easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

incapableness

caveators

hohokus

leyba

subigereque

embryographer

tootlish

macgm

latter

frigora

egressusque

rehydrate

supraordinary

themac

ciceronically

guzzi

foosland

kermack


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: mouereque
cipher variations:
npvfsfrvf oqwgtgswg prxhuhtxh qsyiviuyi rtzjwjvzj
suakxkwak tvblylxbl uwcmzmycm vxdnanzdn wyeoboaeo
xzfpcpbfp yagqdqcgq zbhrerdhr acisfseis bdjtgtfjt
cekuhugku dflvivhlv egmwjwimw fhnxkxjnx gioylykoy
hjpzmzlpz ikqanamqa jlrbobnrb kmscpcosc lntdqdptd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: mouereque
Cipher: nlfvivjfv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: mouereque
Cipher: ABABB ABBAB BAABB AABAA BAAAA AABAA ABBBB BAABB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: mouereque
cipher variations:
npvfsfrvflrjnanxjnjtxvivdxvhvldqdjldfxzlylpzldzntgtvntzdpjwjhpjxfdrerndr
vhrzmztrztjfhuhzfhrltpcpftppnhxkxlhxoqwgtgswgmskoboykokuywjweywiwmerekme
gyamzmqameaouhuwouaeqkxkiqkygesfsoeswisanausaukgiviagismuqdqguqqoiylymiy
prxhuhtxhntlpcpzlplvzxkxfzxjxnfsflnfhzbnanrbnfbpvivxpvbfrlyljrlzhftgtpft
xjtbobvtbvlhjwjbhjtnvrerhvrrpjzmznjzqsyiviuyioumqdqamqmwaylygaykyogtgmog
iacoboscogcqwjwyqwcgsmzmksmaiguhuqguykucpcwucwmikxkcikuowsfsiwssqkanaoka
rtzjwjvzjpvnrerbnrnxbzmzhbzlzphuhnphjbdpcptdphdrxkxzrxdhtnanltnbjhvivrhv
zlvdqdxvdxnjlyldjlvpxtgtjxttrlbobplbsuakxkwakqwosfscosoycanaicamaqivioqi
kceqdqueqiesylyasyeiuobomuockiwjwsiwamwereyweyokmzmekmwqyuhukyuusmcpcqmc
tvblylxblrxptgtdptpzdbobjdbnbrjwjprjldfrervfrjftzmzbtzfjvpcpnvpdljxkxtjx
bnxfsfzxfzplnanflnxrzvivlzvvtndqdrnduwcmzmycmsyquhuequqaecpckecocskxkqsk
megsfswgskguanacuagkwqdqowqemkylyukycoygtgaygaqmobogmoysawjwmawwuoeresoe
vxdnanzdntzrvivfrvrbfdqdlfdpdtlylrtlnfhtgtxhtlhvbobdvbhlxrerpxrfnlzmzvlz
dpzhuhbzhbrnpcphnpztbxkxnbxxvpfsftpfwyeoboaeouaswjwgswscgeremgeqeumzmsum
ogiuhuyiumiwcpcewcimysfsqysgomanawmaeqaivicaicsoqdqioqaucylyocyywqgtguqg
xzfpcpbfpvbtxkxhtxtdhfsfnhfrfvnantvnphjvivzjvnjxdqdfxdjnztgtrzthpnbobxnb
frbjwjdbjdtprerjprbvdzmzpdzzxrhuhvrhyagqdqcgqwcuylyiuyueigtgoigsgwobouwo
qikwjwakwokyeregyekoauhusauiqocpcyocgsckxkeckeuqsfskqscweanaqeaaysiviwsi
zbhrerdhrxdvzmzjvzvfjhuhpjhthxpcpvxprjlxkxblxplzfsfhzflpbvivtbvjrpdqdzpd
htdlylfdlfvrtgtlrtdxfbobrfbbztjwjxtjacisfseisyewanakwawgkiviqkiuiyqdqwyq
skmylycmyqmagtgiagmqcwjwucwksqereaqeiuemzmgemgwsuhumsueygcpcsgccaukxkyuk
bdjtgtfjtzfxboblxbxhljwjrljvjzrerxzrtlnzmzdnzrnbhuhjbhnrdxkxvdxltrfsfbrf
jvfnanhfnhxtvivntvfzhdqdthddbvlylzvlcekuhugkuagycpcmycyimkxksmkwkasfsyas
umoanaeoasocivikcioseylyweymusgtgcsgkwgoboigoiyuwjwouwgaiereuieecwmzmawm
dflvivhlvbhzdqdnzdzjnlyltnlxlbtgtzbtvnpbobfpbtpdjwjldjptfzmzxfznvthuhdth
lxhpcpjhpjzvxkxpvxhbjfsfvjffdxnanbxnegmwjwimwciaereoaeakomzmuomymcuhuacu
woqcpcgqcuqekxkmekquganaygaowuivieuimyiqdqkiqkawylyqwyickgtgwkggeyobocyo
fhnxkxjnxdjbfsfpbfblpnanvpnzndvivbdvxprdqdhrdvrflylnflrvhbobzhbpxvjwjfvj
nzjrerljrlbxzmzrxzjdlhuhxlhhfzpcpdzpgioylykoyekcgtgqcgcmqobowqoaoewjwcew
yqsereisewsgmzmogmswicpcaicqywkxkgwkoaksfsmksmcyanasyakemiviymiigaqdqeaq
hjpzmzlpzfldhuhrdhdnrpcpxrpbpfxkxdfxzrtfsfjtfxthnanphntxjdqdbjdrzxlylhxl
pbltgtnltndzbobtzblfnjwjznjjhbrerfbrikqanamqagmeiviseieosqdqysqcqgylyegy
asugtgkugyuioboqiouykereckesaymzmiymqcmuhuomuoeacpcuacmgokxkaokkicsfsgcs
jlrbobnrbhnfjwjtfjfptrerztrdrhzmzfhzbtvhuhlvhzvjpcprjpvzlfsfdlftbznanjzn
rdnvivpnvpfbdqdvbdnhplylbplljdtgthdtkmscpcosciogkxkugkgqusfsausesianagia
cuwivimwiawkqdqskqwamgtgemgucaobokaoseowjwqowqgcerewceoiqmzmcqmmkeuhuieu
lntdqdptdjphlylvhlhrvtgtbvtftjbobhjbdvxjwjnxjbxlrertlrxbnhuhfnhvdbpcplbp
tfpxkxrpxrhdfsfxdfpjrnandrnnlfvivjfvmouerequekqimzmwimiswuhucwugukcpcikc
ewykxkoykcymsfsumsycoivigoiwecqdqmcqugqylysqysiegtgyegqksoboesoomgwjwkgw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: mouereque
Cipher: zbhrerdhr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: mouereque
Cipher: 234354512451145451

Extended Methods:
Method #1

Plaintext: mouereque
method variations:
rtzkwkvzkwyepbpaepbdkugufkugipzmzlpz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
m o u e r e q u e 
2 4 5 5 2 5 1 5 5 
3 3 4 1 4 1 4 4 1 
They are then read out in rows:
245525155334141441
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: mouereque
Cipher: rzwvpsqqd

Read more ...
Method #3

Plaintext: mouereque
method variations:
sxyfyayyf xyfyayyfs yfyayyfsx
fyayyfsxy yayyfsxyf ayyfsxyfy
yyfsxyfya yfsxyfyay fsxyfyayy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: mouereque

