easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

inyokern

counterplayer

transnaturation

intertouch

excussorum

lustraverimque

clippermills

undrab

terracewards

burkley

babeship

tavernwards

courval

osteostracan

gamera

arbitreris

continentis

dendrochronologist


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: manana
cipher variations:
nbobob ocpcpc pdqdqd qerere rfsfsf
sgtgtg thuhuh uivivi vjwjwj wkxkxk
xlylyl ymzmzm znanan aobobo bpcpcp
cqdqdq drerer esfsfs ftgtgt guhuhu
hviviv iwjwjw jxkxkx kylyly lzmzmz

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: manana
Cipher: nzmzmz

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: manana
Cipher: ABABB AAAAA ABBAA AAAAA ABBAA AAAAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: manana
cipher variations:
nboboblbobobjbobobhbobobfbobobdbobobzbobobxbobob
vbobobtbobobrbobobpbobobocpcpcmcpcpckcpcpcicpcpc
gcpcpcecpcpcacpcpcycpcpcwcpcpcucpcpcscpcpcqcpcpc
pdqdqdndqdqdldqdqdjdqdqdhdqdqdfdqdqdbdqdqdzdqdqd
xdqdqdvdqdqdtdqdqdrdqdqdqerereoereremererekerere
iereregererecerereaerereyererewerereuerereserere
rfsfsfpfsfsfnfsfsflfsfsfjfsfsfhfsfsfdfsfsfbfsfsf
zfsfsfxfsfsfvfsfsftfsfsfsgtgtgqgtgtgogtgtgmgtgtg
kgtgtgigtgtgegtgtgcgtgtgagtgtgygtgtgwgtgtgugtgtg
thuhuhrhuhuhphuhuhnhuhuhlhuhuhjhuhuhfhuhuhdhuhuh
bhuhuhzhuhuhxhuhuhvhuhuhuivivisiviviqivivioivivi
mivivikivivigivivieiviviciviviaiviviyiviviwivivi
vjwjwjtjwjwjrjwjwjpjwjwjnjwjwjljwjwjhjwjwjfjwjwj
djwjwjbjwjwjzjwjwjxjwjwjwkxkxkukxkxkskxkxkqkxkxk
okxkxkmkxkxkikxkxkgkxkxkekxkxkckxkxkakxkxkykxkxk
xlylylvlylyltlylylrlylylplylylnlylyljlylylhlylyl
flylyldlylylblylylzlylylymzmzmwmzmzmumzmzmsmzmzm
qmzmzmomzmzmkmzmzmimzmzmgmzmzmemzmzmcmzmzmamzmzm
znananxnananvnanantnananrnananpnananlnananjnanan
hnananfnanandnananbnananaoboboyobobowobobouobobo
soboboqobobomobobokoboboiobobogoboboeobobocobobo
bpcpcpzpcpcpxpcpcpvpcpcptpcpcprpcpcpnpcpcplpcpcp
jpcpcphpcpcpfpcpcpdpcpcpcqdqdqaqdqdqyqdqdqwqdqdq
uqdqdqsqdqdqoqdqdqmqdqdqkqdqdqiqdqdqgqdqdqeqdqdq
drererbrererzrererxrerervrerertrererprerernrerer
lrererjrererhrererfrereresfsfscsfsfsasfsfsysfsfs
wsfsfsusfsfsqsfsfsosfsfsmsfsfsksfsfsisfsfsgsfsfs
ftgtgtdtgtgtbtgtgtztgtgtxtgtgtvtgtgtrtgtgtptgtgt
ntgtgtltgtgtjtgtgthtgtgtguhuhueuhuhucuhuhuauhuhu
yuhuhuwuhuhusuhuhuquhuhuouhuhumuhuhukuhuhuiuhuhu
hvivivfvivivdvivivbvivivzvivivxvivivtvivivrviviv
pvivivnvivivlvivivjviviviwjwjwgwjwjwewjwjwcwjwjw
awjwjwywjwjwuwjwjwswjwjwqwjwjwowjwjwmwjwjwkwjwjw
jxkxkxhxkxkxfxkxkxdxkxkxbxkxkxzxkxkxvxkxkxtxkxkx
rxkxkxpxkxkxnxkxkxlxkxkxkylylyiylylygylylyeylyly
cylylyaylylywylylyuylylysylylyqylylyoylylymylyly
lzmzmzjzmzmzhzmzmzfzmzmzdzmzmzbzmzmzxzmzmzvzmzmz
tzmzmzrzmzmzpzmzmznzmzmzmananakananaiananaganana
eananacananayananawananauananasananaqananaoanana

