesemu natqueseum natquesmeu natquesmue natquesume natquesuem natqueesmu natqueesum natqueemsu
natqueemus natqueeums natqueeusm natquemesu natquemeus natquemseu natquemsue natquemuse natquemues natqueuems natqueuesm
natqueumes natqueumse natqueusme natqueusem natqeuseum natqeusemu natqeusuem natqeusume natqeusmue natqeusmeu natqeuesum
natqeuesmu natqeueusm natqeueums natqeuemus natqeuemsu natqeuuesm natqeuuems natqeuusem natqeuusme natqeuumse natqeuumes
natqeumeus natqeumesu natqeumues natqeumuse natqeumsue natqeumseu natqesueum natqesuemu natqesuuem natqesuume natqesumue
natqesumeu natqeseuum natqeseumu natqeseuum natqeseumu natqesemuu natqesemuu natqesueum natqesuemu natqesuuem natqesuume
natqesumue natqesumeu natqesmeuu natqesmeuu natqesmueu natqesmuue natqesmuue natqesmueu natqeesuum natqeesumu natqeesuum
natqeesumu natqeesmuu natqeesmuu natqeeusum natqeeusmu natqeeuusm natqeeuums natqeeumus natqeeumsu natqeeuusm natqeeuums
natqeeusum natqeeusmu natqeeumsu natqeeumus natqeemuus natqeemusu natqeemuus natqeemusu natqeemsuu natqeemsuu natqeuseum
natqeusemu natqeusuem natqeusume natqeusmue natqeusmeu natqeuesum natqeuesmu natqeueusm natqeueums natqeuemus natqeuemsu
natqeuuesm natqeuuems natqeuusem natqeuusme natqeuumse natqeuumes natqeumeus natqeumesu natqeumues natqeumuse natqeumsue
natqeumseu natqemseuu natqemseuu natqemsueu natqemsuue natqemsuue natqemsueu natqemesuu natqemesuu natqemeusu natqemeuus
natqemeuus natqemeusu natqemuesu natqemueus natqemuseu natqemusue natqemuuse natqemuues natqemueus natqemuesu natqemuues
natqemuuse natqemusue natqemuseu natumusqee natumusqee natumuseqe natumuseeq natumuseeq natumuseqe natumuqsee natumuqsee
natumuqese natumuqees natumuqees natumuqese natumueqse natumueqes natumuesqe natumueseq natumueesq natumueeqs natumueqes
natumueqse natumueeqs natumueesq natumueseq natumuesqe natumsuqee natumsuqee natumsueqe natumsueeq natumsueeq natumsueqe
natumsquee natumsquee natumsqeue natumsqeeu natumsqeeu natumsqeue natumseque natumseqeu natumseuqe natumseueq natumseeuq
natumseequ natumseqeu natumseque natumseequ natumseeuq natumseueq natumseuqe natumqsuee natumqsuee natumqseue natumqseeu
natumqseeu natumqseue natumqusee natumqusee natumquese natumquees natumquees natumquese natumqeuse natumqeues natumqesue
natumqeseu natumqeesu natumqeeus natumqeues natumqeuse natumqeeus natumqeesu natumqeseu natumqesue natumesque natumesqeu
natumesuqe natumesueq natumeseuq natumesequ natumeqsue natumeqseu natumequse natumeques natumeqeus natumeqesu natumeuqse
natumeuqes natumeusqe natumeuseq natumeuesq natumeueqs natumeequs natumeeqsu natumeeuqs natumeeusq natumeesuq natumeesqu
natumesqeu natumesque natumesequ natumeseuq natumesueq natumesuqe natumeqseu natumeqsue natumeqesu natumeqeus natumeques
natumequse natumeeqsu natumeequs natumeesqu natumeesuq natumeeusq natumeeuqs natumeuqes natumeuqse natumeueqs natumeuesq