first 5040 cipher variations(362880 total)
mouereque mouereqeu mouereuqe mouereueq mouereeuq mouereequ mouerqeue mouerqeeu mouerquee mouerquee mouerqeue
mouerqeeu moueruqee moueruqee mouerueqe mouerueeq mouerueeq mouerueqe mouereque mouereqeu mouereuqe mouereueq
mouereeuq mouereequ moueerque moueerqeu moueeruqe moueerueq moueereuq moueerequ moueeqrue moueeqreu moueequre
moueequer moueeqeur moueeqeru moueeuqre moueeuqer moueeurqe moueeureq moueeuerq moueeueqr moueeequr moueeeqru
moueeeuqr moueeeurq moueeeruq moueeerqu moueqerue moueqereu moueqeure moueqeuer moueqeeur moueqeeru moueqreue
moueqreeu moueqruee moueqruee moueqreue moueqreeu mouequree mouequree mouequere mouequeer mouequeer mouequere
moueqerue moueqereu moueqeure moueqeuer moueqeeur moueqeeru moueueqre moueueqer moueuerqe moueuereq moueueerq
moueueeqr moueuqere moueuqeer moueuqree moueuqree moueuqere moueuqeer moueurqee moueurqee moueureqe moueureeq
moueureeq moueureqe moueueqre moueueqer moueuerqe moueuereq moueueerq moueueeqr moueeequr moueeeqru moueeeuqr
moueeeurq moueeeruq moueeerqu moueeqeur moueeqeru moueequer moueequre moueeqrue moueeqreu moueeuqer moueeuqre
moueeueqr moueeuerq moueeureq moueeurqe moueerque moueerqeu moueeruqe moueerueq moueereuq moueerequ moureeque
moureeqeu moureeuqe moureeueq moureeeuq moureeequ moureqeue moureqeeu mourequee mourequee moureqeue moureqeeu
moureuqee moureuqee moureueqe moureueeq moureueeq moureueqe moureeque moureeqeu moureeuqe moureeueq moureeeuq
moureeequ moureeque moureeqeu moureeuqe moureeueq moureeeuq moureeequ moureqeue moureqeeu mourequee mourequee
moureqeue moureqeeu moureuqee moureuqee moureueqe moureueeq moureueeq moureueqe moureeque moureeqeu moureeuqe
moureeueq moureeeuq moureeequ mourqeeue mourqeeeu mourqeuee mourqeuee mourqeeue mourqeeeu mourqeeue mourqeeeu
mourqeuee mourqeuee mourqeeue mourqeeeu mourqueee mourqueee mourqueee mourqueee mourqueee mourqueee mourqeeue
mourqeeeu mourqeuee mourqeuee mourqeeue mourqeeeu mourueqee mourueqee mourueeqe mourueeeq mourueeeq mourueeqe
mouruqeee mouruqeee mouruqeee mouruqeee mouruqeee mouruqeee mourueqee mourueqee mourueeqe mourueeeq mourueeeq
mourueeqe mourueqee mourueqee mourueeqe mourueeeq mourueeeq mourueeqe moureeque moureeqeu moureeuqe moureeueq
moureeeuq moureeequ moureqeue moureqeeu mourequee mourequee moureqeue moureqeeu moureuqee moureuqee moureueqe
moureueeq moureueeq moureueqe moureeque moureeqeu moureeuqe moureeueq moureeeuq moureeequ mouereque mouereqeu
mouereuqe mouereueq mouereeuq mouereequ mouerqeue mouerqeeu mouerquee mouerquee mouerqeue mouerqeeu moueruqee
moueruqee mouerueqe mouerueeq mouerueeq mouerueqe mouereque mouereqeu mouereuqe mouereueq mouereeuq mouereequ
moueerque moueerqeu moueeruqe moueerueq moueereuq moueerequ moueeqrue moueeqreu moueequre moueequer moueeqeur
moueeqeru moueeuqre moueeuqer moueeurqe moueeureq moueeuerq moueeueqr moueeequr moueeeqru moueeeuqr moueeeurq
moueeeruq moueeerqu moueqerue moueqereu moueqeure moueqeuer moueqeeur moueqeeru moueqreue moueqreeu moueqruee
moueqruee moueqreue moueqreeu mouequree mouequree mouequere mouequeer mouequeer mouequere moueqerue moueqereu
moueqeure moueqeuer moueqeeur moueqeeru moueueqre moueueqer moueuerqe moueuereq moueueerq moueueeqr moueuqere
moueuqeer moueuqree moueuqree moueuqere moueuqeer moueurqee moueurqee moueureqe moueureeq moueureeq moueureqe
moueueqre moueueqer moueuerqe moueuereq moueueerq moueueeqr moueeequr moueeeqru moueeeuqr moueeeurq moueeeruq
moueeerqu moueeqeur moueeqeru moueequer moueequre moueeqrue moueeqreu moueeuqer moueeuqre moueeueqr moueeuerq
moueeureq moueeurqe moueerque moueerqeu moueeruqe moueerueq moueereuq moueerequ mouqreeue mouqreeeu mouqreuee
mouqreuee mouqreeue mouqreeeu mouqreeue mouqreeeu mouqreuee mouqreuee mouqreeue mouqreeeu mouqrueee mouqrueee
mouqrueee mouqrueee mouqrueee mouqrueee mouqreeue mouqreeeu mouqreuee mouqreuee mouqreeue mouqreeeu mouqereue
mouqereeu mouqeruee mouqeruee mouqereue mouqereeu mouqeerue mouqeereu mouqeeure mouqeeuer mouqeeeur mouqeeeru
mouqeuere mouqeueer mouqeuree mouqeuree mouqeuere mouqeueer mouqeeeur mouqeeeru mouqeeuer mouqeeure mouqeerue
mouqeereu mouqeerue mouqeereu mouqeeure mouqeeuer mouqeeeur mouqeeeru mouqereue mouqereeu mouqeruee mouqeruee
mouqereue mouqereeu mouqeuree mouqeuree mouqeuere mouqeueer mouqeueer mouqeuere mouqeerue mouqeereu mouqeeure
mouqeeuer mouqeeeur mouqeeeru mouqueere mouqueeer mouqueree mouqueree mouqueere mouqueeer mouqueere mouqueeer
mouqueree mouqueree mouqueere mouqueeer mouqureee mouqureee mouqureee mouqureee mouqureee mouqureee mouqueere
mouqueeer mouqueree mouqueree mouqueere mouqueeer mouqeeeur mouqeeeru mouqeeuer mouqeeure mouqeerue mouqeereu
mouqeeeur mouqeeeru mouqeeuer mouqeeure mouqeerue mouqeereu mouqeueer mouqeuere mouqeueer mouqeuere mouqeuree
mouqeuree mouqereue mouqereeu mouqeruee mouqeruee mouqereue mouqereeu mouureqee mouureqee mouureeqe mouureeeq
mouureeeq mouureeqe mouurqeee mouurqeee mouurqeee mouurqeee mouurqeee mouurqeee mouureqee mouureqee mouureeqe
mouureeeq mouureeeq mouureeqe mouureqee mouureqee mouureeqe mouureeeq mouureeeq mouureeqe mouuerqee mouuerqee
mouuereqe mouuereeq mouuereeq mouuereqe mouueqree mouueqree mouueqere mouueqeer mouueqeer mouueqere mouueeqre
mouueeqer mouueerqe mouueereq mouueeerq mouueeeqr mouueeqer mouueeqre mouueeeqr mouueeerq mouueereq mouueerqe
mouuqeree mouuqeree mouuqeere mouuqeeer mouuqeeer mouuqeere mouuqreee mouuqreee mouuqreee mouuqreee mouuqreee
mouuqreee mouuqeree mouuqeree mouuqeere mouuqeeer mouuqeeer mouuqeere mouuqeree mouuqeree mouuqeere mouuqeeer
mouuqeeer mouuqeere mouueeqre mouueeqer mouueerqe mouueereq mouueeerq mouueeeqr mouueqere mouueqeer mouueqree
mouueqree mouueqere mouueqeer mouuerqee mouuerqee mouuereqe mouuereeq mouuereeq mouuereqe mouueeqre mouueeqer
mouueerqe mouueereq mouueeerq mouueeeqr mouueeqer mouueeqre mouueeeqr mouueeerq mouueereq mouueerqe mouueqeer
mouueqere mouueqeer mouueqere mouueqree mouueqree mouueeqer mouueeqre mouueeeqr mouueeerq mouueereq mouueerqe
mouuerqee mouuerqee mouuereqe mouuereeq mouuereeq mouuereqe mouereque mouereqeu mouereuqe mouereueq mouereeuq
mouereequ mouerqeue mouerqeeu mouerquee mouerquee mouerqeue mouerqeeu moueruqee moueruqee mouerueqe mouerueeq
mouerueeq mouerueqe mouereque mouereqeu mouereuqe mouereueq mouereeuq mouereequ moueerque moueerqeu moueeruqe
moueerueq moueereuq moueerequ moueeqrue moueeqreu moueequre moueequer moueeqeur moueeqeru moueeuqre moueeuqer
moueeurqe moueeureq moueeuerq moueeueqr moueeequr moueeeqru moueeeuqr moueeeurq moueeeruq moueeerqu moueqerue
moueqereu moueqeure moueqeuer moueqeeur moueqeeru moueqreue moueqreeu moueqruee moueqruee moueqreue moueqreeu
mouequree mouequree mouequere mouequeer mouequeer mouequere moueqerue moueqereu moueqeure moueqeuer moueqeeur
moueqeeru moueueqre moueueqer moueuerqe moueuereq moueueerq moueueeqr moueuqere moueuqeer moueuqree moueuqree
moueuqere moueuqeer moueurqee moueurqee moueureqe moueureeq moueureeq moueureqe moueueqre moueueqer moueuerqe
moueuereq moueueerq moueueeqr moueeequr moueeeqru moueeeuqr moueeeurq moueeeruq moueeerqu moueeqeur moueeqeru
moueequer moueequre moueeqrue moueeqreu moueeuqer moueeuqre moueeueqr moueeuerq moueeureq moueeurqe moueerque