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: manana
Cipher: znanan

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: manana
Cipher: 231133113311

Extended Methods:
Method #1

Plaintext: manana
method variations:
rfsfsfwlxlxlbqcqcqgvhvhv

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
m a n a n a 
2 1 3 1 3 1 
3 1 3 1 3 1 
They are then read out in rows:
213131313131
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: manana
Cipher: bccccc

Read more ...
Method #3

Plaintext: manana
method variations:
clclcf lclcfc clcfcl
lcfclc cfclcl fclclc

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: manana

all 720 cipher variations:
manana manaan mannaa mannaa manana manaan maanna maanan maanna maanan maaann
maaann manana manaan mannaa mannaa manana manaan maaann maaann maanan maanna
maanna maanan mnaana mnaaan mnanaa mnanaa mnaana mnaaan mnaana mnaaan mnanaa
mnanaa mnaana mnaaan mnnaaa mnnaaa mnnaaa mnnaaa mnnaaa mnnaaa mnaana mnaaan
mnanaa mnanaa mnaana mnaaan manana manaan mannaa mannaa manana manaan maanna
maanan maanna maanan maaann maaann manana manaan mannaa mannaa manana manaan
maaann maaann maanan maanna maanna maanan mnnaaa mnnaaa mnnaaa mnnaaa mnnaaa
mnnaaa mnanaa mnanaa mnaana mnaaan mnaaan mnaana mnaana mnaaan mnanaa mnanaa
mnaana mnaaan mnaaan mnaana mnaaan mnaana mnanaa mnanaa manana manaan mannaa
mannaa manana manaan maanna maanan maanna maanan maaann maaann manana manaan
mannaa mannaa manana manaan maaann maaann maanan maanna maanna maanan amnana
amnaan amnnaa amnnaa amnana amnaan amanna amanan amanna amanan amaann amaann
amnana amnaan amnnaa amnnaa amnana amnaan amaann amaann amanan amanna amanna
amanan anmana anmaan anmnaa anmnaa anmana anmaan anamna anaman ananma ananam
anaanm anaamn annama annaam annmaa annmaa annama annaam anaanm anaamn ananam
ananma anamna anaman aanmna aanman aannma aannam aananm aanamn aamnna aamnan
aamnna aamnan aamann aamann aanmna aanman aannma aannam aananm aanamn aaamnn
aaamnn aaanmn aaannm aaannm aaanmn annama annaam annmaa annmaa annama annaam
ananma ananam anamna anaman anaamn anaanm anmana anmaan anmnaa anmnaa anmana
anmaan anaamn anaanm anaman anamna ananma ananam aananm aanamn aannam aannma
aanmna aanman aaannm aaanmn aaannm aaanmn aaamnn aaamnn aananm aanamn aannam
aannma aanmna aanman aamann aamann aamnan aamnna aamnna aamnan namana namaan
namnaa namnaa namana namaan naamna naaman naanma naanam naaanm naaamn nanama
nanaam nanmaa nanmaa nanama nanaam naaanm naaamn naanam naanma naamna naaman
nmaana nmaaan nmanaa nmanaa nmaana nmaaan nmaana nmaaan nmanaa nmanaa nmaana
nmaaan nmnaaa nmnaaa nmnaaa nmnaaa nmnaaa nmnaaa nmaana nmaaan nmanaa nmanaa
nmaana nmaaan namana namaan namnaa namnaa namana namaan naamna naaman naanma
naanam naaanm naaamn nanama nanaam nanmaa nanmaa nanama nanaam naaanm naaamn
naanam naanma naamna naaman nnmaaa nnmaaa nnmaaa nnmaaa nnmaaa nnmaaa nnamaa