natumeuseq natumeusqe natuumsqee natuumsqee natuumseqe natuumseeq natuumseeq natuumseqe natuumqsee natuumqsee natuumqese
natuumqees natuumqees natuumqese natuumeqse natuumeqes natuumesqe natuumeseq natuumeesq natuumeeqs natuumeqes natuumeqse
natuumeeqs natuumeesq natuumeseq natuumesqe natuusmqee natuusmqee natuusmeqe natuusmeeq natuusmeeq natuusmeqe natuusqmee
natuusqmee natuusqeme natuusqeem natuusqeem natuusqeme natuuseqme natuuseqem natuusemqe natuusemeq natuuseemq natuuseeqm
natuuseqem natuuseqme natuuseeqm natuuseemq natuusemeq natuusemqe natuuqsmee natuuqsmee natuuqseme natuuqseem natuuqseem
natuuqseme natuuqmsee natuuqmsee natuuqmese natuuqmees natuuqmees natuuqmese natuuqemse natuuqemes natuuqesme natuuqesem
natuuqeesm natuuqeems natuuqemes natuuqemse natuuqeems natuuqeesm natuuqesem natuuqesme natuuesqme natuuesqem natuuesmqe
natuuesmeq natuuesemq natuueseqm natuueqsme natuueqsem natuueqmse natuueqmes natuueqems natuueqesm natuuemqse natuuemqes
natuuemsqe natuuemseq natuuemesq natuuemeqs natuueeqms natuueeqsm natuueemqs natuueemsq natuueesmq natuueesqm natuuesqem
natuuesqme natuueseqm natuuesemq natuuesmeq natuuesmqe natuueqsem natuueqsme natuueqesm natuueqems natuueqmes natuueqmse
natuueeqsm natuueeqms natuueesqm natuueesmq natuueemsq natuueemqs natuuemqes natuuemqse natuuemeqs natuuemesq natuuemseq
natuuemsqe natusumqee natusumqee natusumeqe natusumeeq natusumeeq natusumeqe natusuqmee natusuqmee natusuqeme natusuqeem
natusuqeem natusuqeme natusueqme natusueqem natusuemqe natusuemeq natusueemq natusueeqm natusueqem natusueqme natusueeqm
natusueemq natusuemeq natusuemqe natusmuqee natusmuqee natusmueqe natusmueeq natusmueeq natusmueqe natusmquee natusmquee
natusmqeue natusmqeeu natusmqeeu natusmqeue natusmeque natusmeqeu natusmeuqe natusmeueq natusmeeuq natusmeequ natusmeqeu
natusmeque natusmeequ natusmeeuq natusmeueq natusmeuqe natusqmuee natusqmuee natusqmeue natusqmeeu natusqmeeu natusqmeue
natusqumee natusqumee natusqueme natusqueem natusqueem natusqueme natusqeume natusqeuem natusqemue natusqemeu natusqeemu
natusqeeum natusqeuem natusqeume natusqeeum natusqeemu natusqemeu natusqemue natusemque natusemqeu natusemuqe natusemueq
natusemeuq natusemequ natuseqmue natuseqmeu natusequme natusequem natuseqeum natuseqemu natuseuqme natuseuqem natuseumqe
natuseumeq natuseuemq natuseueqm natuseequm natuseeqmu natuseeuqm natuseeumq natuseemuq natuseemqu natusemqeu natusemque
natusemequ natusemeuq natusemueq natusemuqe natuseqmeu natuseqmue natuseqemu natuseqeum natusequem natusequme natuseeqmu
natuseequm natuseemqu natuseemuq natuseeumq natuseeuqm natuseuqem natuseuqme natuseueqm natuseuemq natuseumeq natuseumqe
natuqusmee natuqusmee natuquseme natuquseem natuquseem natuquseme natuqumsee natuqumsee natuqumese natuqumees natuqumees
natuqumese natuquemse natuquemes natuquesme natuquesem natuqueesm natuqueems natuquemes natuquemse natuqueems natuqueesm