moueerqeu moueeruqe moueerueq moueereuq moueerequ moeureque moeureqeu moeureuqe moeureueq moeureeuq moeureequ
moeurqeue moeurqeeu moeurquee moeurquee moeurqeue moeurqeeu moeuruqee moeuruqee moeurueqe moeurueeq moeurueeq
moeurueqe moeureque moeureqeu moeureuqe moeureueq moeureeuq moeureequ moeuerque moeuerqeu moeueruqe moeuerueq
moeuereuq moeuerequ moeueqrue moeueqreu moeuequre moeuequer moeueqeur moeueqeru moeueuqre moeueuqer moeueurqe
moeueureq moeueuerq moeueueqr moeueequr moeueeqru moeueeuqr moeueeurq moeueeruq moeueerqu moeuqerue moeuqereu
moeuqeure moeuqeuer moeuqeeur moeuqeeru moeuqreue moeuqreeu moeuqruee moeuqruee moeuqreue moeuqreeu moeuquree
moeuquree moeuquere moeuqueer moeuqueer moeuquere moeuqerue moeuqereu moeuqeure moeuqeuer moeuqeeur moeuqeeru
moeuueqre moeuueqer moeuuerqe moeuuereq moeuueerq moeuueeqr moeuuqere moeuuqeer moeuuqree moeuuqree moeuuqere
moeuuqeer moeuurqee moeuurqee moeuureqe moeuureeq moeuureeq moeuureqe moeuueqre moeuueqer moeuuerqe moeuuereq
moeuueerq moeuueeqr moeueequr moeueeqru moeueeuqr moeueeurq moeueeruq moeueerqu moeueqeur moeueqeru moeuequer
moeuequre moeueqrue moeueqreu moeueuqer moeueuqre moeueueqr moeueuerq moeueureq moeueurqe moeuerque moeuerqeu
moeueruqe moeuerueq moeuereuq moeuerequ moerueque moerueqeu moerueuqe moerueueq moerueeuq moerueequ moeruqeue
moeruqeeu moeruquee moeruquee moeruqeue moeruqeeu moeruuqee moeruuqee moeruueqe moeruueeq moeruueeq moeruueqe
moerueque moerueqeu moerueuqe moerueueq moerueeuq moerueequ moereuque moereuqeu moereuuqe moereuueq moereueuq
moereuequ moerequue moerequeu moerequue moerequeu moereqeuu moereqeuu moereuque moereuqeu moereuuqe moereuueq
moereueuq moereuequ moereequu moereequu moereeuqu moereeuuq moereeuuq moereeuqu moerqeuue moerqeueu moerqeuue
moerqeueu moerqeeuu moerqeeuu moerqueue moerqueeu moerquuee moerquuee moerqueue moerqueeu moerquuee moerquuee
moerqueue moerqueeu moerqueeu moerqueue moerqeuue moerqeueu moerqeuue moerqeueu moerqeeuu moerqeeuu moerueque
moerueqeu moerueuqe moerueueq moerueeuq moerueequ moeruqeue moeruqeeu moeruquee moeruquee moeruqeue moeruqeeu
moeruuqee moeruuqee moeruueqe moeruueeq moeruueeq moeruueqe moerueque moerueqeu moerueuqe moerueueq moerueeuq
moerueequ moereequu moereequu moereeuqu moereeuuq moereeuuq moereeuqu moereqeuu moereqeuu moerequeu moerequue
moerequue moerequeu moereuqeu moereuque moereuequ moereueuq moereuueq moereuuqe moereuque moereuqeu moereuuqe
moereuueq moereueuq moereuequ moeeruque moeeruqeu moeeruuqe moeeruueq moeerueuq moeeruequ moeerquue moeerqueu
moeerquue moeerqueu moeerqeuu moeerqeuu moeeruque moeeruqeu moeeruuqe moeeruueq moeerueuq moeeruequ moeerequu
moeerequu moeereuqu moeereuuq moeereuuq moeereuqu moeeurque moeeurqeu moeeuruqe moeeurueq moeeureuq moeeurequ
moeeuqrue moeeuqreu moeeuqure moeeuquer moeeuqeur moeeuqeru moeeuuqre moeeuuqer moeeuurqe moeeuureq moeeuuerq
moeeuueqr moeeuequr moeeueqru moeeueuqr moeeueurq moeeueruq moeeuerqu moeequrue moeequreu moeequure moeequuer
moeequeur moeequeru moeeqruue moeeqrueu moeeqruue moeeqrueu moeeqreuu moeeqreuu moeequrue moeequreu moeequure
moeequuer moeequeur moeequeru moeeqeruu moeeqeruu moeeqeuru moeeqeuur moeeqeuur moeeqeuru moeeuuqre moeeuuqer
moeeuurqe moeeuureq moeeuuerq moeeuueqr moeeuqure moeeuquer moeeuqrue moeeuqreu moeeuqeru moeeuqeur moeeurque
moeeurqeu moeeuruqe moeeurueq moeeureuq moeeurequ moeeueqru moeeuequr moeeuerqu moeeueruq moeeueurq moeeueuqr
moeeeuqur moeeeuqru moeeeuuqr moeeeuurq moeeeuruq moeeeurqu moeeequur moeeequru moeeequur moeeequru moeeeqruu
moeeeqruu moeeeuqur moeeeuqru moeeeuuqr moeeeuurq moeeeuruq moeeeurqu moeeerquu moeeerquu moeeeruqu moeeeruuq
moeeeruuq moeeeruqu moeqreuue moeqreueu moeqreuue moeqreueu moeqreeuu moeqreeuu moeqrueue moeqrueeu moeqruuee
moeqruuee moeqrueue moeqrueeu moeqruuee moeqruuee moeqrueue moeqrueeu moeqrueeu moeqrueue moeqreuue moeqreueu
moeqreuue moeqreueu moeqreeuu moeqreeuu moeqeruue moeqerueu moeqeruue moeqerueu moeqereuu moeqereuu moeqeurue
moeqeureu moeqeuure moeqeuuer moeqeueur moeqeueru moeqeuure moeqeuuer moeqeurue moeqeureu moeqeueru moeqeueur
moeqeeuur moeqeeuru moeqeeuur moeqeeuru moeqeeruu moeqeeruu moequerue moequereu moequeure moequeuer moequeeur
moequeeru moequreue moequreeu moequruee moequruee moequreue moequreeu moequuree moequuree moequuere moequueer
moequueer moequuere moequerue moequereu moequeure moequeuer moequeeur moequeeru moequeure moequeuer moequerue
moequereu moequeeru moequeeur moequuere moequueer moequuree moequuree moequuere moequueer moequruee moequruee
moequreue moequreeu moequreeu moequreue moequeure moequeuer moequerue moequereu moequeeru moequeeur moeqeeuur
moeqeeuru moeqeeuur moeqeeuru moeqeeruu moeqeeruu moeqeueur moeqeueru moeqeuuer moeqeuure moeqeurue moeqeureu
moeqeuuer moeqeuure moeqeueur moeqeueru moeqeureu moeqeurue moeqeruue moeqerueu moeqeruue moeqerueu moeqereuu
moeqereuu moeureque moeureqeu moeureuqe moeureueq moeureeuq moeureequ moeurqeue moeurqeeu moeurquee moeurquee
moeurqeue moeurqeeu moeuruqee moeuruqee moeurueqe moeurueeq moeurueeq moeurueqe moeureque moeureqeu moeureuqe
moeureueq moeureeuq moeureequ moeuerque moeuerqeu moeueruqe moeuerueq moeuereuq moeuerequ moeueqrue moeueqreu
moeuequre moeuequer moeueqeur moeueqeru moeueuqre moeueuqer moeueurqe moeueureq moeueuerq moeueueqr moeueequr
moeueeqru moeueeuqr moeueeurq moeueeruq moeueerqu moeuqerue moeuqereu moeuqeure moeuqeuer moeuqeeur moeuqeeru
moeuqreue moeuqreeu moeuqruee moeuqruee moeuqreue moeuqreeu moeuquree moeuquree moeuquere moeuqueer moeuqueer
moeuquere moeuqerue moeuqereu moeuqeure moeuqeuer moeuqeeur moeuqeeru moeuueqre moeuueqer moeuuerqe moeuuereq
moeuueerq moeuueeqr moeuuqere moeuuqeer moeuuqree moeuuqree moeuuqere moeuuqeer moeuurqee moeuurqee moeuureqe
moeuureeq moeuureeq moeuureqe moeuueqre moeuueqer moeuuerqe moeuuereq moeuueerq moeuueeqr moeueequr moeueeqru
moeueeuqr moeueeurq moeueeruq moeueerqu moeueqeur moeueqeru moeuequer moeuequre moeueqrue moeueqreu moeueuqer
moeueuqre moeueueqr moeueuerq moeueureq moeueurqe moeuerque moeuerqeu moeueruqe moeuerueq moeuereuq moeuerequ
moeerequu moeerequu moeereuqu moeereuuq moeereuuq moeereuqu moeerqeuu moeerqeuu moeerqueu moeerquue moeerquue
moeerqueu moeeruqeu moeeruque moeeruequ moeerueuq moeeruueq moeeruuqe moeeruque moeeruqeu moeeruuqe moeeruueq
moeerueuq moeeruequ moeeerquu moeeerquu moeeeruqu moeeeruuq moeeeruuq moeeeruqu moeeeqruu moeeeqruu moeeequru
moeeequur moeeequur moeeequru moeeeuqru moeeeuqur moeeeurqu moeeeuruq moeeeuurq moeeeuuqr moeeeuqur moeeeuqru
moeeeuuqr moeeeuurq moeeeuruq moeeeurqu moeeqeruu moeeqeruu moeeqeuru moeeqeuur moeeqeuur moeeqeuru moeeqreuu
moeeqreuu moeeqrueu moeeqruue moeeqruue moeeqrueu moeequreu moeequrue moeequeru moeequeur moeequuer moeequure
moeequrue moeequreu moeequure moeequuer moeequeur moeequeru moeeueqru moeeuequr moeeuerqu moeeueruq moeeueurq
moeeueuqr moeeuqeru moeeuqeur moeeuqreu moeeuqrue moeeuqure moeeuquer moeeurqeu moeeurque moeeurequ moeeureuq
moeeurueq moeeuruqe moeeuuqre moeeuuqer moeeuurqe moeeuureq moeeuuerq moeeuueqr moeeuequr moeeueqru moeeueuqr
moeeueurq moeeueruq moeeuerqu moeeuqeur moeeuqeru moeeuquer moeeuqure moeeuqrue moeeuqreu moeeuuqer moeeuuqre
moeeuueqr moeeuuerq moeeuureq moeeuurqe moeeurque moeeurqeu moeeuruqe moeeurueq moeeureuq moeeurequ moreueque
