easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

effraction

spreadover

laventure

craniometrist

cockayne

comstar

lowville

probabilities

thalamically

nesquehoning

kleptomanist

brassylic

fibromyitis

sponsorial

aerate

mutualistic

quietaverimus

atloidoaxoid


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: majagga
cipher variations:
nbkbhhb oclciic pdmdjjd qenekke rfofllf
sgpgmmg thqhnnh uiriooi vjsjppj wktkqqk
xlulrrl ymvmssm znwnttn aoxouuo bpypvvp
cqzqwwq drarxxr esbsyys ftctzzt guduaau
hvevbbv iwfwccw jxgxddx kyhyeey lzizffz

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: majagga
Cipher: nzqzttz

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: majagga
Cipher: ABABB AAAAA BBBAA AAAAA AABBA AABBA AAAAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: majagga
cipher variations:
nbkbhhblbcbttbjbubffbhbmbrrbfbebddbdbwbppbzbgbnnbxbybzzb
vbqbllbtbibxxbrbabjjbpbsbvvboclciicmcdcuuckcvcggcicncssc
gcfceececxcqqcachcoocyczcaacwcrcmmcucjcyycscbckkcqctcwwc
pdmdjjdndedvvdldwdhhdjdodttdhdgdffdfdydrrdbdidppdzdadbbd
xdsdnndvdkdzzdtdcdlldrdudxxdqenekkeoefewwemexeiiekepeuue
ieheggegezessecejeqqeaebecceyeteooeweleaaeuedemmeseveyye
rfofllfpfgfxxfnfyfjjflfqfvvfjfifhhfhfafttfdfkfrrfbfcfddf
zfufppfxfmfbbfvfefnnftfwfzzfsgpgmmgqghgyygogzgkkgmgrgwwg
kgjgiigigbguugeglgssgcgdgeegagvgqqgygngccgwgfgoogugxgaag
thqhnnhrhihzzhphahllhnhshxxhlhkhjjhjhchvvhfhmhtthdhehffh
bhwhrrhzhohddhxhghpphvhyhbbhuiriooisijiaaiqibimmioitiyyi
milikkikidiwwiginiuuieifiggicixissiaipieeiyihiqqiwizicci
vjsjppjtjkjbbjrjcjnnjpjujzzjnjmjlljljejxxjhjojvvjfjgjhhj
djyjttjbjqjffjzjijrrjxjajddjwktkqqkuklkcckskdkookqkvkaak
oknkmmkmkfkyykikpkwwkgkhkiikekzkuukckrkggkakjksskykbkeek
xlulrrlvlmlddltlelpplrlwlbblplolnnlnlglzzljlqlxxlhliljjl
flalvvldlslhhlblklttlzlclfflymvmssmwmnmeemumfmqqmsmxmccm
qmpmoomomhmaamkmrmyymimjmkkmgmbmwwmemtmiimcmlmuumamdmggm
znwnttnxnonffnvngnrrntnynddnrnqnppnpninbbnlnsnzznjnknlln
hncnxxnfnunjjndnmnvvnbnenhhnaoxouuoyopoggowohossouozoeeo
soroqqoqojoccomotoaaokolommoiodoyyogovokkoeonowwocofoiio
bpypvvpzpqphhpxpipttpvpapffptpsprrprpkpddpnpupbbplpmpnnp
jpepzzphpwpllpfpopxxpdpgpjjpcqzqwwqaqrqiiqyqjquuqwqbqggq
uqtqssqsqlqeeqoqvqccqmqnqooqkqfqaaqiqxqmmqgqpqyyqeqhqkkq
drarxxrbrsrjjrzrkrvvrxrcrhhrvrurttrtrmrffrprwrddrnrorppr
lrgrbbrjryrnnrhrqrzzrfrirllresbsyyscstskksaslswwsysdsiis
wsvsuususnsggsqsxseesospsqqsmshsccskszsoosisrsaasgsjsmms
ftctzztdtutlltbtmtxxtztetjjtxtwtvvtvtothhtrtytfftptqtrrt
ntitddtltatpptjtstbbthtktnntguduaaueuvummucunuyyuaufukku
yuxuwwuwupuiiusuzugguqurussuoujueeumubuqqukutuccuiuluoou
hvevbbvfvwvnnvdvovzzvbvgvllvzvyvxxvxvqvjjvtvavhhvrvsvttv
pvkvffvnvcvrrvlvuvddvjvmvppviwfwccwgwxwoowewpwaawcwhwmmw
awzwyywywrwkkwuwbwiiwswtwuuwqwlwggwowdwsswmwvweewkwnwqqw
jxgxddxhxyxppxfxqxbbxdxixnnxbxaxzzxzxsxllxvxcxjjxtxuxvvx
rxmxhhxpxexttxnxwxffxlxoxrrxkyhyeeyiyzyqqygyryccyeyjyooy
cybyaayaytymmywydykkyuyvywwysynyiiyqyfyuuyoyxyggymypyssy
lzizffzjzazrrzhzszddzfzkzppzdzczbbzbzuznnzxzezllzvzwzxxz
tzozjjzrzgzvvzpzyzhhznzqzttzmajaggakabassaiataeeagalaqqa
eadaccacavaooayafammawaxayyauapakkasahawwaqazaiiaoarauua

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: majagga
Cipher: znwnttn

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: majagga
Cipher: 23114211222211

Extended Methods:
Method #1

Plaintext: majagga
method variations:
rfofmmfwltlrrlbqyqwwqgvdvbbv

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
m a j a g g a 
2 1 4 1 2 2 1 
3 1 2 1 2 2 1 
They are then read out in rows:
21412213121221
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: majagga
Cipher: bdglffb

Read more ...
Method #3

Plaintext: majagga
method variations:
cqbfgbf qbfgbfc bfgbfcq
fgbfcqb gbfcqbf bfcqbfg
fcqbfgb

