easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

sacerdotemque

dutifully

stuprum

spand

nitemini

paulo

unrotating

redlined

swanwort

jgoun

unadvancedly

litchis

visceribus

primaeva

trichopterygidae

uppity

searles

adorns


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: mucksy
cipher variations:
nvdltz owemua pxfnvb qygowc rzhpxd
saiqye tbjrzf ucksag vdltbh wemuci
xfnvdj ygowek zhpxfl aiqygm bjrzhn
cksaio dltbjp emuckq fnvdlr gowems
hpxfnt iqygou jrzhpv ksaiqw ltbjrx

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: mucksy
Cipher: nfxphb

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: mucksy
Cipher: ABABB BAABB AAABA ABAAB BAAAB BABBA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: mucksy
cipher variations:
nvdltzljhfdvjxlznrhlptxnfztnhjdnxhrfzpfvlxxdjpvt
vrnjfptfrdplrtvxzhphzrjdowemuamkigewkymaosimquyo
gauoikeoyisgaqgwmyyekqwuwsokgqugseqmsuwyaiqiaske
pxfnvbnljhfxlznbptjnrvzphbvpjlfpzjthbrhxnzzflrxv
xtplhrvhtfrntvxzbjrjbtlfqygowcomkigymaocqukoswaq
icwqkmgqakuicsiyoaagmsywyuqmiswiugsouwyackskcumg
rzhpxdpnljhznbpdrvlptxbrjdxrlnhrblvjdtjzpbbhntzx
zvrnjtxjvhtpvxzbdltldvnhsaiqyeqomkiaocqeswmquycs
keysmoiscmwkeukaqcciouayawsokuykwiuqwyacemumewoi
tbjrzfrpnljbpdrftxnrvzdtlfztnpjtdnxlfvlbrddjpvbz
bxtplvzlxjvrxzbdfnvnfxpjucksagsqomkcqesguyoswaeu
mgauoqkueoymgwmcseekqwcacyuqmwamykwsyacegowogyqk
vdltbhtrpnldrfthvzptxbfvnhbvprlvfpznhxndtfflrxdb
dzvrnxbnzlxtzbdfhpxphzrlwemuciusqomesguiwaquycgw
oicwqsmwgqaoiyoeuggmsyeceawsoycoamyuacegiqyqiasm
xfnvdjvtrpnfthvjxbrvzdhxpjdxrtnxhrbpjzpfvhhntzfd
fbxtpzdpbnzvbdfhjrzrjbtnygowekwusqoguiwkycswaeiy
qkeysuoyiscqkaqgwiiouagegcyuqaeqcoawcegiksaskcuo
zhpxflxvtrphvjxlzdtxbfjzrlfztvpzjtdrlbrhxjjpvbhf
hdzvrbfrdpbxdfhjltbtldvpaiqygmywusqiwkymaeuycgka
smgauwqakuesmcsiykkqwcigieawscgseqcyegikmucumewq
bjrzhnzxvtrjxlznbfvzdhlbtnhbvxrblvftndtjzllrxdjh
jfbxtdhtfrdzfhjlnvdvnfxrcksaioaywuskymaocgwaeimc
uoicwyscmwguoeukammsyekikgcyueiugseagikmowewogys
dltbjpbzxvtlznbpdhxbfjndvpjdxztdnxhvpfvlbnntzflj
lhdzvfjvhtfbhjlnpxfxphztemuckqcaywumaocqeiycgkoe
wqkeyaueoyiwqgwmcoouagmkmieawgkwiugcikmoqygyqiau
fnvdlrdbzxvnbpdrfjzdhlpfxrlfzbvfpzjxrhxndppvbhnl
njfbxhlxjvhdjlnprzhzrjbvgowemsecaywocqesgkaeimqg
ysmgacwgqakysiyoeqqwciomokgcyimykwiekmoqsaiaskcw
hpxfntfdbzxpdrfthlbfjnrhztnhbdxhrblztjzpfrrxdjpn
plhdzjnzlxjflnprtbjbtldxiqygougecayqesguimcgkosi
auoiceyiscmaukaqgssyekqoqmieakoamykgmoqsuckcumey
jrzhpvhfdbzrfthvjndhlptjbvpjdfzjtdnbvlbrhttzflrp
rnjfblpbnzlhnprtvdldvnfzksaiqwigecasguiwkoeimquk
cwqkegakueocwmcsiuuagmsqsokgcmqcoamioqsuwemewoga
ltbjrxjhfdbthvjxlpfjnrvldxrlfhblvfpdxndtjvvbhntr
tplhdnrdpbnjprtvxfnfxphbmucksykigecuiwkymqgkoswm
eysmgicmwgqeyoeukwwciousuqmieoseqcokqsuwygogyqic