moreueqeu moreueuqe moreueueq moreueeuq moreueequ moreuqeue moreuqeeu moreuquee moreuquee moreuqeue moreuqeeu
moreuuqee moreuuqee moreuueqe moreuueeq moreuueeq moreuueqe moreueque moreueqeu moreueuqe moreueueq moreueeuq
moreueequ moreeuque moreeuqeu moreeuuqe moreeuueq moreeueuq moreeuequ moreequue moreequeu moreequue moreequeu
moreeqeuu moreeqeuu moreeuque moreeuqeu moreeuuqe moreeuueq moreeueuq moreeuequ moreeequu moreeequu moreeeuqu
moreeeuuq moreeeuuq moreeeuqu moreqeuue moreqeueu moreqeuue moreqeueu moreqeeuu moreqeeuu morequeue morequeeu
morequuee morequuee morequeue morequeeu morequuee morequuee morequeue morequeeu morequeeu morequeue moreqeuue
moreqeueu moreqeuue moreqeueu moreqeeuu moreqeeuu moreueque moreueqeu moreueuqe moreueueq moreueeuq moreueequ
moreuqeue moreuqeeu moreuquee moreuquee moreuqeue moreuqeeu moreuuqee moreuuqee moreuueqe moreuueeq moreuueeq
moreuueqe moreueque moreueqeu moreueuqe moreueueq moreueeuq moreueequ moreeequu moreeequu moreeeuqu moreeeuuq
moreeeuuq moreeeuqu moreeqeuu moreeqeuu moreequeu moreequue moreequue moreequeu moreeuqeu moreeuque moreeuequ
moreeueuq moreeuueq moreeuuqe moreeuque moreeuqeu moreeuuqe moreeuueq moreeueuq moreeuequ morueeque morueeqeu
morueeuqe morueeueq morueeeuq morueeequ morueqeue morueqeeu moruequee moruequee morueqeue morueqeeu morueuqee
morueuqee morueueqe morueueeq morueueeq morueueqe morueeque morueeqeu morueeuqe morueeueq morueeeuq morueeequ
morueeque morueeqeu morueeuqe morueeueq morueeeuq morueeequ morueqeue morueqeeu moruequee moruequee morueqeue
morueqeeu morueuqee morueuqee morueueqe morueueeq morueueeq morueueqe morueeque morueeqeu morueeuqe morueeueq
morueeeuq morueeequ moruqeeue moruqeeeu moruqeuee moruqeuee moruqeeue moruqeeeu moruqeeue moruqeeeu moruqeuee
moruqeuee moruqeeue moruqeeeu moruqueee moruqueee moruqueee moruqueee moruqueee moruqueee moruqeeue moruqeeeu
moruqeuee moruqeuee moruqeeue moruqeeeu moruueqee moruueqee moruueeqe moruueeeq moruueeeq moruueeqe moruuqeee
moruuqeee moruuqeee moruuqeee moruuqeee moruuqeee moruueqee moruueqee moruueeqe moruueeeq moruueeeq moruueeqe
moruueqee moruueqee moruueeqe moruueeeq moruueeeq moruueeqe morueeque morueeqeu morueeuqe morueeueq morueeeuq
morueeequ morueqeue morueqeeu moruequee moruequee morueqeue morueqeeu morueuqee morueuqee morueueqe morueueeq
morueueeq morueueqe morueeque morueeqeu morueeuqe morueeueq morueeeuq morueeequ moreueque moreueqeu moreueuqe
moreueueq moreueeuq moreueequ moreuqeue moreuqeeu moreuquee moreuquee moreuqeue moreuqeeu moreuuqee moreuuqee
moreuueqe moreuueeq moreuueeq moreuueqe moreueque moreueqeu moreueuqe moreueueq moreueeuq moreueequ moreeuque
moreeuqeu moreeuuqe moreeuueq moreeueuq moreeuequ moreequue moreequeu moreequue moreequeu moreeqeuu moreeqeuu
moreeuque moreeuqeu moreeuuqe moreeuueq moreeueuq moreeuequ moreeequu moreeequu moreeeuqu moreeeuuq moreeeuuq
moreeeuqu moreqeuue moreqeueu moreqeuue moreqeueu moreqeeuu moreqeeuu morequeue morequeeu morequuee morequuee
morequeue morequeeu morequuee morequuee morequeue morequeeu morequeeu morequeue moreqeuue moreqeueu moreqeuue
moreqeueu moreqeeuu moreqeeuu moreueque moreueqeu moreueuqe moreueueq moreueeuq moreueequ moreuqeue moreuqeeu
moreuquee moreuquee moreuqeue moreuqeeu moreuuqee moreuuqee moreuueqe moreuueeq moreuueeq moreuueqe moreueque
moreueqeu moreueuqe moreueueq moreueeuq moreueequ moreeequu moreeequu moreeeuqu moreeeuuq moreeeuuq moreeeuqu
moreeqeuu moreeqeuu moreequeu moreequue moreequue moreequeu moreeuqeu moreeuque moreeuequ moreeueuq moreeuueq
moreeuuqe moreeuque moreeuqeu moreeuuqe moreeuueq moreeueuq moreeuequ morqueeue morqueeeu morqueuee morqueuee
morqueeue morqueeeu morqueeue morqueeeu morqueuee morqueuee morqueeue morqueeeu morquueee morquueee morquueee
morquueee morquueee morquueee morqueeue morqueeeu morqueuee morqueuee morqueeue morqueeeu morqeueue morqeueeu
morqeuuee morqeuuee morqeueue morqeueeu morqeeuue morqeeueu morqeeuue morqeeueu morqeeeuu morqeeeuu morqeueue
morqeueeu morqeuuee morqeuuee morqeueue morqeueeu morqeeeuu morqeeeuu morqeeueu morqeeuue morqeeuue morqeeueu
morqeeuue morqeeueu morqeeuue morqeeueu morqeeeuu morqeeeuu morqeueue morqeueeu morqeuuee morqeuuee morqeueue
morqeueeu morqeuuee morqeuuee morqeueue morqeueeu morqeueeu morqeueue morqeeuue morqeeueu morqeeuue morqeeueu
morqeeeuu morqeeeuu morqueeue morqueeeu morqueuee morqueuee morqueeue morqueeeu morqueeue morqueeeu morqueuee
morqueuee morqueeue morqueeeu morquueee morquueee morquueee morquueee morquueee morquueee morqueeue morqueeeu
morqueuee morqueuee morqueeue morqueeeu morqeeeuu morqeeeuu morqeeueu morqeeuue morqeeuue morqeeueu morqeeeuu
morqeeeuu morqeeueu morqeeuue morqeeuue morqeeueu morqeueeu morqeueue morqeueeu morqeueue morqeuuee morqeuuee
morqeueue morqeueeu morqeuuee morqeuuee morqeueue morqeueeu moruueqee moruueqee moruueeqe moruueeeq moruueeeq
moruueeqe moruuqeee moruuqeee moruuqeee moruuqeee moruuqeee moruuqeee moruueqee moruueqee moruueeqe moruueeeq
moruueeeq moruueeqe moruueqee moruueqee moruueeqe moruueeeq moruueeeq moruueeqe morueuqee morueuqee morueueqe
morueueeq morueueeq morueueqe moruequee moruequee morueqeue morueqeeu morueqeeu morueqeue morueeque morueeqeu
morueeuqe morueeueq morueeeuq morueeequ morueeqeu morueeque morueeequ morueeeuq morueeueq morueeuqe moruqeuee
moruqeuee moruqeeue moruqeeeu moruqeeeu moruqeeue moruqueee moruqueee moruqueee moruqueee moruqueee moruqueee
moruqeuee moruqeuee moruqeeue moruqeeeu moruqeeeu moruqeeue moruqeuee moruqeuee moruqeeue moruqeeeu moruqeeeu
moruqeeue morueeque morueeqeu morueeuqe morueeueq morueeeuq morueeequ morueqeue morueqeeu moruequee moruequee
morueqeue morueqeeu morueuqee morueuqee morueueqe morueueeq morueueeq morueueqe morueeque morueeqeu morueeuqe
morueeueq morueeeuq morueeequ morueeqeu morueeque morueeequ morueeeuq morueeueq morueeuqe morueqeeu morueqeue
morueqeeu morueqeue moruequee moruequee morueeqeu morueeque morueeequ morueeeuq morueeueq morueeuqe morueuqee
morueuqee morueueqe morueueeq morueueeq morueueqe moreueque moreueqeu moreueuqe moreueueq moreueeuq moreueequ
moreuqeue moreuqeeu moreuquee moreuquee moreuqeue moreuqeeu moreuuqee moreuuqee moreuueqe moreuueeq moreuueeq
moreuueqe moreueque moreueqeu moreueuqe moreueueq moreueeuq moreueequ moreeuque moreeuqeu moreeuuqe moreeuueq
moreeueuq moreeuequ moreequue moreequeu moreequue moreequeu moreeqeuu moreeqeuu moreeuque moreeuqeu moreeuuqe
moreeuueq moreeueuq moreeuequ moreeequu moreeequu moreeeuqu moreeeuuq moreeeuuq moreeeuqu moreqeuue moreqeueu
moreqeuue moreqeueu moreqeeuu moreqeeuu morequeue morequeeu morequuee morequuee morequeue morequeeu morequuee
morequuee morequeue morequeeu morequeeu morequeue moreqeuue moreqeueu moreqeuue moreqeueu moreqeeuu moreqeeuu
moreueque moreueqeu moreueuqe moreueueq moreueeuq moreueequ moreuqeue moreuqeeu moreuquee moreuquee moreuqeue
moreuqeeu moreuuqee moreuuqee moreuueqe moreuueeq moreuueeq moreuueqe moreueque moreueqeu moreueuqe moreueueq
moreueeuq moreueequ moreeequu moreeequu moreeeuqu moreeeuuq moreeeuuq moreeeuqu moreeqeuu moreeqeuu moreequeu
moreequue moreequue moreequeu moreeuqeu moreeuque moreeuequ moreeueuq moreeuueq moreeuuqe moreeuque moreeuqeu