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: majagga

all 5040 cipher variations:
majagga majagag majagga majagag majaagg majaagg majgaga majgaag majggaa majggaa majgaga
majgaag majggaa majggaa majgaga majgaag majgaag majgaga majagga majagag majagga majagag
majaagg majaagg maajgga maajgag maajgga maajgag maajagg maajagg maagjga maagjag maaggja
maaggaj maagagj maagajg maaggja maaggaj maagjga maagjag maagajg maagagj maaaggj maaagjg
maaaggj maaagjg maaajgg maaajgg magajga magajag magagja magagaj magaagj magaajg magjaga
magjaag magjgaa magjgaa magjaga magjaag maggjaa maggjaa maggaja maggaaj maggaaj maggaja
magajga magajag magagja magagaj magaagj magaajg magagja magagaj magajga magajag magaajg
magaagj maggaja maggaaj maggjaa maggjaa maggaja maggaaj magjgaa magjgaa magjaga magjaag
magjaag magjaga magagja magagaj magajga magajag magaajg magaagj maaaggj maaagjg maaaggj
maaagjg maaajgg maaajgg maagagj maagajg maaggaj maaggja maagjga maagjag maaggaj maaggja
maagagj maagajg maagjag maagjga maajgga maajgag maajgga maajgag maajagg maajagg mjaagga
mjaagag mjaagga mjaagag mjaaagg mjaaagg mjagaga mjagaag mjaggaa mjaggaa mjagaga mjagaag
mjaggaa mjaggaa mjagaga mjagaag mjagaag mjagaga mjaagga mjaagag mjaagga mjaagag mjaaagg
mjaaagg mjaagga mjaagag mjaagga mjaagag mjaaagg mjaaagg mjagaga mjagaag mjaggaa mjaggaa
mjagaga mjagaag mjaggaa mjaggaa mjagaga mjagaag mjagaag mjagaga mjaagga mjaagag mjaagga
mjaagag mjaaagg mjaaagg mjgaaga mjgaaag mjgagaa mjgagaa mjgaaga mjgaaag mjgaaga mjgaaag
mjgagaa mjgagaa mjgaaga mjgaaag mjggaaa mjggaaa mjggaaa mjggaaa mjggaaa mjggaaa mjgaaga
mjgaaag mjgagaa mjgagaa mjgaaga mjgaaag mjgagaa mjgagaa mjgaaga mjgaaag mjgaaag mjgaaga
mjggaaa mjggaaa mjggaaa mjggaaa mjggaaa mjggaaa mjgagaa mjgagaa mjgaaga mjgaaag mjgaaag
mjgaaga mjgagaa mjgagaa mjgaaga mjgaaag mjgaaag mjgaaga mjaagga mjaagag mjaagga mjaagag
mjaaagg mjaaagg mjagaga mjagaag mjaggaa mjaggaa mjagaga mjagaag mjaggaa mjaggaa mjagaga
mjagaag mjagaag mjagaga mjaagga mjaagag mjaagga mjaagag mjaaagg mjaaagg majagga majagag
majagga majagag majaagg majaagg majgaga majgaag majggaa majggaa majgaga majgaag majggaa
majggaa majgaga majgaag majgaag majgaga majagga majagag majagga majagag majaagg majaagg
maajgga maajgag maajgga maajgag maajagg maajagg maagjga maagjag maaggja maaggaj maagagj
maagajg maaggja maaggaj maagjga maagjag maagajg maagagj maaaggj maaagjg maaaggj maaagjg
maaajgg maaajgg magajga magajag magagja magagaj magaagj magaajg magjaga magjaag magjgaa
magjgaa magjaga magjaag maggjaa maggjaa maggaja maggaaj maggaaj maggaja magajga magajag
magagja magagaj magaagj magaajg magagja magagaj magajga magajag magaajg magaagj maggaja
maggaaj maggjaa maggjaa maggaja maggaaj magjgaa magjgaa magjaga magjaag magjaag magjaga
magagja magagaj magajga magajag magaajg magaagj maaaggj maaagjg maaaggj maaagjg maaajgg
maaajgg maagagj maagajg maaggaj maaggja maagjga maagjag maaggaj maaggja maagagj maagajg
maagjag maagjga maajgga maajgag maajgga maajgag maajagg maajagg mgjaaga mgjaaag mgjagaa
mgjagaa mgjaaga mgjaaag mgjaaga mgjaaag mgjagaa mgjagaa mgjaaga mgjaaag mgjgaaa mgjgaaa
mgjgaaa mgjgaaa mgjgaaa mgjgaaa mgjaaga mgjaaag mgjagaa mgjagaa mgjaaga mgjaaag mgajaga
mgajaag mgajgaa mgajgaa mgajaga mgajaag mgaajga mgaajag mgaagja mgaagaj mgaaagj mgaaajg
mgagaja mgagaaj mgagjaa mgagjaa mgagaja mgagaaj mgaaagj mgaaajg mgaagaj mgaagja mgaajga
mgaajag mgaajga mgaajag mgaagja mgaagaj mgaaagj mgaaajg mgajaga mgajaag mgajgaa mgajgaa
mgajaga mgajaag mgagjaa mgagjaa mgagaja mgagaaj mgagaaj mgagaja mgaajga mgaajag mgaagja
mgaagaj mgaaagj mgaaajg mggaaja mggaaaj mggajaa mggajaa mggaaja mggaaaj mggaaja mggaaaj
mggajaa mggajaa mggaaja mggaaaj mggjaaa mggjaaa mggjaaa mggjaaa mggjaaa mggjaaa mggaaja
mggaaaj mggajaa mggajaa mggaaja mggaaaj mgaaagj mgaaajg mgaagaj mgaagja mgaajga mgaajag
mgaaagj mgaaajg mgaagaj mgaagja mgaajga mgaajag mgagaaj mgagaja mgagaaj mgagaja mgagjaa
mgagjaa mgajaga mgajaag mgajgaa mgajgaa mgajaga mgajaag mgjagaa mgjagaa mgjaaga mgjaaag
mgjaaag mgjaaga mgjgaaa mgjgaaa mgjgaaa mgjgaaa mgjgaaa mgjgaaa mgjagaa mgjagaa mgjaaga
mgjaaag mgjaaag mgjaaga mgjagaa mgjagaa mgjaaga mgjaaag mgjaaag mgjaaga mgajgaa mgajgaa