natuquesem natuquesme natuqsumee natuqsumee natuqsueme natuqsueem natuqsueem natuqsueme natuqsmuee natuqsmuee natuqsmeue
natuqsmeeu natuqsmeeu natuqsmeue natuqsemue natuqsemeu natuqseume natuqseuem natuqseeum natuqseemu natuqsemeu natuqsemue
natuqseemu natuqseeum natuqseuem natuqseume natuqmsuee natuqmsuee natuqmseue natuqmseeu natuqmseeu natuqmseue natuqmusee
natuqmusee natuqmuese natuqmuees natuqmuees natuqmuese natuqmeuse natuqmeues natuqmesue natuqmeseu natuqmeesu natuqmeeus
natuqmeues natuqmeuse natuqmeeus natuqmeesu natuqmeseu natuqmesue natuqesmue natuqesmeu natuqesume natuqesuem natuqeseum
natuqesemu natuqemsue natuqemseu natuqemuse natuqemues natuqemeus natuqemesu natuqeumse natuqeumes natuqeusme natuqeusem
natuqeuesm natuqeuems natuqeemus natuqeemsu natuqeeums natuqeeusm natuqeesum natuqeesmu natuqesmeu natuqesmue natuqesemu
natuqeseum natuqesuem natuqesume natuqemseu natuqemsue natuqemesu natuqemeus natuqemues natuqemuse natuqeemsu natuqeemus
natuqeesmu natuqeesum natuqeeusm natuqeeums natuqeumes natuqeumse natuqeuems natuqeuesm natuqeusem natuqeusme natueusqme
natueusqem natueusmqe natueusmeq natueusemq natueuseqm natueuqsme natueuqsem natueuqmse natueuqmes natueuqems natueuqesm
natueumqse natueumqes natueumsqe natueumseq natueumesq natueumeqs natueueqms natueueqsm natueuemqs natueuemsq natueuesmq
natueuesqm natuesuqme natuesuqem natuesumqe natuesumeq natuesuemq natuesueqm natuesqume natuesquem natuesqmue natuesqmeu
natuesqemu natuesqeum natuesmque natuesmqeu natuesmuqe natuesmueq natuesmeuq natuesmequ natueseqmu natuesequm natuesemqu
natuesemuq natueseumq natueseuqm natueqsume natueqsuem natueqsmue natueqsmeu natueqsemu natueqseum natuequsme natuequsem
natuequmse natuequmes natuequems natuequesm natueqmuse natueqmues natueqmsue natueqmseu natueqmesu natueqmeus natueqeums
natueqeusm natueqemus natueqemsu natueqesmu natueqesum natuemsque natuemsqeu natuemsuqe natuemsueq natuemseuq natuemsequ
natuemqsue natuemqseu natuemquse natuemques natuemqeus natuemqesu natuemuqse natuemuqes natuemusqe natuemuseq natuemuesq
natuemueqs natuemequs natuemeqsu natuemeuqs natuemeusq natuemesuq natuemesqu natueesqmu natueesqum natueesmqu natueesmuq
natueesumq natueesuqm natueeqsmu natueeqsum natueeqmsu natueeqmus natueequms natueequsm natueemqsu natueemqus natueemsqu
natueemsuq natueemusq natueemuqs natueeuqms natueeuqsm natueeumqs natueeumsq natueeusmq natueeusqm natueusqem natueusqme
natueuseqm natueusemq natueusmeq natueusmqe natueuqsem natueuqsme natueuqesm natueuqems natueuqmes natueuqmse natueueqsm
natueueqms natueuesqm natueuesmq natueuemsq natueuemqs natueumqes natueumqse natueumeqs natueumesq natueumseq natueumsqe
natuesuqem natuesuqme natuesueqm natuesuemq natuesumeq natuesumqe natuesquem natuesqume natuesqeum natuesqemu natuesqmeu
natuesqmue natuesequm natueseqmu natueseuqm natueseumq natuesemuq natuesemqu natuesmqeu natuesmque natuesmequ natuesmeuq