moreeuuqe moreeuueq moreeueuq moreeuequ moeeruque moeeruqeu moeeruuqe moeeruueq moeerueuq moeeruequ moeerquue
moeerqueu moeerquue moeerqueu moeerqeuu moeerqeuu moeeruque moeeruqeu moeeruuqe moeeruueq moeerueuq moeeruequ
moeerequu moeerequu moeereuqu moeereuuq moeereuuq moeereuqu moeeurque moeeurqeu moeeuruqe moeeurueq moeeureuq
moeeurequ moeeuqrue moeeuqreu moeeuqure moeeuquer moeeuqeur moeeuqeru moeeuuqre moeeuuqer moeeuurqe moeeuureq
moeeuuerq moeeuueqr moeeuequr moeeueqru moeeueuqr moeeueurq moeeueruq moeeuerqu moeequrue moeequreu moeequure
moeequuer moeequeur moeequeru moeeqruue moeeqrueu moeeqruue moeeqrueu moeeqreuu moeeqreuu moeequrue moeequreu
moeequure moeequuer moeequeur moeequeru moeeqeruu moeeqeruu moeeqeuru moeeqeuur moeeqeuur moeeqeuru moeeuuqre
moeeuuqer moeeuurqe moeeuureq moeeuuerq moeeuueqr moeeuqure moeeuquer moeeuqrue moeeuqreu moeeuqeru moeeuqeur
moeeurque moeeurqeu moeeuruqe moeeurueq moeeureuq moeeurequ moeeueqru moeeuequr moeeuerqu moeeueruq moeeueurq
moeeueuqr moeeeuqur moeeeuqru moeeeuuqr moeeeuurq moeeeuruq moeeeurqu moeeequur moeeequru moeeequur moeeequru
moeeeqruu moeeeqruu moeeeuqur moeeeuqru moeeeuuqr moeeeuurq moeeeuruq moeeeurqu moeeerquu moeeerquu moeeeruqu
moeeeruuq moeeeruuq moeeeruqu moereuque moereuqeu moereuuqe moereuueq moereueuq moereuequ moerequue moerequeu
moerequue moerequeu moereqeuu moereqeuu moereuque moereuqeu moereuuqe moereuueq moereueuq moereuequ moereequu
moereequu moereeuqu moereeuuq moereeuuq moereeuqu moerueque moerueqeu moerueuqe moerueueq moerueeuq moerueequ
moeruqeue moeruqeeu moeruquee moeruquee moeruqeue moeruqeeu moeruuqee moeruuqee moeruueqe moeruueeq moeruueeq
moeruueqe moerueque moerueqeu moerueuqe moerueueq moerueeuq moerueequ moerqueue moerqueeu moerquuee moerquuee
moerqueue moerqueeu moerqeuue moerqeueu moerqeuue moerqeueu moerqeeuu moerqeeuu moerqueue moerqueeu moerquuee
moerquuee moerqueue moerqueeu moerqeeuu moerqeeuu moerqeueu moerqeuue moerqeuue moerqeueu moeruuqee moeruuqee
moeruueqe moeruueeq moeruueeq moeruueqe moeruquee moeruquee moeruqeue moeruqeeu moeruqeeu moeruqeue moerueque
moerueqeu moerueuqe moerueueq moerueeuq moerueequ moerueqeu moerueque moerueequ moerueeuq moerueueq moerueuqe
moereuque moereuqeu moereuuqe moereuueq moereueuq moereuequ moerequue moerequeu moerequue moerequeu moereqeuu
moereqeuu moereuque moereuqeu moereuuqe moereuueq moereueuq moereuequ moereequu moereequu moereeuqu moereeuuq
moereeuuq moereeuqu moeureque moeureqeu moeureuqe moeureueq moeureeuq moeureequ moeurqeue moeurqeeu moeurquee
moeurquee moeurqeue moeurqeeu moeuruqee moeuruqee moeurueqe moeurueeq moeurueeq moeurueqe moeureque moeureqeu
moeureuqe moeureueq moeureeuq moeureequ moeuerque moeuerqeu moeueruqe moeuerueq moeuereuq moeuerequ moeueqrue
moeueqreu moeuequre moeuequer moeueqeur moeueqeru moeueuqre moeueuqer moeueurqe moeueureq moeueuerq moeueueqr
moeueequr moeueeqru moeueeuqr moeueeurq moeueeruq moeueerqu moeuqerue moeuqereu moeuqeure moeuqeuer moeuqeeur
moeuqeeru moeuqreue moeuqreeu moeuqruee moeuqruee moeuqreue moeuqreeu moeuquree moeuquree moeuquere moeuqueer
moeuqueer moeuquere moeuqerue moeuqereu moeuqeure moeuqeuer moeuqeeur moeuqeeru moeuueqre moeuueqer moeuuerqe
moeuuereq moeuueerq moeuueeqr moeuuqere moeuuqeer moeuuqree moeuuqree moeuuqere moeuuqeer moeuurqee moeuurqee
moeuureqe moeuureeq moeuureeq moeuureqe moeuueqre moeuueqer moeuuerqe moeuuereq moeuueerq moeuueeqr moeueequr
moeueeqru moeueeuqr moeueeurq moeueeruq moeueerqu moeueqeur moeueqeru moeuequer moeuequre moeueqrue moeueqreu
moeueuqer moeueuqre moeueueqr moeueuerq moeueureq moeueurqe moeuerque moeuerqeu moeueruqe moeuerueq moeuereuq
moeuerequ moeqrueue moeqrueeu moeqruuee moeqruuee moeqrueue moeqrueeu moeqreuue moeqreueu moeqreuue moeqreueu
moeqreeuu moeqreeuu moeqrueue moeqrueeu moeqruuee moeqruuee moeqrueue moeqrueeu moeqreeuu moeqreeuu moeqreueu
moeqreuue moeqreuue moeqreueu moequreue moequreeu moequruee moequruee moequreue moequreeu moequerue moequereu
moequeure moequeuer moequeeur moequeeru moequuere moequueer moequuree moequuree moequuere moequueer moequeeur
moequeeru moequeuer moequeure moequerue moequereu moeqeurue moeqeureu moeqeuure moeqeuuer moeqeueur moeqeueru
moeqeruue moeqerueu moeqeruue moeqerueu moeqereuu moeqereuu moeqeurue moeqeureu moeqeuure moeqeuuer moeqeueur
moeqeueru moeqeeruu moeqeeruu moeqeeuru moeqeeuur moeqeeuur moeqeeuru moequuere moequueer moequuree moequuree
moequuere moequueer moequeure moequeuer moequerue moequereu moequeeru moequeeur moequreue moequreeu moequruee
moequruee moequreue moequreeu moequeeru moequeeur moequereu moequerue moequeure moequeuer moeqeueur moeqeueru
moeqeuuer moeqeuure moeqeurue moeqeureu moeqeeuur moeqeeuru moeqeeuur moeqeeuru moeqeeruu moeqeeruu moeqeueur
moeqeueru moeqeuuer moeqeuure moeqeurue moeqeureu moeqereuu moeqereuu moeqerueu moeqeruue moeqeruue moeqerueu
moeuruqee moeuruqee moeurueqe moeurueeq moeurueeq moeurueqe moeurquee moeurquee moeurqeue moeurqeeu moeurqeeu
moeurqeue moeureque moeureqeu moeureuqe moeureueq moeureeuq moeureequ moeureqeu moeureque moeureequ moeureeuq
moeureueq moeureuqe moeuurqee moeuurqee moeuureqe moeuureeq moeuureeq moeuureqe moeuuqree moeuuqree moeuuqere
moeuuqeer moeuuqeer moeuuqere moeuueqre moeuueqer moeuuerqe moeuuereq moeuueerq moeuueeqr moeuueqer moeuueqre
moeuueeqr moeuueerq moeuuereq moeuuerqe moeuquree moeuquree moeuquere moeuqueer moeuqueer moeuquere moeuqruee
moeuqruee moeuqreue moeuqreeu moeuqreeu moeuqreue moeuqerue moeuqereu moeuqeure moeuqeuer moeuqeeur moeuqeeru
moeuqereu moeuqerue moeuqeeru moeuqeeur moeuqeuer moeuqeure moeueuqre moeueuqer moeueurqe moeueureq moeueuerq
moeueueqr moeuequre moeuequer moeueqrue moeueqreu moeueqeru moeueqeur moeuerque moeuerqeu moeueruqe moeuerueq
moeuereuq moeuerequ moeueeqru moeueequr moeueerqu moeueeruq moeueeurq moeueeuqr moeueuqer moeueuqre moeueueqr
moeueuerq moeueureq moeueurqe moeuequer moeuequre moeueqeur moeueqeru moeueqreu moeueqrue moeueequr moeueeqru
moeueeuqr moeueeurq moeueeruq moeueerqu moeuerqeu moeuerque moeuerequ moeuereuq moeuerueq moeueruqe moeeruque
moeeruqeu moeeruuqe moeeruueq moeerueuq moeeruequ moeerquue moeerqueu moeerquue moeerqueu moeerqeuu moeerqeuu
moeeruque moeeruqeu moeeruuqe moeeruueq moeerueuq moeeruequ moeerequu moeerequu moeereuqu moeereuuq moeereuuq
moeereuqu moeeurque moeeurqeu moeeuruqe moeeurueq moeeureuq moeeurequ moeeuqrue moeeuqreu moeeuqure moeeuquer
moeeuqeur moeeuqeru moeeuuqre moeeuuqer moeeuurqe moeeuureq moeeuuerq moeeuueqr moeeuequr moeeueqru moeeueuqr
moeeueurq moeeueruq moeeuerqu moeequrue moeequreu moeequure moeequuer moeequeur moeequeru moeeqruue moeeqrueu
moeeqruue moeeqrueu moeeqreuu moeeqreuu moeequrue moeequreu moeequure moeequuer moeequeur moeequeru moeeqeruu
moeeqeruu moeeqeuru moeeqeuur moeeqeuur moeeqeuru moeeuuqre moeeuuqer moeeuurqe moeeuureq moeeuuerq moeeuueqr
moeeuqure moeeuquer moeeuqrue moeeuqreu moeeuqeru moeeuqeur moeeurque moeeurqeu moeeuruqe moeeurueq moeeureuq
moeeurequ moeeueqru moeeuequr moeeuerqu moeeueruq moeeueurq moeeueuqr moeeeuqur moeeeuqru moeeeuuqr moeeeuurq
moeeeuruq moeeeurqu moeeequur moeeequru moeeequur moeeequru moeeeqruu moeeeqruu moeeeuqur moeeeuqru moeeeuuqr
moeeeuurq moeeeuruq moeeeurqu moeeerquu moeeerquu moeeeruqu moeeeruuq moeeeruuq moeeeruqu moqereuue moqereueu