mgajaga mgajaag mgajaag mgajaga mgagjaa mgagjaa mgagaja mgagaaj mgagaaj mgagaja mgaagja
mgaagaj mgaajga mgaajag mgaaajg mgaaagj mgaagaj mgaagja mgaaagj mgaaajg mgaajag mgaajga
mggajaa mggajaa mggaaja mggaaaj mggaaaj mggaaja mggjaaa mggjaaa mggjaaa mggjaaa mggjaaa
mggjaaa mggajaa mggajaa mggaaja mggaaaj mggaaaj mggaaja mggajaa mggajaa mggaaja mggaaaj
mggaaaj mggaaja mgaagja mgaagaj mgaajga mgaajag mgaaajg mgaaagj mgagaja mgagaaj mgagjaa
mgagjaa mgagaja mgagaaj mgajgaa mgajgaa mgajaga mgajaag mgajaag mgajaga mgaagja mgaagaj
mgaajga mgaajag mgaaajg mgaaagj mgaagaj mgaagja mgaaagj mgaaajg mgaajag mgaajga mgagaaj
mgagaja mgagaaj mgagaja mgagjaa mgagjaa mgaagaj mgaagja mgaaagj mgaaajg mgaajag mgaajga
mgajgaa mgajgaa mgajaga mgajaag mgajaag mgajaga majagga majagag majagga majagag majaagg
majaagg majgaga majgaag majggaa majggaa majgaga majgaag majggaa majggaa majgaga majgaag
majgaag majgaga majagga majagag majagga majagag majaagg majaagg maajgga maajgag maajgga
maajgag maajagg maajagg maagjga maagjag maaggja maaggaj maagagj maagajg maaggja maaggaj
maagjga maagjag maagajg maagagj maaaggj maaagjg maaaggj maaagjg maaajgg maaajgg magajga
magajag magagja magagaj magaagj magaajg magjaga magjaag magjgaa magjgaa magjaga magjaag
maggjaa maggjaa maggaja maggaaj maggaaj maggaja magajga magajag magagja magagaj magaagj
magaajg magagja magagaj magajga magajag magaajg magaagj maggaja maggaaj maggjaa maggjaa
maggaja maggaaj magjgaa magjgaa magjaga magjaag magjaag magjaga magagja magagaj magajga
magajag magaajg magaagj maaaggj maaagjg maaaggj maaagjg maaajgg maaajgg maagagj maagajg
maaggaj maaggja maagjga maagjag maaggaj maaggja maagagj maagajg maagjag maagjga maajgga
maajgag maajgga maajgag maajagg maajagg amjagga amjagag amjagga amjagag amjaagg amjaagg
amjgaga amjgaag amjggaa amjggaa amjgaga amjgaag amjggaa amjggaa amjgaga amjgaag amjgaag
amjgaga amjagga amjagag amjagga amjagag amjaagg amjaagg amajgga amajgag amajgga amajgag
amajagg amajagg amagjga amagjag amaggja amaggaj amagagj amagajg amaggja amaggaj amagjga
amagjag amagajg amagagj amaaggj amaagjg amaaggj amaagjg amaajgg amaajgg amgajga amgajag
amgagja amgagaj amgaagj amgaajg amgjaga amgjaag amgjgaa amgjgaa amgjaga amgjaag amggjaa
amggjaa amggaja amggaaj amggaaj amggaja amgajga amgajag amgagja amgagaj amgaagj amgaajg
amgagja amgagaj amgajga amgajag amgaajg amgaagj amggaja amggaaj amggjaa amggjaa amggaja
amggaaj amgjgaa amgjgaa amgjaga amgjaag amgjaag amgjaga amgagja amgagaj amgajga amgajag
amgaajg amgaagj amaaggj amaagjg amaaggj amaagjg amaajgg amaajgg amagagj amagajg amaggaj
amaggja amagjga amagjag amaggaj amaggja amagagj amagajg amagjag amagjga amajgga amajgag
amajgga amajgag amajagg amajagg ajmagga ajmagag ajmagga ajmagag ajmaagg ajmaagg ajmgaga
ajmgaag ajmggaa ajmggaa ajmgaga ajmgaag ajmggaa ajmggaa ajmgaga ajmgaag ajmgaag ajmgaga
ajmagga ajmagag ajmagga ajmagag ajmaagg ajmaagg ajamgga ajamgag ajamgga ajamgag ajamagg
ajamagg ajagmga ajagmag ajaggma ajaggam ajagagm ajagamg ajaggma ajaggam ajagmga ajagmag
ajagamg ajagagm ajaaggm ajaagmg ajaaggm ajaagmg ajaamgg ajaamgg ajgamga ajgamag ajgagma
ajgagam ajgaagm ajgaamg ajgmaga ajgmaag ajgmgaa ajgmgaa ajgmaga ajgmaag ajggmaa ajggmaa
ajggama ajggaam ajggaam ajggama ajgamga ajgamag ajgagma ajgagam ajgaagm ajgaamg ajgagma
ajgagam ajgamga ajgamag ajgaamg ajgaagm ajggama ajggaam ajggmaa ajggmaa ajggama ajggaam
ajgmgaa ajgmgaa ajgmaga ajgmaag ajgmaag ajgmaga ajgagma ajgagam ajgamga ajgamag ajgaamg
ajgaagm ajaaggm ajaagmg ajaaggm ajaagmg ajaamgg ajaamgg ajagagm ajagamg ajaggam ajaggma
ajagmga ajagmag ajaggam ajaggma ajagagm ajagamg ajagmag ajagmga ajamgga ajamgag ajamgga
ajamgag ajamagg ajamagg aajmgga aajmgag aajmgga aajmgag aajmagg aajmagg aajgmga aajgmag
aajggma aajggam aajgagm aajgamg aajggma aajggam aajgmga aajgmag aajgamg aajgagm aajaggm
aajagmg aajaggm aajagmg aajamgg aajamgg aamjgga aamjgag aamjgga aamjgag aamjagg aamjagg
aamgjga aamgjag aamggja aamggaj aamgagj aamgajg aamggja aamggaj aamgjga aamgjag aamgajg
aamgagj aamaggj aamagjg aamaggj aamagjg aamajgg aamajgg aagmjga aagmjag aagmgja aagmgaj
aagmagj aagmajg aagjmga aagjmag aagjgma aagjgam aagjagm aagjamg aaggjma aaggjam aaggmja