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: mucksy
Cipher: zhpxfl

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: mucksy
Cipher: 235431523445

Extended Methods:
Method #1

Plaintext: mucksy
method variations:
rzhpxdwenucibkszhogpxent

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
m u c k s y 
2 5 3 5 3 4 
3 4 1 2 4 5 
They are then read out in rows:
253534341245
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: mucksy
Cipher: wxssfy

Read more ...
Method #3

Plaintext: mucksy
method variations:
xovmtk ovmtkx vmtkxo
mtkxov tkxovm kxovmt

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: mucksy

all 720 cipher variations:
mucksy muckys mucsky mucsyk mucysk mucyks mukcsy mukcys mukscy muksyc mukysc
mukycs muskcy muskyc muscky muscyk musyck musykc muyksc muykcs muyskc muysck
muycsk muycks mcuksy mcukys mcusky mcusyk mcuysk mcuyks mckusy mckuys mcksuy
mcksyu mckysu mckyus mcskuy mcskyu mcsuky mcsuyk mcsyuk mcsyku mcyksu mcykus
mcysku mcysuk mcyusk mcyuks mkcusy mkcuys mkcsuy mkcsyu mkcysu mkcyus mkucsy
mkucys mkuscy mkusyc mkuysc mkuycs mksucy mksuyc mkscuy mkscyu mksycu mksyuc
mkyusc mkyucs mkysuc mkyscu mkycsu mkycus msckuy msckyu mscuky mscuyk mscyuk
mscyku mskcuy mskcyu mskucy mskuyc mskyuc mskycu msukcy msukyc msucky msucyk
msuyck msuykc msykuc msykcu msyukc msyuck msycuk msycku mycksu myckus mycsku
mycsuk mycusk mycuks mykcsu mykcus mykscu myksuc mykusc mykucs myskcu myskuc
myscku myscuk mysuck mysukc myuksc myukcs myuskc myusck myucsk myucks umcksy
umckys umcsky umcsyk umcysk umcyks umkcsy umkcys umkscy umksyc umkysc umkycs
umskcy umskyc umscky umscyk umsyck umsykc umyksc umykcs umyskc umysck umycsk
umycks ucmksy ucmkys ucmsky ucmsyk ucmysk ucmyks uckmsy uckmys ucksmy ucksym
uckysm uckyms ucskmy ucskym ucsmky ucsmyk ucsymk ucsykm ucyksm ucykms ucyskm
ucysmk ucymsk ucymks ukcmsy ukcmys ukcsmy ukcsym ukcysm ukcyms ukmcsy ukmcys
ukmscy ukmsyc ukmysc ukmycs uksmcy uksmyc ukscmy ukscym uksycm uksymc ukymsc
ukymcs ukysmc ukyscm ukycsm ukycms usckmy usckym uscmky uscmyk uscymk uscykm
uskcmy uskcym uskmcy uskmyc uskymc uskycm usmkcy usmkyc usmcky usmcyk usmyck
usmykc usykmc usykcm usymkc usymck usycmk usyckm uycksm uyckms uycskm uycsmk
uycmsk uycmks uykcsm uykcms uykscm uyksmc uykmsc uykmcs uyskcm uyskmc uysckm
uyscmk uysmck uysmkc uymksc uymkcs uymskc uymsck uymcsk uymcks cumksy cumkys
cumsky cumsyk cumysk cumyks cukmsy cukmys cuksmy cuksym cukysm cukyms cuskmy
cuskym cusmky cusmyk cusymk cusykm cuyksm cuykms cuyskm cuysmk cuymsk cuymks
cmuksy cmukys cmusky cmusyk cmuysk cmuyks cmkusy cmkuys cmksuy cmksyu cmkysu
cmkyus cmskuy cmskyu cmsuky cmsuyk cmsyuk cmsyku cmyksu cmykus cmysku cmysuk
cmyusk cmyuks ckmusy ckmuys ckmsuy ckmsyu ckmysu ckmyus ckumsy ckumys ckusmy
ckusym ckuysm ckuyms cksumy cksuym cksmuy cksmyu cksymu cksyum ckyusm ckyums
ckysum ckysmu ckymsu ckymus csmkuy csmkyu csmuky csmuyk csmyuk csmyku cskmuy