nnamaa nnaama nnaaam nnaaam nnaama nnaama nnaaam nnamaa nnamaa nnaama nnaaam
nnaaam nnaama nnaaam nnaama nnamaa nnamaa namana namaan namnaa namnaa namana
namaan naamna naaman naanma naanam naaanm naaamn nanama nanaam nanmaa nanmaa
nanama nanaam naaanm naaamn naanam naanma naamna naaman aanmna aanman aannma
aannam aananm aanamn aamnna aamnan aamnna aamnan aamann aamann aanmna aanman
aannma aannam aananm aanamn aaamnn aaamnn aaanmn aaannm aaannm aaanmn anamna
anaman ananma ananam anaanm anaamn anmana anmaan anmnaa anmnaa anmana anmaan
annmaa annmaa annama annaam annaam annama anamna anaman ananma ananam anaanm
anaamn amnana amnaan amnnaa amnnaa amnana amnaan amanna amanan amanna amanan
amaann amaann amnana amnaan amnnaa amnnaa amnana amnaan amaann amaann amanan
amanna amanna amanan annmaa annmaa annama annaam annaam annama anmnaa anmnaa
anmana anmaan anmaan anmana anamna anaman ananma ananam anaanm anaamn anaman
anamna anaamn anaanm ananam ananma aanmna aanman aannma aannam aananm aanamn
aamnna aamnan aamnna aamnan aamann aamann aanmna aanman aannma aannam aananm
aanamn aaamnn aaamnn aaanmn aaannm aaannm aaanmn nanama nanaam nanmaa nanmaa
nanama nanaam naanma naanam naamna naaman naaamn naaanm namana namaan namnaa
namnaa namana namaan naaamn naaanm naaman naamna naanma naanam nnaama nnaaam
nnamaa nnamaa nnaama nnaaam nnaama nnaaam nnamaa nnamaa nnaama nnaaam nnmaaa
nnmaaa nnmaaa nnmaaa nnmaaa nnmaaa nnaama nnaaam nnamaa nnamaa nnaama nnaaam
nanama nanaam nanmaa nanmaa nanama nanaam naanma naanam naamna naaman naaamn
naaanm namana namaan namnaa namnaa namana namaan naaamn naaanm naaman naamna
naanma naanam nmnaaa nmnaaa nmnaaa nmnaaa nmnaaa nmnaaa nmanaa nmanaa nmaana
nmaaan nmaaan nmaana nmaana nmaaan nmanaa nmanaa nmaana nmaaan nmaaan nmaana
nmaaan nmaana nmanaa nmanaa nanama nanaam nanmaa nanmaa nanama nanaam naanma
naanam naamna naaman naaamn naaanm namana namaan namnaa namnaa namana namaan
naaamn naaanm naaman naamna naanma naanam aananm aanamn aannam aannma aanmna
aanman aaannm aaanmn aaannm aaanmn aaamnn aaamnn aananm aanamn aannam aannma
aanmna aanman aamann aamann aamnan aamnna aamnna aamnan anaanm anaamn ananam
ananma anamna anaman anaanm anaamn ananam ananma anamna anaman annaam annama
annaam annama annmaa annmaa anmana anmaan anmnaa anmnaa anmana anmaan aananm
aanamn aannam aannma aanmna aanman aaannm aaanmn aaannm aaanmn aaamnn aaamnn
aananm aanamn aannam aannma aanmna aanman aamann aamann aamnan aamnna aamnna
aamnan annaam annama annaam annama annmaa annmaa ananam ananma anaanm anaamn
anaman anamna anaanm anaamn ananam ananma anamna anaman anmaan anmana anmaan
anmana anmnaa anmnaa amnana amnaan amnnaa amnnaa amnana amnaan amanna amanan
amanna amanan amaann amaann amnana amnaan amnnaa amnnaa amnana amnaan amaann
amaann amanan amanna amanna amanan

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us