natuesmueq natuesmuqe natueqsuem natueqsume natueqseum natueqsemu natueqsmeu natueqsmue natuequsem natuequsme natuequesm
natuequems natuequmes natuequmse natueqeusm natueqeums natueqesum natueqesmu natueqemsu natueqemus natueqmues natueqmuse
natueqmeus natueqmesu natueqmseu natueqmsue natueesqum natueesqmu natueesuqm natueesumq natueesmuq natueesmqu natueeqsum
natueeqsmu natueequsm natueequms natueeqmus natueeqmsu natueeuqsm natueeuqms natueeusqm natueeusmq natueeumsq natueeumqs
natueemqus natueemqsu natueemuqs natueemusq natueemsuq natueemsqu natuemsqeu natuemsque natuemsequ natuemseuq natuemsueq
natuemsuqe natuemqseu natuemqsue natuemqesu natuemqeus natuemques natuemquse natuemeqsu natuemequs natuemesqu natuemesuq
natuemeusq natuemeuqs natuemuqes natuemuqse natuemueqs natuemuesq natuemuseq natuemusqe natemusque natemusqeu natemusuqe
natemusueq natemuseuq natemusequ natemuqsue natemuqseu natemuquse natemuques natemuqeus natemuqesu natemuuqse natemuuqes
natemuusqe natemuuseq natemuuesq natemuueqs natemuequs natemueqsu natemueuqs natemueusq natemuesuq natemuesqu natemsuque
natemsuqeu natemsuuqe natemsuueq natemsueuq natemsuequ natemsquue natemsqueu natemsquue natemsqueu natemsqeuu natemsqeuu
natemsuque natemsuqeu natemsuuqe natemsuueq natemsueuq natemsuequ natemsequu natemsequu natemseuqu natemseuuq natemseuuq
natemseuqu natemqsuue natemqsueu natemqsuue natemqsueu natemqseuu natemqseuu natemqusue natemquseu natemquuse natemquues
natemqueus natemquesu natemquuse natemquues natemqusue natemquseu natemquesu natemqueus natemqeuus natemqeusu natemqeuus
natemqeusu natemqesuu natemqesuu natemusque natemusqeu natemusuqe natemusueq natemuseuq natemusequ natemuqsue natemuqseu
natemuquse natemuques natemuqeus natemuqesu natemuuqse natemuuqes natemuusqe natemuuseq natemuuesq natemuueqs natemuequs
natemueqsu natemueuqs natemueusq natemuesuq natemuesqu natemesquu natemesquu natemesuqu natemesuuq natemesuuq natemesuqu
natemeqsuu natemeqsuu natemequsu natemequus natemequus natemequsu natemeuqsu natemeuqus natemeusqu natemeusuq natemeuusq
natemeuuqs natemeuqus natemeuqsu natemeuuqs natemeuusq natemeusuq natemeusqu nateumsque nateumsqeu nateumsuqe nateumsueq
nateumseuq nateumsequ nateumqsue nateumqseu nateumquse nateumques nateumqeus nateumqesu nateumuqse nateumuqes nateumusqe
nateumuseq nateumuesq nateumueqs nateumequs nateumeqsu nateumeuqs nateumeusq nateumesuq nateumesqu nateusmque nateusmqeu
nateusmuqe nateusmueq nateusmeuq nateusmequ nateusqmue nateusqmeu nateusqume nateusquem nateusqeum nateusqemu nateusuqme
nateusuqem nateusumqe nateusumeq nateusuemq nateusueqm nateusequm nateuseqmu nateuseuqm nateuseumq nateusemuq nateusemqu
nateuqsmue nateuqsmeu nateuqsume nateuqsuem nateuqseum nateuqsemu nateuqmsue nateuqmseu nateuqmuse nateuqmues nateuqmeus
nateuqmesu nateuqumse nateuqumes nateuqusme nateuqusem nateuquesm nateuquems nateuqemus nateuqemsu nateuqeums nateuqeusm
nateuqesum nateuqesmu nateuusqme nateuusqem nateuusmqe nateuusmeq nateuusemq nateuuseqm nateuuqsme nateuuqsem nateuuqmse