cskmyu cskumy cskuym cskyum cskymu csukmy csukym csumky csumyk csuymk csuykm
csykum csykmu csyukm csyumk csymuk csymku cymksu cymkus cymsku cymsuk cymusk
cymuks cykmsu cykmus cyksmu cyksum cykusm cykums cyskmu cyskum cysmku cysmuk
cysumk cysukm cyuksm cyukms cyuskm cyusmk cyumsk cyumks kucmsy kucmys kucsmy
kucsym kucysm kucyms kumcsy kumcys kumscy kumsyc kumysc kumycs kusmcy kusmyc
kuscmy kuscym kusycm kusymc kuymsc kuymcs kuysmc kuyscm kuycsm kuycms kcumsy
kcumys kcusmy kcusym kcuysm kcuyms kcmusy kcmuys kcmsuy kcmsyu kcmysu kcmyus
kcsmuy kcsmyu kcsumy kcsuym kcsyum kcsymu kcymsu kcymus kcysmu kcysum kcyusm
kcyums kmcusy kmcuys kmcsuy kmcsyu kmcysu kmcyus kmucsy kmucys kmuscy kmusyc
kmuysc kmuycs kmsucy kmsuyc kmscuy kmscyu kmsycu kmsyuc kmyusc kmyucs kmysuc
kmyscu kmycsu kmycus kscmuy kscmyu kscumy kscuym kscyum kscymu ksmcuy ksmcyu
ksmucy ksmuyc ksmyuc ksmycu ksumcy ksumyc ksucmy ksucym ksuycm ksuymc ksymuc
ksymcu ksyumc ksyucm ksycum ksycmu kycmsu kycmus kycsmu kycsum kycusm kycums
kymcsu kymcus kymscu kymsuc kymusc kymucs kysmcu kysmuc kyscmu kyscum kysucm
kysumc kyumsc kyumcs kyusmc kyuscm kyucsm kyucms suckmy suckym sucmky sucmyk
sucymk sucykm sukcmy sukcym sukmcy sukmyc sukymc sukycm sumkcy sumkyc sumcky
sumcyk sumyck sumykc suykmc suykcm suymkc suymck suycmk suyckm scukmy scukym
scumky scumyk scuymk scuykm sckumy sckuym sckmuy sckmyu sckymu sckyum scmkuy
scmkyu scmuky scmuyk scmyuk scmyku scykmu scykum scymku scymuk scyumk scyukm
skcumy skcuym skcmuy skcmyu skcymu skcyum skucmy skucym skumcy skumyc skuymc
skuycm skmucy skmuyc skmcuy skmcyu skmycu skmyuc skyumc skyucm skymuc skymcu
skycmu skycum smckuy smckyu smcuky smcuyk smcyuk smcyku smkcuy smkcyu smkucy
smkuyc smkyuc smkycu smukcy smukyc smucky smucyk smuyck smuykc smykuc smykcu
smyukc smyuck smycuk smycku syckmu syckum sycmku sycmuk sycumk sycukm sykcmu
sykcum sykmcu sykmuc sykumc sykucm symkcu symkuc symcku symcuk symuck symukc
syukmc syukcm syumkc syumck syucmk syuckm yucksm yuckms yucskm yucsmk yucmsk
yucmks yukcsm yukcms yukscm yuksmc yukmsc yukmcs yuskcm yuskmc yusckm yuscmk
yusmck yusmkc yumksc yumkcs yumskc yumsck yumcsk yumcks ycuksm ycukms ycuskm
ycusmk ycumsk ycumks yckusm yckums ycksum ycksmu yckmsu yckmus ycskum ycskmu
ycsukm ycsumk ycsmuk ycsmku ycmksu ycmkus ycmsku ycmsuk ycmusk ycmuks ykcusm
ykcums ykcsum ykcsmu ykcmsu ykcmus ykucsm ykucms ykuscm ykusmc ykumsc ykumcs
yksucm yksumc ykscum ykscmu yksmcu yksmuc ykmusc ykmucs ykmsuc ykmscu ykmcsu
ykmcus ysckum ysckmu yscukm yscumk yscmuk yscmku yskcum yskcmu yskucm yskumc
yskmuc yskmcu ysukcm ysukmc ysuckm ysucmk ysumck ysumkc ysmkuc ysmkcu ysmukc
ysmuck ysmcuk ysmcku ymcksu ymckus ymcsku ymcsuk ymcusk ymcuks ymkcsu ymkcus
ymkscu ymksuc ymkusc ymkucs ymskcu ymskuc ymscku ymscuk ymsuck ymsukc ymuksc
ymukcs ymuskc ymusck ymucsk ymucks

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us