aaggmaj aaggamj aaggajm aagajgm aagajmg aagagjm aagagmj aagamgj aagamjg aagmgja aagmgaj
aagmjga aagmjag aagmajg aagmagj aaggmja aaggmaj aaggjma aaggjam aaggajm aaggamj aagjgma
aagjgam aagjmga aagjmag aagjamg aagjagm aagagjm aagagmj aagajgm aagajmg aagamjg aagamgj
aaamggj aaamgjg aaamggj aaamgjg aaamjgg aaamjgg aaagmgj aaagmjg aaaggmj aaaggjm aaagjgm
aaagjmg aaaggmj aaaggjm aaagmgj aaagmjg aaagjmg aaagjgm aaajggm aaajgmg aaajggm aaajgmg
aaajmgg aaajmgg agjamga agjamag agjagma agjagam agjaagm agjaamg agjmaga agjmaag agjmgaa
agjmgaa agjmaga agjmaag agjgmaa agjgmaa agjgama agjgaam agjgaam agjgama agjamga agjamag
agjagma agjagam agjaagm agjaamg agajmga agajmag agajgma agajgam agajagm agajamg agamjga
agamjag agamgja agamgaj agamagj agamajg agagmja agagmaj agagjma agagjam agagajm agagamj
agaamgj agaamjg agaagmj agaagjm agaajgm agaajmg agmajga agmajag agmagja agmagaj agmaagj
agmaajg agmjaga agmjaag agmjgaa agmjgaa agmjaga agmjaag agmgjaa agmgjaa agmgaja agmgaaj
agmgaaj agmgaja agmajga agmajag agmagja agmagaj agmaagj agmaajg aggamja aggamaj aggajma
aggajam aggaajm aggaamj aggmaja aggmaaj aggmjaa aggmjaa aggmaja aggmaaj aggjmaa aggjmaa
aggjama aggjaam aggjaam aggjama aggamja aggamaj aggajma aggajam aggaajm aggaamj agaamgj
agaamjg agaagmj agaagjm agaajgm agaajmg agamagj agamajg agamgaj agamgja agamjga agamjag
agagmaj agagmja agagamj agagajm agagjam agagjma agajmga agajmag agajgma agajgam agajagm
agajamg agjagma agjagam agjamga agjamag agjaamg agjaagm agjgama agjgaam agjgmaa agjgmaa
agjgama agjgaam agjmgaa agjmgaa agjmaga agjmaag agjmaag agjmaga agjagma agjagam agjamga
agjamag agjaamg agjaagm agajgma agajgam agajmga agajmag agajamg agajagm agagjma agagjam
agagmja agagmaj agagamj agagajm agamgja agamgaj agamjga agamjag agamajg agamagj agaagmj
agaagjm agaamgj agaamjg agaajmg agaajgm aggajma aggajam aggamja aggamaj aggaamj aggaajm
aggjama aggjaam aggjmaa aggjmaa aggjama aggjaam aggmjaa aggmjaa aggmaja aggmaaj aggmaaj
aggmaja aggajma aggajam aggamja aggamaj aggaamj aggaajm agmagja agmagaj agmajga agmajag
agmaajg agmaagj agmgaja agmgaaj agmgjaa agmgjaa agmgaja agmgaaj agmjgaa agmjgaa agmjaga
agmjaag agmjaag agmjaga agmagja agmagaj agmajga agmajag agmaajg agmaagj agaagmj agaagjm
agaamgj agaamjg agaajmg agaajgm agagamj agagajm agagmaj agagmja agagjma agagjam agamgaj
agamgja agamagj agamajg agamjag agamjga agajgma agajgam agajmga agajmag agajamg agajagm
aajaggm aajagmg aajaggm aajagmg aajamgg aajamgg aajgagm aajgamg aajggam aajggma aajgmga
aajgmag aajggam aajggma aajgagm aajgamg aajgmag aajgmga aajmgga aajmgag aajmgga aajmgag
aajmagg aajmagg aaajggm aaajgmg aaajggm aaajgmg aaajmgg aaajmgg aaagjgm aaagjmg aaaggjm
aaaggmj aaagmgj aaagmjg aaaggjm aaaggmj aaagjgm aaagjmg aaagmjg aaagmgj aaamggj aaamgjg
aaamggj aaamgjg aaamjgg aaamjgg aagajgm aagajmg aagagjm aagagmj aagamgj aagamjg aagjagm
aagjamg aagjgam aagjgma aagjmga aagjmag aaggjam aaggjma aaggajm aaggamj aaggmaj aaggmja
aagmjga aagmjag aagmgja aagmgaj aagmagj aagmajg aagagjm aagagmj aagajgm aagajmg aagamjg
aagamgj aaggajm aaggamj aaggjam aaggjma aaggmja aaggmaj aagjgam aagjgma aagjagm aagjamg
aagjmag aagjmga aagmgja aagmgaj aagmjga aagmjag aagmajg aagmagj aamaggj aamagjg aamaggj
aamagjg aamajgg aamajgg aamgagj aamgajg aamggaj aamggja aamgjga aamgjag aamggaj aamggja
aamgagj aamgajg aamgjag aamgjga aamjgga aamjgag aamjgga aamjgag aamjagg aamjagg jamagga
jamagag jamagga jamagag jamaagg jamaagg jamgaga jamgaag jamggaa jamggaa jamgaga jamgaag
jamggaa jamggaa jamgaga jamgaag jamgaag jamgaga jamagga jamagag jamagga jamagag jamaagg
jamaagg jaamgga jaamgag jaamgga jaamgag jaamagg jaamagg jaagmga jaagmag jaaggma jaaggam
jaagagm jaagamg jaaggma jaaggam jaagmga jaagmag jaagamg jaagagm jaaaggm jaaagmg jaaaggm
jaaagmg jaaamgg jaaamgg jagamga jagamag jagagma jagagam jagaagm jagaamg jagmaga jagmaag
jagmgaa jagmgaa jagmaga jagmaag jaggmaa jaggmaa jaggama jaggaam jaggaam jaggama jagamga
jagamag jagagma jagagam jagaagm jagaamg jagagma jagagam jagamga jagamag jagaamg jagaagm
jaggama jaggaam jaggmaa jaggmaa jaggama jaggaam jagmgaa jagmgaa jagmaga jagmaag jagmaag
jagmaga jagagma jagagam jagamga jagamag jagaamg jagaagm jaaaggm jaaagmg jaaaggm jaaagmg
jaaamgg jaaamgg jaagagm jaagamg jaaggam jaaggma jaagmga jaagmag jaaggam jaaggma jaagagm