nateuuqmes nateuuqems nateuuqesm nateuumqse nateuumqes nateuumsqe nateuumseq nateuumesq nateuumeqs nateuueqms nateuueqsm
nateuuemqs nateuuemsq nateuuesmq nateuuesqm nateuesqum nateuesqmu nateuesuqm nateuesumq nateuesmuq nateuesmqu nateueqsum
nateueqsmu nateuequsm nateuequms nateueqmus nateueqmsu nateueuqsm nateueuqms nateueusqm nateueusmq nateueumsq nateueumqs
nateuemqus nateuemqsu nateuemuqs nateuemusq nateuemsuq nateuemsqu natesumque natesumqeu natesumuqe natesumueq natesumeuq
natesumequ natesuqmue natesuqmeu natesuqume natesuquem natesuqeum natesuqemu natesuuqme natesuuqem natesuumqe natesuumeq
natesuuemq natesuueqm natesuequm natesueqmu natesueuqm natesueumq natesuemuq natesuemqu natesmuque natesmuqeu natesmuuqe
natesmuueq natesmueuq natesmuequ natesmquue natesmqueu natesmquue natesmqueu natesmqeuu natesmqeuu natesmuque natesmuqeu
natesmuuqe natesmuueq natesmueuq natesmuequ natesmequu natesmequu natesmeuqu natesmeuuq natesmeuuq natesmeuqu natesqmuue
natesqmueu natesqmuue natesqmueu natesqmeuu natesqmeuu natesqumue natesqumeu natesquume natesquuem natesqueum natesquemu
natesquume natesquuem natesqumue natesqumeu natesquemu natesqueum natesqeuum natesqeumu natesqeuum natesqeumu natesqemuu
natesqemuu natesumque natesumqeu natesumuqe natesumueq natesumeuq natesumequ natesuqmue natesuqmeu natesuqume natesuquem
natesuqeum natesuqemu natesuuqme natesuuqem natesuumqe natesuumeq natesuuemq natesuueqm natesuequm natesueqmu natesueuqm
natesueumq natesuemuq natesuemqu natesemquu natesemquu natesemuqu natesemuuq natesemuuq natesemuqu nateseqmuu nateseqmuu
natesequmu natesequum natesequum natesequmu nateseuqmu nateseuqum nateseumqu nateseumuq nateseuumq nateseuuqm nateseuqum
nateseuqmu nateseuuqm nateseuumq nateseumuq nateseumqu natequsmue natequsmeu natequsume natequsuem natequseum natequsemu
natequmsue natequmseu natequmuse natequmues natequmeus natequmesu natequumse natequumes natequusme natequusem natequuesm
natequuems natequemus natequemsu natequeums natequeusm natequesum natequesmu nateqsumue nateqsumeu nateqsuume nateqsuuem
nateqsueum nateqsuemu nateqsmuue nateqsmueu nateqsmuue nateqsmueu nateqsmeuu nateqsmeuu nateqsumue nateqsumeu nateqsuume
nateqsuuem nateqsueum nateqsuemu nateqsemuu nateqsemuu nateqseumu nateqseuum nateqseuum nateqseumu nateqmsuue nateqmsueu
nateqmsuue nateqmsueu nateqmseuu nateqmseuu nateqmusue nateqmuseu nateqmuuse nateqmuues nateqmueus nateqmuesu nateqmuuse
nateqmuues nateqmusue nateqmuseu nateqmuesu nateqmueus nateqmeuus nateqmeusu nateqmeuus nateqmeusu nateqmesuu nateqmesuu
natequsmue natequsmeu natequsume natequsuem natequseum natequsemu natequmsue natequmseu natequmuse natequmues natequmeus
natequmesu natequumse natequumes natequusme natequusem natequuesm natequuems natequemus natequemsu natequeums natequeusm
natequesum natequesmu nateqesmuu nateqesmuu nateqesumu nateqesuum nateqesuum nateqesumu nateqemsuu nateqemsuu nateqemusu