moqereuue moqereueu moqereeuu moqereeuu moqerueue moqerueeu moqeruuee moqeruuee moqerueue moqerueeu moqeruuee
moqeruuee moqerueue moqerueeu moqerueeu moqerueue moqereuue moqereueu moqereuue moqereueu moqereeuu moqereeuu
moqeeruue moqeerueu moqeeruue moqeerueu moqeereuu moqeereuu moqeeurue moqeeureu moqeeuure moqeeuuer moqeeueur
moqeeueru moqeeuure moqeeuuer moqeeurue moqeeureu moqeeueru moqeeueur moqeeeuur moqeeeuru moqeeeuur moqeeeuru
moqeeeruu moqeeeruu moqeuerue moqeuereu moqeueure moqeueuer moqeueeur moqeueeru moqeureue moqeureeu moqeuruee
moqeuruee moqeureue moqeureeu moqeuuree moqeuuree moqeuuere moqeuueer moqeuueer moqeuuere moqeuerue moqeuereu
moqeueure moqeueuer moqeueeur moqeueeru moqeueure moqeueuer moqeuerue moqeuereu moqeueeru moqeueeur moqeuuere
moqeuueer moqeuuree moqeuuree moqeuuere moqeuueer moqeuruee moqeuruee moqeureue moqeureeu moqeureeu moqeureue
moqeueure moqeueuer moqeuerue moqeuereu moqeueeru moqeueeur moqeeeuur moqeeeuru moqeeeuur moqeeeuru moqeeeruu
moqeeeruu moqeeueur moqeeueru moqeeuuer moqeeuure moqeeurue moqeeureu moqeeuuer moqeeuure moqeeueur moqeeueru
moqeeureu moqeeurue moqeeruue moqeerueu moqeeruue moqeerueu moqeereuu moqeereuu moqreeuue moqreeueu moqreeuue
moqreeueu moqreeeuu moqreeeuu moqreueue moqreueeu moqreuuee moqreuuee moqreueue moqreueeu moqreuuee moqreuuee
moqreueue moqreueeu moqreueeu moqreueue moqreeuue moqreeueu moqreeuue moqreeueu moqreeeuu moqreeeuu moqreeuue
moqreeueu moqreeuue moqreeueu moqreeeuu moqreeeuu moqreueue moqreueeu moqreuuee moqreuuee moqreueue moqreueeu
moqreuuee moqreuuee moqreueue moqreueeu moqreueeu moqreueue moqreeuue moqreeueu moqreeuue moqreeueu moqreeeuu
moqreeeuu moqrueeue moqrueeeu moqrueuee moqrueuee moqrueeue moqrueeeu moqrueeue moqrueeeu moqrueuee moqrueuee
moqrueeue moqrueeeu moqruueee moqruueee moqruueee moqruueee moqruueee moqruueee moqrueeue moqrueeeu moqrueuee
moqrueuee moqrueeue moqrueeeu moqrueuee moqrueuee moqrueeue moqrueeeu moqrueeeu moqrueeue moqruueee moqruueee
moqruueee moqruueee moqruueee moqruueee moqrueuee moqrueuee moqrueeue moqrueeeu moqrueeeu moqrueeue moqrueuee
moqrueuee moqrueeue moqrueeeu moqrueeeu moqrueeue moqreeuue moqreeueu moqreeuue moqreeueu moqreeeuu moqreeeuu
moqreueue moqreueeu moqreuuee moqreuuee moqreueue moqreueeu moqreuuee moqreuuee moqreueue moqreueeu moqreueeu
moqreueue moqreeuue moqreeueu moqreeuue moqreeueu moqreeeuu moqreeeuu moqereuue moqereueu moqereuue moqereueu
moqereeuu moqereeuu moqerueue moqerueeu moqeruuee moqeruuee moqerueue moqerueeu moqeruuee moqeruuee moqerueue
moqerueeu moqerueeu moqerueue moqereuue moqereueu moqereuue moqereueu moqereeuu moqereeuu moqeeruue moqeerueu
moqeeruue moqeerueu moqeereuu moqeereuu moqeeurue moqeeureu moqeeuure moqeeuuer moqeeueur moqeeueru moqeeuure
moqeeuuer moqeeurue moqeeureu moqeeueru moqeeueur moqeeeuur moqeeeuru moqeeeuur moqeeeuru moqeeeruu moqeeeruu
moqeuerue moqeuereu moqeueure moqeueuer moqeueeur moqeueeru moqeureue moqeureeu moqeuruee moqeuruee moqeureue
moqeureeu moqeuuree moqeuuree moqeuuere moqeuueer moqeuueer moqeuuere moqeuerue moqeuereu moqeueure moqeueuer
moqeueeur moqeueeru moqeueure moqeueuer moqeuerue moqeuereu moqeueeru moqeueeur moqeuuere moqeuueer moqeuuree
moqeuuree moqeuuere moqeuueer moqeuruee moqeuruee moqeureue moqeureeu moqeureeu moqeureue moqeueure moqeueuer
moqeuerue moqeuereu moqeueeru moqeueeur moqeeeuur moqeeeuru moqeeeuur moqeeeuru moqeeeruu moqeeeruu moqeeueur
moqeeueru moqeeuuer moqeeuure moqeeurue moqeeureu moqeeuuer moqeeuure moqeeueur moqeeueru moqeeureu moqeeurue
moqeeruue moqeerueu moqeeruue moqeerueu moqeereuu moqeereuu moqureeue moqureeeu moqureuee moqureuee moqureeue
moqureeeu moqureeue moqureeeu moqureuee moqureuee moqureeue moqureeeu moqurueee moqurueee moqurueee moqurueee
moqurueee moqurueee moqureeue moqureeeu moqureuee moqureuee moqureeue moqureeeu moquereue moquereeu moqueruee
moqueruee moquereue moquereeu moqueerue moqueereu moqueeure moqueeuer moqueeeur moqueeeru moqueuere moqueueer
moqueuree moqueuree moqueuere moqueueer moqueeeur moqueeeru moqueeuer moqueeure moqueerue moqueereu moqueerue
moqueereu moqueeure moqueeuer moqueeeur moqueeeru moquereue moquereeu moqueruee moqueruee moquereue moquereeu
moqueuree moqueuree moqueuere moqueueer moqueueer moqueuere moqueerue moqueereu moqueeure moqueeuer moqueeeur
moqueeeru moquueere moquueeer moquueree moquueree moquueere moquueeer moquueere moquueeer moquueree moquueree
moquueere moquueeer moquureee moquureee moquureee moquureee moquureee moquureee moquueere moquueeer moquueree
moquueree moquueere moquueeer moqueeeur moqueeeru moqueeuer moqueeure moqueerue moqueereu moqueeeur moqueeeru
moqueeuer moqueeure moqueerue moqueereu moqueueer moqueuere moqueueer moqueuere moqueuree moqueuree moquereue
moquereeu moqueruee moqueruee moquereue moquereeu moqureuee moqureuee moqureeue moqureeeu moqureeeu moqureeue
moqurueee moqurueee moqurueee moqurueee moqurueee moqurueee moqureuee moqureuee moqureeue moqureeeu moqureeeu
moqureeue moqureuee moqureuee moqureeue moqureeeu moqureeeu moqureeue moqueruee moqueruee moquereue moquereeu
moquereeu moquereue moqueuree moqueuree moqueuere moqueueer moqueueer moqueuere moqueeure moqueeuer moqueerue
moqueereu moqueeeru moqueeeur moqueeuer moqueeure moqueeeur moqueeeru moqueereu moqueerue moquueree moquueree
moquueere moquueeer moquueeer moquueere moquureee moquureee moquureee moquureee moquureee moquureee moquueree
moquueree moquueere moquueeer moquueeer moquueere moquueree moquueree moquueere moquueeer moquueeer moquueere
moqueeure moqueeuer moqueerue moqueereu moqueeeru moqueeeur moqueuere moqueueer moqueuree moqueuree moqueuere
moqueueer moqueruee moqueruee moquereue moquereeu moquereeu moquereue moqueeure moqueeuer moqueerue moqueereu
moqueeeru moqueeeur moqueeuer moqueeure moqueeeur moqueeeru moqueereu moqueerue moqueueer moqueuere moqueueer
moqueuere moqueuree moqueuree moqueeuer moqueeure moqueeeur moqueeeru moqueereu moqueerue moqueruee moqueruee
moquereue moquereeu moquereeu moquereue moqereuue moqereueu moqereuue moqereueu moqereeuu moqereeuu moqerueue
moqerueeu moqeruuee moqeruuee moqerueue moqerueeu moqeruuee moqeruuee moqerueue moqerueeu moqerueeu moqerueue
moqereuue moqereueu moqereuue moqereueu moqereeuu moqereeuu moqeeruue moqeerueu moqeeruue moqeerueu moqeereuu
moqeereuu moqeeurue moqeeureu moqeeuure moqeeuuer moqeeueur moqeeueru moqeeuure moqeeuuer moqeeurue moqeeureu
moqeeueru moqeeueur moqeeeuur moqeeeuru moqeeeuur moqeeeuru moqeeeruu moqeeeruu moqeuerue moqeuereu moqeueure
moqeueuer moqeueeur moqeueeru moqeureue moqeureeu moqeuruee moqeuruee moqeureue moqeureeu moqeuuree moqeuuree
moqeuuere moqeuueer moqeuueer moqeuuere moqeuerue moqeuereu moqeueure moqeueuer moqeueeur moqeueeru moqeueure
moqeueuer moqeuerue moqeuereu moqeueeru moqeueeur moqeuuere moqeuueer moqeuuree moqeuuree moqeuuere moqeuueer
moqeuruee moqeuruee moqeureue moqeureeu moqeureeu moqeureue moqeueure moqeueuer moqeuerue moqeuereu moqeueeru
moqeueeur moqeeeuur moqeeeuru moqeeeuur moqeeeuru moqeeeruu moqeeeruu moqeeueur moqeeueru moqeeuuer moqeeuure
moqeeurue moqeeureu moqeeuuer moqeeuure moqeeueur moqeeueru moqeeureu moqeeurue moqeeruue moqeerueu moqeeruue
moqeerueu moqeereuu moqeereuu mouereque mouereqeu mouereuqe mouereueq mouereeuq mouereequ mouerqeue mouerqeeu