jaagamg jaagmag jaagmga jaamgga jaamgag jaamgga jaamgag jaamagg jaamagg jmaagga jmaagag
jmaagga jmaagag jmaaagg jmaaagg jmagaga jmagaag jmaggaa jmaggaa jmagaga jmagaag jmaggaa
jmaggaa jmagaga jmagaag jmagaag jmagaga jmaagga jmaagag jmaagga jmaagag jmaaagg jmaaagg
jmaagga jmaagag jmaagga jmaagag jmaaagg jmaaagg jmagaga jmagaag jmaggaa jmaggaa jmagaga
jmagaag jmaggaa jmaggaa jmagaga jmagaag jmagaag jmagaga jmaagga jmaagag jmaagga jmaagag
jmaaagg jmaaagg jmgaaga jmgaaag jmgagaa jmgagaa jmgaaga jmgaaag jmgaaga jmgaaag jmgagaa
jmgagaa jmgaaga jmgaaag jmggaaa jmggaaa jmggaaa jmggaaa jmggaaa jmggaaa jmgaaga jmgaaag
jmgagaa jmgagaa jmgaaga jmgaaag jmgagaa jmgagaa jmgaaga jmgaaag jmgaaag jmgaaga jmggaaa
jmggaaa jmggaaa jmggaaa jmggaaa jmggaaa jmgagaa jmgagaa jmgaaga jmgaaag jmgaaag jmgaaga
jmgagaa jmgagaa jmgaaga jmgaaag jmgaaag jmgaaga jmaagga jmaagag jmaagga jmaagag jmaaagg
jmaaagg jmagaga jmagaag jmaggaa jmaggaa jmagaga jmagaag jmaggaa jmaggaa jmagaga jmagaag
jmagaag jmagaga jmaagga jmaagag jmaagga jmaagag jmaaagg jmaaagg jamagga jamagag jamagga
jamagag jamaagg jamaagg jamgaga jamgaag jamggaa jamggaa jamgaga jamgaag jamggaa jamggaa
jamgaga jamgaag jamgaag jamgaga jamagga jamagag jamagga jamagag jamaagg jamaagg jaamgga
jaamgag jaamgga jaamgag jaamagg jaamagg jaagmga jaagmag jaaggma jaaggam jaagagm jaagamg
jaaggma jaaggam jaagmga jaagmag jaagamg jaagagm jaaaggm jaaagmg jaaaggm jaaagmg jaaamgg
jaaamgg jagamga jagamag jagagma jagagam jagaagm jagaamg jagmaga jagmaag jagmgaa jagmgaa
jagmaga jagmaag jaggmaa jaggmaa jaggama jaggaam jaggaam jaggama jagamga jagamag jagagma
jagagam jagaagm jagaamg jagagma jagagam jagamga jagamag jagaamg jagaagm jaggama jaggaam
jaggmaa jaggmaa jaggama jaggaam jagmgaa jagmgaa jagmaga jagmaag jagmaag jagmaga jagagma
jagagam jagamga jagamag jagaamg jagaagm jaaaggm jaaagmg jaaaggm jaaagmg jaaamgg jaaamgg
jaagagm jaagamg jaaggam jaaggma jaagmga jaagmag jaaggam jaaggma jaagagm jaagamg jaagmag
jaagmga jaamgga jaamgag jaamgga jaamgag jaamagg jaamagg jgmaaga jgmaaag jgmagaa jgmagaa
jgmaaga jgmaaag jgmaaga jgmaaag jgmagaa jgmagaa jgmaaga jgmaaag jgmgaaa jgmgaaa jgmgaaa
jgmgaaa jgmgaaa jgmgaaa jgmaaga jgmaaag jgmagaa jgmagaa jgmaaga jgmaaag jgamaga jgamaag
jgamgaa jgamgaa jgamaga jgamaag jgaamga jgaamag jgaagma jgaagam jgaaagm jgaaamg jgagama
jgagaam jgagmaa jgagmaa jgagama jgagaam jgaaagm jgaaamg jgaagam jgaagma jgaamga jgaamag
jgaamga jgaamag jgaagma jgaagam jgaaagm jgaaamg jgamaga jgamaag jgamgaa jgamgaa jgamaga
jgamaag jgagmaa jgagmaa jgagama jgagaam jgagaam jgagama jgaamga jgaamag jgaagma jgaagam
jgaaagm jgaaamg jggaama jggaaam jggamaa jggamaa jggaama jggaaam jggaama jggaaam jggamaa
jggamaa jggaama jggaaam jggmaaa jggmaaa jggmaaa jggmaaa jggmaaa jggmaaa jggaama jggaaam
jggamaa jggamaa jggaama jggaaam jgaaagm jgaaamg jgaagam jgaagma jgaamga jgaamag jgaaagm
jgaaamg jgaagam jgaagma jgaamga jgaamag jgagaam jgagama jgagaam jgagama jgagmaa jgagmaa
jgamaga jgamaag jgamgaa jgamgaa jgamaga jgamaag jgmagaa jgmagaa jgmaaga jgmaaag jgmaaag
jgmaaga jgmgaaa jgmgaaa jgmgaaa jgmgaaa jgmgaaa jgmgaaa jgmagaa jgmagaa jgmaaga jgmaaag
jgmaaag jgmaaga jgmagaa jgmagaa jgmaaga jgmaaag jgmaaag jgmaaga jgamgaa jgamgaa jgamaga
jgamaag jgamaag jgamaga jgagmaa jgagmaa jgagama jgagaam jgagaam jgagama jgaagma jgaagam
jgaamga jgaamag jgaaamg jgaaagm jgaagam jgaagma jgaaagm jgaaamg jgaamag jgaamga jggamaa
jggamaa jggaama jggaaam jggaaam jggaama jggmaaa jggmaaa jggmaaa jggmaaa jggmaaa jggmaaa
jggamaa jggamaa jggaama jggaaam jggaaam jggaama jggamaa jggamaa jggaama jggaaam jggaaam
jggaama jgaagma jgaagam jgaamga jgaamag jgaaamg jgaaagm jgagama jgagaam jgagmaa jgagmaa
jgagama jgagaam jgamgaa jgamgaa jgamaga jgamaag jgamaag jgamaga jgaagma jgaagam jgaamga
jgaamag jgaaamg jgaaagm jgaagam jgaagma jgaaagm jgaaamg jgaamag jgaamga jgagaam jgagama
jgagaam jgagama jgagmaa jgagmaa jgaagam jgaagma jgaaagm jgaaamg jgaamag jgaamga jgamgaa
jgamgaa jgamaga jgamaag jgamaag jgamaga jamagga jamagag jamagga jamagag jamaagg jamaagg
jamgaga jamgaag jamggaa jamggaa jamgaga jamgaag jamggaa jamggaa jamgaga jamgaag jamgaag
jamgaga jamagga jamagag jamagga jamagag jamaagg jamaagg jaamgga jaamgag jaamgga jaamgag