nateqemuus nateqemuus nateqemusu nateqeumsu nateqeumus nateqeusmu nateqeusum nateqeuusm nateqeuums nateqeumus nateqeumsu
nateqeuums nateqeuusm nateqeusum nateqeusmu nateuusqme nateuusqem nateuusmqe nateuusmeq nateuusemq nateuuseqm nateuuqsme
nateuuqsem nateuuqmse nateuuqmes nateuuqems nateuuqesm nateuumqse nateuumqes nateuumsqe nateuumseq nateuumesq nateuumeqs
nateuueqms nateuueqsm nateuuemqs nateuuemsq nateuuesmq nateuuesqm nateusuqme nateusuqem nateusumqe nateusumeq nateusuemq
nateusueqm nateusqume nateusquem nateusqmue nateusqmeu nateusqemu nateusqeum nateusmque nateusmqeu nateusmuqe nateusmueq
nateusmeuq nateusmequ nateuseqmu nateusequm nateusemqu nateusemuq nateuseumq nateuseuqm nateuqsume nateuqsuem nateuqsmue
nateuqsmeu nateuqsemu nateuqseum nateuqusme nateuqusem nateuqumse nateuqumes nateuquems nateuquesm nateuqmuse nateuqmues
nateuqmsue nateuqmseu nateuqmesu nateuqmeus nateuqeums nateuqeusm nateuqemus nateuqemsu nateuqesmu nateuqesum nateumsque
nateumsqeu nateumsuqe nateumsueq nateumseuq nateumsequ nateumqsue nateumqseu nateumquse nateumques nateumqeus nateumqesu
nateumuqse nateumuqes nateumusqe nateumuseq nateumuesq nateumueqs nateumequs nateumeqsu nateumeuqs nateumeusq nateumesuq
nateumesqu nateuesqmu nateuesqum nateuesmqu nateuesmuq nateuesumq nateuesuqm nateueqsmu nateueqsum nateueqmsu nateueqmus
nateuequms nateuequsm nateuemqsu nateuemqus nateuemsqu nateuemsuq nateuemusq nateuemuqs nateueuqms nateueuqsm nateueumqs
nateueumsq nateueusmq nateueusqm nateeusqum nateeusqmu nateeusuqm nateeusumq nateeusmuq nateeusmqu nateeuqsum nateeuqsmu
nateeuqusm nateeuqums nateeuqmus nateeuqmsu nateeuuqsm nateeuuqms nateeuusqm nateeuusmq nateeuumsq nateeuumqs nateeumqus
nateeumqsu nateeumuqs nateeumusq nateeumsuq nateeumsqu nateesuqum nateesuqmu nateesuuqm nateesuumq nateesumuq nateesumqu
nateesquum nateesqumu nateesquum nateesqumu nateesqmuu nateesqmuu nateesuqum nateesuqmu nateesuuqm nateesuumq nateesumuq
nateesumqu nateesmquu nateesmquu nateesmuqu nateesmuuq nateesmuuq nateesmuqu nateeqsuum nateeqsumu nateeqsuum nateeqsumu
nateeqsmuu nateeqsmuu nateequsum nateequsmu nateequusm nateequums nateequmus nateequmsu nateequusm nateequums nateequsum
nateequsmu nateequmsu nateequmus nateeqmuus nateeqmusu nateeqmuus nateeqmusu nateeqmsuu nateeqmsuu nateeusqum nateeusqmu
nateeusuqm nateeusumq nateeusmuq nateeusmqu nateeuqsum nateeuqsmu nateeuqusm nateeuqums nateeuqmus nateeuqmsu nateeuuqsm
nateeuuqms nateeuusqm nateeuusmq nateeuumsq nateeuumqs nateeumqus nateeumqsu nateeumuqs nateeumusq nateeumsuq nateeumsqu
nateemsquu nateemsquu nateemsuqu nateemsuuq nateemsuuq nateemsuqu nateemqsuu nateemqsuu nateemqusu nateemquus nateemquus
nateemqusu nateemuqsu nateemuqus nateemusqu nateemusuq nateemuusq nateemuuqs nateemuqus nateemuqsu nateemuuqs nateemuusq
nateemusuq nateemusqu

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us