mouerquee mouerquee mouerqeue mouerqeeu moueruqee moueruqee mouerueqe mouerueeq mouerueeq mouerueqe mouereque
mouereqeu mouereuqe mouereueq mouereeuq mouereequ moueerque moueerqeu moueeruqe moueerueq moueereuq moueerequ
moueeqrue moueeqreu moueequre moueequer moueeqeur moueeqeru moueeuqre moueeuqer moueeurqe moueeureq moueeuerq
moueeueqr moueeequr moueeeqru moueeeuqr moueeeurq moueeeruq moueeerqu moueqerue moueqereu moueqeure moueqeuer
moueqeeur moueqeeru moueqreue moueqreeu moueqruee moueqruee moueqreue moueqreeu mouequree mouequree mouequere
mouequeer mouequeer mouequere moueqerue moueqereu moueqeure moueqeuer moueqeeur moueqeeru moueueqre moueueqer
moueuerqe moueuereq moueueerq moueueeqr moueuqere moueuqeer moueuqree moueuqree moueuqere moueuqeer moueurqee
moueurqee moueureqe moueureeq moueureeq moueureqe moueueqre moueueqer moueuerqe moueuereq moueueerq moueueeqr
moueeequr moueeeqru moueeeuqr moueeeurq moueeeruq moueeerqu moueeqeur moueeqeru moueequer moueequre moueeqrue
moueeqreu moueeuqer moueeuqre moueeueqr moueeuerq moueeureq moueeurqe moueerque moueerqeu moueeruqe moueerueq
moueereuq moueerequ moureeque moureeqeu moureeuqe moureeueq moureeeuq moureeequ moureqeue moureqeeu mourequee
mourequee moureqeue moureqeeu moureuqee moureuqee moureueqe moureueeq moureueeq moureueqe moureeque moureeqeu
moureeuqe moureeueq moureeeuq moureeequ moureeque moureeqeu moureeuqe moureeueq moureeeuq moureeequ moureqeue
moureqeeu mourequee mourequee moureqeue moureqeeu moureuqee moureuqee moureueqe moureueeq moureueeq moureueqe
moureeque moureeqeu moureeuqe moureeueq moureeeuq moureeequ mourqeeue mourqeeeu mourqeuee mourqeuee mourqeeue
mourqeeeu mourqeeue mourqeeeu mourqeuee mourqeuee mourqeeue mourqeeeu mourqueee mourqueee mourqueee mourqueee
mourqueee mourqueee mourqeeue mourqeeeu mourqeuee mourqeuee mourqeeue mourqeeeu mourueqee mourueqee mourueeqe
mourueeeq mourueeeq mourueeqe mouruqeee mouruqeee mouruqeee mouruqeee mouruqeee mouruqeee mourueqee mourueqee
mourueeqe mourueeeq mourueeeq mourueeqe mourueqee mourueqee mourueeqe mourueeeq mourueeeq mourueeqe moureeque
moureeqeu moureeuqe moureeueq moureeeuq moureeequ moureqeue moureqeeu mourequee mourequee moureqeue moureqeeu
moureuqee moureuqee moureueqe moureueeq moureueeq moureueqe moureeque moureeqeu moureeuqe moureeueq moureeeuq
moureeequ mouereque mouereqeu mouereuqe mouereueq mouereeuq mouereequ mouerqeue mouerqeeu mouerquee mouerquee
mouerqeue mouerqeeu moueruqee moueruqee mouerueqe mouerueeq mouerueeq mouerueqe mouereque mouereqeu mouereuqe
mouereueq mouereeuq mouereequ moueerque moueerqeu moueeruqe moueerueq moueereuq moueerequ moueeqrue moueeqreu
moueequre moueequer moueeqeur moueeqeru moueeuqre moueeuqer moueeurqe moueeureq moueeuerq moueeueqr moueeequr
moueeeqru moueeeuqr moueeeurq moueeeruq moueeerqu moueqerue moueqereu moueqeure moueqeuer moueqeeur moueqeeru
moueqreue moueqreeu moueqruee moueqruee moueqreue moueqreeu mouequree mouequree mouequere mouequeer mouequeer
mouequere moueqerue moueqereu moueqeure moueqeuer moueqeeur moueqeeru moueueqre moueueqer moueuerqe moueuereq
moueueerq moueueeqr moueuqere moueuqeer moueuqree moueuqree moueuqere moueuqeer moueurqee moueurqee moueureqe
moueureeq moueureeq moueureqe moueueqre moueueqer moueuerqe moueuereq moueueerq moueueeqr moueeequr moueeeqru
moueeeuqr moueeeurq moueeeruq moueeerqu moueeqeur moueeqeru moueequer moueequre moueeqrue moueeqreu moueeuqer
moueeuqre moueeueqr moueeuerq moueeureq moueeurqe moueerque moueerqeu moueeruqe moueerueq moueereuq moueerequ
mouqreeue mouqreeeu mouqreuee mouqreuee mouqreeue mouqreeeu mouqreeue mouqreeeu mouqreuee mouqreuee mouqreeue
mouqreeeu mouqrueee mouqrueee mouqrueee mouqrueee mouqrueee mouqrueee mouqreeue mouqreeeu mouqreuee mouqreuee
mouqreeue mouqreeeu mouqereue mouqereeu mouqeruee mouqeruee mouqereue mouqereeu mouqeerue mouqeereu mouqeeure
mouqeeuer mouqeeeur mouqeeeru mouqeuere mouqeueer mouqeuree mouqeuree mouqeuere mouqeueer mouqeeeur mouqeeeru
mouqeeuer mouqeeure mouqeerue mouqeereu mouqeerue mouqeereu mouqeeure mouqeeuer mouqeeeur mouqeeeru mouqereue
mouqereeu mouqeruee mouqeruee mouqereue mouqereeu mouqeuree mouqeuree mouqeuere mouqeueer mouqeueer mouqeuere
mouqeerue mouqeereu mouqeeure mouqeeuer mouqeeeur mouqeeeru mouqueere mouqueeer mouqueree mouqueree mouqueere
mouqueeer mouqueere mouqueeer mouqueree mouqueree mouqueere mouqueeer mouqureee mouqureee mouqureee mouqureee
mouqureee mouqureee mouqueere mouqueeer mouqueree mouqueree mouqueere mouqueeer mouqeeeur mouqeeeru mouqeeuer
mouqeeure mouqeerue mouqeereu mouqeeeur mouqeeeru mouqeeuer mouqeeure mouqeerue mouqeereu mouqeueer mouqeuere
mouqeueer mouqeuere mouqeuree mouqeuree mouqereue mouqereeu mouqeruee mouqeruee mouqereue mouqereeu mouureqee
mouureqee mouureeqe mouureeeq mouureeeq mouureeqe mouurqeee mouurqeee mouurqeee mouurqeee mouurqeee mouurqeee
mouureqee mouureqee mouureeqe mouureeeq mouureeeq mouureeqe mouureqee mouureqee mouureeqe mouureeeq mouureeeq
mouureeqe mouuerqee mouuerqee mouuereqe mouuereeq mouuereeq mouuereqe mouueqree mouueqree mouueqere mouueqeer
mouueqeer mouueqere mouueeqre mouueeqer mouueerqe mouueereq mouueeerq mouueeeqr mouueeqer mouueeqre mouueeeqr
mouueeerq mouueereq mouueerqe mouuqeree mouuqeree mouuqeere mouuqeeer mouuqeeer mouuqeere mouuqreee mouuqreee
mouuqreee mouuqreee mouuqreee mouuqreee mouuqeree mouuqeree mouuqeere mouuqeeer mouuqeeer mouuqeere mouuqeree
mouuqeree mouuqeere mouuqeeer mouuqeeer mouuqeere mouueeqre mouueeqer mouueerqe mouueereq mouueeerq mouueeeqr
mouueqere mouueqeer mouueqree mouueqree mouueqere mouueqeer mouuerqee mouuerqee mouuereqe mouuereeq mouuereeq
mouuereqe mouueeqre mouueeqer mouueerqe mouueereq mouueeerq mouueeeqr mouueeqer mouueeqre mouueeeqr mouueeerq
mouueereq mouueerqe mouueqeer mouueqere mouueqeer mouueqere mouueqree mouueqree mouueeqer mouueeqre mouueeeqr
mouueeerq mouueereq mouueerqe mouuerqee mouuerqee mouuereqe mouuereeq mouuereeq mouuereqe mouereque mouereqeu
mouereuqe mouereueq mouereeuq mouereequ mouerqeue mouerqeeu mouerquee mouerquee mouerqeue mouerqeeu moueruqee
moueruqee mouerueqe mouerueeq mouerueeq mouerueqe mouereque mouereqeu mouereuqe mouereueq mouereeuq mouereequ
moueerque moueerqeu moueeruqe moueerueq moueereuq moueerequ moueeqrue moueeqreu moueequre moueequer moueeqeur
moueeqeru moueeuqre moueeuqer moueeurqe moueeureq moueeuerq moueeueqr moueeequr moueeeqru moueeeuqr moueeeurq
moueeeruq moueeerqu moueqerue moueqereu moueqeure moueqeuer moueqeeur moueqeeru moueqreue moueqreeu moueqruee
moueqruee moueqreue moueqreeu mouequree mouequree mouequere mouequeer mouequeer mouequere moueqerue moueqereu
moueqeure moueqeuer moueqeeur moueqeeru moueueqre moueueqer moueuerqe moueuereq moueueerq moueueeqr moueuqere
moueuqeer moueuqree moueuqree moueuqere moueuqeer moueurqee moueurqee moueureqe moueureeq moueureeq moueureqe
moueueqre moueueqer moueuerqe moueuereq moueueerq moueueeqr moueeequr moueeeqru moueeeuqr moueeeurq moueeeruq
moueeerqu moueeqeur moueeqeru moueequer moueequre moueeqrue moueeqreu moueeuqer moueeuqre moueeueqr moueeuerq
moueeureq moueeurqe moueerque moueerqeu moueeruqe moueerueq moueereuq moueerequ moeerequu moeerequu moeereuqu