jaamagg jaamagg jaagmga jaagmag jaaggma jaaggam jaagagm jaagamg jaaggma jaaggam jaagmga
jaagmag jaagamg jaagagm jaaaggm jaaagmg jaaaggm jaaagmg jaaamgg jaaamgg jagamga jagamag
jagagma jagagam jagaagm jagaamg jagmaga jagmaag jagmgaa jagmgaa jagmaga jagmaag jaggmaa
jaggmaa jaggama jaggaam jaggaam jaggama jagamga jagamag jagagma jagagam jagaagm jagaamg
jagagma jagagam jagamga jagamag jagaamg jagaagm jaggama jaggaam jaggmaa jaggmaa jaggama
jaggaam jagmgaa jagmgaa jagmaga jagmaag jagmaag jagmaga jagagma jagagam jagamga jagamag
jagaamg jagaagm jaaaggm jaaagmg jaaaggm jaaagmg jaaamgg jaaamgg jaagagm jaagamg jaaggam
jaaggma jaagmga jaagmag jaaggam jaaggma jaagagm jaagamg jaagmag jaagmga jaamgga jaamgag
jaamgga jaamgag jaamagg jaamagg aajmgga aajmgag aajmgga aajmgag aajmagg aajmagg aajgmga
aajgmag aajggma aajggam aajgagm aajgamg aajggma aajggam aajgmga aajgmag aajgamg aajgagm
aajaggm aajagmg aajaggm aajagmg aajamgg aajamgg aamjgga aamjgag aamjgga aamjgag aamjagg
aamjagg aamgjga aamgjag aamggja aamggaj aamgagj aamgajg aamggja aamggaj aamgjga aamgjag
aamgajg aamgagj aamaggj aamagjg aamaggj aamagjg aamajgg aamajgg aagmjga aagmjag aagmgja
aagmgaj aagmagj aagmajg aagjmga aagjmag aagjgma aagjgam aagjagm aagjamg aaggjma aaggjam
aaggmja aaggmaj aaggamj aaggajm aagajgm aagajmg aagagjm aagagmj aagamgj aagamjg aagmgja
aagmgaj aagmjga aagmjag aagmajg aagmagj aaggmja aaggmaj aaggjma aaggjam aaggajm aaggamj
aagjgma aagjgam aagjmga aagjmag aagjamg aagjagm aagagjm aagagmj aagajgm aagajmg aagamjg
aagamgj aaamggj aaamgjg aaamggj aaamgjg aaamjgg aaamjgg aaagmgj aaagmjg aaaggmj aaaggjm
aaagjgm aaagjmg aaaggmj aaaggjm aaagmgj aaagmjg aaagjmg aaagjgm aaajggm aaajgmg aaajggm
aaajgmg aaajmgg aaajmgg ajamgga ajamgag ajamgga ajamgag ajamagg ajamagg ajagmga ajagmag
ajaggma ajaggam ajagagm ajagamg ajaggma ajaggam ajagmga ajagmag ajagamg ajagagm ajaaggm
ajaagmg ajaaggm ajaagmg ajaamgg ajaamgg ajmagga ajmagag ajmagga ajmagag ajmaagg ajmaagg
ajmgaga ajmgaag ajmggaa ajmggaa ajmgaga ajmgaag ajmggaa ajmggaa ajmgaga ajmgaag ajmgaag
ajmgaga ajmagga ajmagag ajmagga ajmagag ajmaagg ajmaagg ajgmaga ajgmaag ajgmgaa ajgmgaa
ajgmaga ajgmaag ajgamga ajgamag ajgagma ajgagam ajgaagm ajgaamg ajggama ajggaam ajggmaa
ajggmaa ajggama ajggaam ajgaagm ajgaamg ajgagam ajgagma ajgamga ajgamag ajgmgaa ajgmgaa
ajgmaga ajgmaag ajgmaag ajgmaga ajggmaa ajggmaa ajggama ajggaam ajggaam ajggama ajgagma
ajgagam ajgamga ajgamag ajgaamg ajgaagm ajgagam ajgagma ajgaagm ajgaamg ajgamag ajgamga
ajamgga ajamgag ajamgga ajamgag ajamagg ajamagg ajagmga ajagmag ajaggma ajaggam ajagagm
ajagamg ajaggma ajaggam ajagmga ajagmag ajagamg ajagagm ajaaggm ajaagmg ajaaggm ajaagmg
ajaamgg ajaamgg amjagga amjagag amjagga amjagag amjaagg amjaagg amjgaga amjgaag amjggaa
amjggaa amjgaga amjgaag amjggaa amjggaa amjgaga amjgaag amjgaag amjgaga amjagga amjagag
amjagga amjagag amjaagg amjaagg amajgga amajgag amajgga amajgag amajagg amajagg amagjga
amagjag amaggja amaggaj amagagj amagajg amaggja amaggaj amagjga amagjag amagajg amagagj
amaaggj amaagjg amaaggj amaagjg amaajgg amaajgg amgajga amgajag amgagja amgagaj amgaagj
amgaajg amgjaga amgjaag amgjgaa amgjgaa amgjaga amgjaag amggjaa amggjaa amggaja amggaaj
amggaaj amggaja amgajga amgajag amgagja amgagaj amgaagj amgaajg amgagja amgagaj amgajga
amgajag amgaajg amgaagj amggaja amggaaj amggjaa amggjaa amggaja amggaaj amgjgaa amgjgaa
amgjaga amgjaag amgjaag amgjaga amgagja amgagaj amgajga amgajag amgaajg amgaagj amaaggj
amaagjg amaaggj amaagjg amaajgg amaajgg amagagj amagajg amaggaj amaggja amagjga amagjag
amaggaj amaggja amagagj amagajg amagjag amagjga amajgga amajgag amajgga amajgag amajagg
amajagg agjmaga agjmaag agjmgaa agjmgaa agjmaga agjmaag agjamga agjamag agjagma agjagam
agjaagm agjaamg agjgama agjgaam agjgmaa agjgmaa agjgama agjgaam agjaagm agjaamg agjagam
agjagma agjamga agjamag agmjaga agmjaag agmjgaa agmjgaa agmjaga agmjaag agmajga agmajag
agmagja agmagaj agmaagj agmaajg agmgaja agmgaaj agmgjaa agmgjaa agmgaja agmgaaj agmaagj
agmaajg agmagaj agmagja agmajga agmajag agamjga agamjag agamgja agamgaj agamagj agamajg
agajmga agajmag agajgma agajgam agajagm agajamg agagjma agagjam agagmja agagmaj agagamj
agagajm agaajgm agaajmg agaagjm agaagmj agaamgj agaamjg aggmaja aggmaaj aggmjaa aggmjaa
aggmaja aggmaaj aggamja aggamaj aggajma aggajam aggaajm aggaamj aggjama aggjaam aggjmaa
aggjmaa aggjama aggjaam aggaajm aggaamj aggajam aggajma aggamja aggamaj agamagj agamajg
agamgaj agamgja agamjga agamjag agaamgj agaamjg agaagmj agaagjm agaajgm agaajmg agagamj
agagajm agagmaj agagmja agagjma agagjam agajagm agajamg agajgam agajgma agajmga agajmag
agjmgaa agjmgaa agjmaga agjmaag agjmaag agjmaga agjgmaa agjgmaa agjgama agjgaam agjgaam
agjgama agjagma agjagam agjamga agjamag agjaamg agjaagm agjagam agjagma agjaagm agjaamg
agjamag agjamga agmjgaa agmjgaa agmjaga agmjaag agmjaag agmjaga agmgjaa agmgjaa agmgaja
agmgaaj agmgaaj agmgaja agmagja agmagaj agmajga agmajag agmaajg agmaagj agmagaj agmagja
agmaagj agmaajg agmajag agmajga aggmjaa aggmjaa aggmaja aggmaaj aggmaaj aggmaja aggjmaa
aggjmaa aggjama aggjaam aggjaam aggjama aggajma aggajam aggamja aggamaj aggaamj aggaajm
aggajam aggajma aggaajm aggaamj aggamaj aggamja agamgja agamgaj agamjga agamjag agamajg
agamagj agagmja agagmaj agagjma agagjam agagajm agagamj agajgma agajgam agajmga agajmag
agajamg agajagm agaagjm agaagmj agaajgm agaajmg agaamjg agaamgj agamgaj agamgja agamagj
agamajg agamjag agamjga agagmaj agagmja agagamj agagajm agagjam agagjma agaagmj agaagjm
agaamgj agaamjg agaajmg agaajgm agajgam agajgma agajagm agajamg agajmag agajmga aajmgga
aajmgag aajmgga aajmgag aajmagg aajmagg aajgmga aajgmag aajggma aajggam aajgagm aajgamg
aajggma aajggam aajgmga aajgmag aajgamg aajgagm aajaggm aajagmg aajaggm aajagmg aajamgg
aajamgg aamjgga aamjgag aamjgga aamjgag aamjagg aamjagg aamgjga aamgjag aamggja aamggaj
aamgagj aamgajg aamggja aamggaj aamgjga aamgjag aamgajg aamgagj aamaggj aamagjg aamaggj
aamagjg aamajgg aamajgg aagmjga aagmjag aagmgja aagmgaj aagmagj aagmajg aagjmga aagjmag
aagjgma aagjgam aagjagm aagjamg aaggjma aaggjam aaggmja aaggmaj aaggamj aaggajm aagajgm
aagajmg aagagjm aagagmj aagamgj aagamjg aagmgja aagmgaj aagmjga aagmjag aagmajg aagmagj
aaggmja aaggmaj aaggjma aaggjam aaggajm aaggamj aagjgma aagjgam aagjmga aagjmag aagjamg
aagjagm aagagjm aagagmj aagajgm aagajmg aagamjg aagamgj aaamggj aaamgjg aaamggj aaamgjg
aaamjgg aaamjgg aaagmgj aaagmjg aaaggmj aaaggjm aaagjgm aaagjmg aaaggmj aaaggjm aaagmgj
aaagmjg aaagjmg aaagjgm aaajggm aaajgmg aaajggm aaajgmg aaajmgg aaajmgg gajamga gajamag
gajagma gajagam gajaagm gajaamg gajmaga gajmaag gajmgaa gajmgaa gajmaga gajmaag gajgmaa
gajgmaa gajgama gajgaam gajgaam gajgama gajamga gajamag gajagma gajagam gajaagm gajaamg
gaajmga gaajmag gaajgma gaajgam gaajagm gaajamg gaamjga gaamjag gaamgja gaamgaj gaamagj
gaamajg gaagmja gaagmaj gaagjma gaagjam gaagajm gaagamj gaaamgj gaaamjg gaaagmj gaaagjm
gaaajgm gaaajmg gamajga gamajag gamagja gamagaj gamaagj gamaajg gamjaga gamjaag gamjgaa
gamjgaa gamjaga gamjaag gamgjaa gamgjaa gamgaja gamgaaj gamgaaj gamgaja gamajga gamajag
gamagja gamagaj gamaagj gamaajg gagamja gagamaj gagajma gagajam gagaajm gagaamj gagmaja
gagmaaj gagmjaa gagmjaa gagmaja gagmaaj gagjmaa gagjmaa gagjama gagjaam gagjaam gagjama
gagamja gagamaj gagajma gagajam gagaajm gagaamj gaaamgj gaaamjg gaaagmj gaaagjm gaaajgm
gaaajmg gaamagj gaamajg gaamgaj gaamgja gaamjga gaamjag gaagmaj gaagmja gaagamj gaagajm
gaagjam gaagjma gaajmga gaajmag gaajgma gaajgam gaajagm gaajamg gjaamga gjaamag gjaagma
gjaagam gjaaagm gjaaamg gjamaga gjamaag gjamgaa gjamgaa gjamaga gjamaag gjagmaa gjagmaa
gjagama gjagaam gjagaam gjagama gjaamga gjaamag gjaagma gjaagam gjaaagm gjaaamg gjaamga
gjaamag gjaagma gjaagam gjaaagm gjaaamg gjamaga gjamaag gjamgaa gjamgaa gjamaga gjamaag
gjagmaa gjagmaa gjagama gjagaam gjagaam gjagama gjaamga gjaamag gjaagma gjaagam gjaaagm
gjaaamg gjmaaga gjmaaag gjmagaa gjmagaa gjmaaga gjmaaag gjmaaga gjmaaag gjmagaa gjmagaa
gjmaaga gjmaaag gjmgaaa gjmgaaa gjmgaaa gjmgaaa gjmgaaa gjmgaaa gjmaaga gjmaaag gjmagaa
gjmagaa gjmaaga gjmaaag gjgamaa gjgamaa gjgaama gjgaaam gjgaaam gjgaama gjgmaaa gjgmaaa
gjgmaaa gjgmaaa gjgmaaa gjgmaaa gjgamaa gjgamaa gjgaama gjgaaam gjgaaam gjgaama gjgamaa
gjgamaa gjgaama gjgaaam gjgaaam gjgaama gjaamga gjaamag gjaagma gjaagam gjaaagm gjaaamg