moeereuuq moeereuuq moeereuqu moeerqeuu moeerqeuu moeerqueu moeerquue moeerquue moeerqueu moeeruqeu moeeruque
moeeruequ moeerueuq moeeruueq moeeruuqe moeeruque moeeruqeu moeeruuqe moeeruueq moeerueuq moeeruequ moeeerquu
moeeerquu moeeeruqu moeeeruuq moeeeruuq moeeeruqu moeeeqruu moeeeqruu moeeequru moeeequur moeeequur moeeequru
moeeeuqru moeeeuqur moeeeurqu moeeeuruq moeeeuurq moeeeuuqr moeeeuqur moeeeuqru moeeeuuqr moeeeuurq moeeeuruq
moeeeurqu moeeqeruu moeeqeruu moeeqeuru moeeqeuur moeeqeuur moeeqeuru moeeqreuu moeeqreuu moeeqrueu moeeqruue
moeeqruue moeeqrueu moeequreu moeequrue moeequeru moeequeur moeequuer moeequure moeequrue moeequreu moeequure
moeequuer moeequeur moeequeru moeeueqru moeeuequr moeeuerqu moeeueruq moeeueurq moeeueuqr moeeuqeru moeeuqeur
moeeuqreu moeeuqrue moeeuqure moeeuquer moeeurqeu moeeurque moeeurequ moeeureuq moeeurueq moeeuruqe moeeuuqre
moeeuuqer moeeuurqe moeeuureq moeeuuerq moeeuueqr moeeuequr moeeueqru moeeueuqr moeeueurq moeeueruq moeeuerqu
moeeuqeur moeeuqeru moeeuquer moeeuqure moeeuqrue moeeuqreu moeeuuqer moeeuuqre moeeuueqr moeeuuerq moeeuureq
moeeuurqe moeeurque moeeurqeu moeeuruqe moeeurueq moeeureuq moeeurequ moereequu moereequu moereeuqu moereeuuq
moereeuuq moereeuqu moereqeuu moereqeuu moerequeu moerequue moerequue moerequeu moereuqeu moereuque moereuequ
moereueuq moereuueq moereuuqe moereuque moereuqeu moereuuqe moereuueq moereueuq moereuequ moereequu moereequu
moereeuqu moereeuuq moereeuuq moereeuqu moereqeuu moereqeuu moerequeu moerequue moerequue moerequeu moereuqeu
moereuque moereuequ moereueuq moereuueq moereuuqe moereuque moereuqeu moereuuqe moereuueq moereueuq moereuequ
moerqeeuu moerqeeuu moerqeueu moerqeuue moerqeuue moerqeueu moerqeeuu moerqeeuu moerqeueu moerqeuue moerqeuue
moerqeueu moerqueeu moerqueue moerqueeu moerqueue moerquuee moerquuee moerqueue moerqueeu moerquuee moerquuee
moerqueue moerqueeu moerueqeu moerueque moerueequ moerueeuq moerueueq moerueuqe moeruqeeu moeruqeue moeruqeeu
moeruqeue moeruquee moeruquee moerueqeu moerueque moerueequ moerueeuq moerueueq moerueuqe moeruuqee moeruuqee
moeruueqe moeruueeq moeruueeq moeruueqe moerueque moerueqeu moerueuqe moerueueq moerueeuq moerueequ moeruqeue
moeruqeeu moeruquee moeruquee moeruqeue moeruqeeu moeruuqee moeruuqee moeruueqe moeruueeq moeruueeq moeruueqe
moerueque moerueqeu moerueuqe moerueueq moerueeuq moerueequ moeerequu moeerequu moeereuqu moeereuuq moeereuuq
moeereuqu moeerqeuu moeerqeuu moeerqueu moeerquue moeerquue moeerqueu moeeruqeu moeeruque moeeruequ moeerueuq
moeeruueq moeeruuqe moeeruque moeeruqeu moeeruuqe moeeruueq moeerueuq moeeruequ moeeerquu moeeerquu moeeeruqu
moeeeruuq moeeeruuq moeeeruqu moeeeqruu moeeeqruu moeeequru moeeequur moeeequur moeeequru moeeeuqru moeeeuqur
moeeeurqu moeeeuruq moeeeuurq moeeeuuqr moeeeuqur moeeeuqru moeeeuuqr moeeeuurq moeeeuruq moeeeurqu moeeqeruu
moeeqeruu moeeqeuru moeeqeuur moeeqeuur moeeqeuru moeeqreuu moeeqreuu moeeqrueu moeeqruue moeeqruue moeeqrueu
moeequreu moeequrue moeequeru moeequeur moeequuer moeequure moeequrue moeequreu moeequure moeequuer moeequeur
moeequeru moeeueqru moeeuequr moeeuerqu moeeueruq moeeueurq moeeueuqr moeeuqeru moeeuqeur moeeuqreu moeeuqrue
moeeuqure moeeuquer moeeurqeu moeeurque moeeurequ moeeureuq moeeurueq moeeuruqe moeeuuqre moeeuuqer moeeuurqe
moeeuureq moeeuuerq moeeuueqr moeeuequr moeeueqru moeeueuqr moeeueurq moeeueruq moeeuerqu moeeuqeur moeeuqeru
moeeuquer moeeuqure moeeuqrue moeeuqreu moeeuuqer moeeuuqre moeeuueqr moeeuuerq moeeuureq moeeuurqe moeeurque
moeeurqeu moeeuruqe moeeurueq moeeureuq moeeurequ moeqreeuu moeqreeuu moeqreueu moeqreuue moeqreuue moeqreueu
moeqreeuu moeqreeuu moeqreueu moeqreuue moeqreuue moeqreueu moeqrueeu moeqrueue moeqrueeu moeqrueue moeqruuee
moeqruuee moeqrueue moeqrueeu moeqruuee moeqruuee moeqrueue moeqrueeu moeqereuu moeqereuu moeqerueu moeqeruue
moeqeruue moeqerueu moeqeeruu moeqeeruu moeqeeuru moeqeeuur moeqeeuur moeqeeuru moeqeueru moeqeueur moeqeureu
moeqeurue moeqeuure moeqeuuer moeqeueur moeqeueru moeqeuuer moeqeuure moeqeurue moeqeureu moeqeeruu moeqeeruu
moeqeeuru moeqeeuur moeqeeuur moeqeeuru moeqereuu moeqereuu moeqerueu moeqeruue moeqeruue moeqerueu moeqeureu
moeqeurue moeqeueru moeqeueur moeqeuuer moeqeuure moeqeurue moeqeureu moeqeuure moeqeuuer moeqeueur moeqeueru
moequeeru moequeeur moequereu moequerue moequeure moequeuer moequeeru moequeeur moequereu moequerue moequeure
moequeuer moequreeu moequreue moequreeu moequreue moequruee moequruee moequuere moequueer moequuree moequuree
moequuere moequueer moequeeur moequeeru moequeuer moequeure moequerue moequereu moequeeur moequeeru moequeuer
moequeure moequerue moequereu moequueer moequuere moequueer moequuere moequuree moequuree moequreue moequreeu
moequruee moequruee moequreue moequreeu moeureqeu moeureque moeureequ moeureeuq moeureueq moeureuqe moeurqeeu
moeurqeue moeurqeeu moeurqeue moeurquee moeurquee moeureqeu moeureque moeureequ moeureeuq moeureueq moeureuqe
moeuruqee moeuruqee moeurueqe moeurueeq moeurueeq moeurueqe moeuerqeu moeuerque moeuerequ moeuereuq moeuerueq
moeueruqe moeueqreu moeueqrue moeueqeru moeueqeur moeuequer moeuequre moeueeqru moeueequr moeueerqu moeueeruq
moeueeurq moeueeuqr moeueuqer moeueuqre moeueueqr moeueuerq moeueureq moeueurqe moeuqereu moeuqerue moeuqeeru
moeuqeeur moeuqeuer moeuqeure moeuqreeu moeuqreue moeuqreeu moeuqreue moeuqruee moeuqruee moeuqereu moeuqerue
moeuqeeru moeuqeeur moeuqeuer moeuqeure moeuquree moeuquree moeuquere moeuqueer moeuqueer moeuquere moeueeqru
moeueequr moeueerqu moeueeruq moeueeurq moeueeuqr moeueqeru moeueqeur moeueqreu moeueqrue moeuequre moeuequer
moeuerqeu moeuerque moeuerequ moeuereuq moeuerueq moeueruqe moeueuqre moeueuqer moeueurqe moeueureq moeueuerq
moeueueqr moeuueqer moeuueqre moeuueeqr moeuueerq moeuuereq moeuuerqe moeuuqeer moeuuqere moeuuqeer moeuuqere
moeuuqree moeuuqree moeuueqer moeuueqre moeuueeqr moeuueerq moeuuereq moeuuerqe moeuurqee moeuurqee moeuureqe
moeuureeq moeuureeq moeuureqe moeureque moeureqeu moeureuqe moeureueq moeureeuq moeureequ moeurqeue moeurqeeu
moeurquee moeurquee moeurqeue moeurqeeu moeuruqee moeuruqee moeurueqe moeurueeq moeurueeq moeurueqe moeureque
moeureqeu moeureuqe moeureueq moeureeuq moeureequ moeuerque moeuerqeu moeueruqe moeuerueq moeuereuq moeuerequ
moeueqrue moeueqreu moeuequre moeuequer moeueqeur moeueqeru moeueuqre moeueuqer moeueurqe moeueureq moeueuerq
moeueueqr moeueequr moeueeqru moeueeuqr moeueeurq moeueeruq moeueerqu moeuqerue moeuqereu moeuqeure moeuqeuer
moeuqeeur moeuqeeru moeuqreue moeuqreeu moeuqruee moeuqruee moeuqreue moeuqreeu moeuquree moeuquree moeuquere
moeuqueer moeuqueer moeuquere moeuqerue moeuqereu moeuqeure moeuqeuer moeuqeeur moeuqeeru moeuueqre moeuueqer
moeuuerqe moeuuereq moeuueerq moeuueeqr moeuuqere moeuuqeer moeuuqree moeuuqree moeuuqere moeuuqeer moeuurqee
moeuurqee moeuureqe moeuureeq moeuureeq moeuureqe moeuueqre moeuueqer moeuuerqe moeuuereq moeuueerq moeuueeqr
moeueequr moeueeqru moeueeuqr moeueeurq moeueeruq moeueerqu moeueqeur moeueqeru moeuequer moeuequre moeueqrue
moeueqreu moeueuqer moeueuqre moeueueqr moeueuerq moeueureq moeueurqe moeuerque moeuerqeu moeueruqe moeuerueq
moeuereuq moeuerequ

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us