gjamaga gjamaag gjamgaa gjamgaa gjamaga gjamaag gjagmaa gjagmaa gjagama gjagaam gjagaam
gjagama gjaamga gjaamag gjaagma gjaagam gjaaagm gjaaamg gajamga gajamag gajagma gajagam
gajaagm gajaamg gajmaga gajmaag gajmgaa gajmgaa gajmaga gajmaag gajgmaa gajgmaa gajgama
gajgaam gajgaam gajgama gajamga gajamag gajagma gajagam gajaagm gajaamg gaajmga gaajmag
gaajgma gaajgam gaajagm gaajamg gaamjga gaamjag gaamgja gaamgaj gaamagj gaamajg gaagmja
gaagmaj gaagjma gaagjam gaagajm gaagamj gaaamgj gaaamjg gaaagmj gaaagjm gaaajgm gaaajmg
gamajga gamajag gamagja gamagaj gamaagj gamaajg gamjaga gamjaag gamjgaa gamjgaa gamjaga
gamjaag gamgjaa gamgjaa gamgaja gamgaaj gamgaaj gamgaja gamajga gamajag gamagja gamagaj
gamaagj gamaajg gagamja gagamaj gagajma gagajam gagaajm gagaamj gagmaja gagmaaj gagmjaa
gagmjaa gagmaja gagmaaj gagjmaa gagjmaa gagjama gagjaam gagjaam gagjama gagamja gagamaj
gagajma gagajam gagaajm gagaamj gaaamgj gaaamjg gaaagmj gaaagjm gaaajgm gaaajmg gaamagj
gaamajg gaamgaj gaamgja gaamjga gaamjag gaagmaj gaagmja gaagamj gaagajm gaagjam gaagjma
gaajmga gaajmag gaajgma gaajgam gaajagm gaajamg gmjaaga gmjaaag gmjagaa gmjagaa gmjaaga
gmjaaag gmjaaga gmjaaag gmjagaa gmjagaa gmjaaga gmjaaag gmjgaaa gmjgaaa gmjgaaa gmjgaaa
gmjgaaa gmjgaaa gmjaaga gmjaaag gmjagaa gmjagaa gmjaaga gmjaaag gmajaga gmajaag gmajgaa
gmajgaa gmajaga gmajaag gmaajga gmaajag gmaagja gmaagaj gmaaagj gmaaajg gmagaja gmagaaj
gmagjaa gmagjaa gmagaja gmagaaj gmaaagj gmaaajg gmaagaj gmaagja gmaajga gmaajag gmaajga
gmaajag gmaagja gmaagaj gmaaagj gmaaajg gmajaga gmajaag gmajgaa gmajgaa gmajaga gmajaag
gmagjaa gmagjaa gmagaja gmagaaj gmagaaj gmagaja gmaajga gmaajag gmaagja gmaagaj gmaaagj
gmaaajg gmgaaja gmgaaaj gmgajaa gmgajaa gmgaaja gmgaaaj gmgaaja gmgaaaj gmgajaa gmgajaa
gmgaaja gmgaaaj gmgjaaa gmgjaaa gmgjaaa gmgjaaa gmgjaaa gmgjaaa gmgaaja gmgaaaj gmgajaa
gmgajaa gmgaaja gmgaaaj gmaaagj gmaaajg gmaagaj gmaagja gmaajga gmaajag gmaaagj gmaaajg
gmaagaj gmaagja gmaajga gmaajag gmagaaj gmagaja gmagaaj gmagaja gmagjaa gmagjaa gmajaga
gmajaag gmajgaa gmajgaa gmajaga gmajaag ggjamaa ggjamaa ggjaama ggjaaam ggjaaam ggjaama
ggjmaaa ggjmaaa ggjmaaa ggjmaaa ggjmaaa ggjmaaa ggjamaa ggjamaa ggjaama ggjaaam ggjaaam
ggjaama ggjamaa ggjamaa ggjaama ggjaaam ggjaaam ggjaama ggajmaa ggajmaa ggajama ggajaam
ggajaam ggajama ggamjaa ggamjaa ggamaja ggamaaj ggamaaj ggamaja ggaamja ggaamaj ggaajma
ggaajam ggaaajm ggaaamj ggaamaj ggaamja ggaaamj ggaaajm ggaajam ggaajma ggmajaa ggmajaa
ggmaaja ggmaaaj ggmaaaj ggmaaja ggmjaaa ggmjaaa ggmjaaa ggmjaaa ggmjaaa ggmjaaa ggmajaa
ggmajaa ggmaaja ggmaaaj ggmaaaj ggmaaja ggmajaa ggmajaa ggmaaja ggmaaaj ggmaaaj ggmaaja
ggaamja ggaamaj ggaajma ggaajam ggaaajm ggaaamj ggamaja ggamaaj ggamjaa ggamjaa ggamaja
ggamaaj ggajmaa ggajmaa ggajama ggajaam ggajaam ggajama ggaamja ggaamaj ggaajma ggaajam
ggaaajm ggaaamj ggaamaj ggaamja ggaaamj ggaaajm ggaajam ggaajma ggamaaj ggamaja ggamaaj
ggamaja ggamjaa ggamjaa ggaamaj ggaamja ggaaamj ggaaajm ggaajam ggaajma ggajmaa ggajmaa
ggajama ggajaam ggajaam ggajama gajamga gajamag gajagma gajagam gajaagm gajaamg gajmaga
gajmaag gajmgaa gajmgaa gajmaga gajmaag gajgmaa gajgmaa gajgama gajgaam gajgaam gajgama
gajamga gajamag gajagma gajagam gajaagm gajaamg gaajmga gaajmag gaajgma gaajgam gaajagm
gaajamg gaamjga gaamjag gaamgja gaamgaj gaamagj gaamajg gaagmja gaagmaj gaagjma gaagjam
gaagajm gaagamj gaaamgj gaaamjg gaaagmj gaaagjm gaaajgm gaaajmg gamajga gamajag gamagja
gamagaj gamaagj gamaajg gamjaga gamjaag gamjgaa gamjgaa gamjaga gamjaag gamgjaa gamgjaa
gamgaja gamgaaj gamgaaj gamgaja gamajga gamajag gamagja gamagaj gamaagj gamaajg gagamja
gagamaj gagajma gagajam gagaajm gagaamj gagmaja gagmaaj gagmjaa gagmjaa gagmaja gagmaaj
gagjmaa gagjmaa gagjama gagjaam gagjaam gagjama gagamja gagamaj gagajma gagajam gagaajm
gagaamj gaaamgj gaaamjg gaaagmj gaaagjm gaaajgm gaaajmg gaamagj gaamajg gaamgaj gaamgja
gaamjga gaamjag gaagmaj gaagmja gaagamj gaagajm gaagjam gaagjma gaajmga gaajmag gaajgma
gaajgam gaajagm gaajamg gajagma gajagam gajamga gajamag gajaamg gajaagm gajgama gajgaam
gajgmaa gajgmaa gajgama gajgaam gajmgaa gajmgaa gajmaga gajmaag gajmaag gajmaga gajagma
gajagam gajamga gajamag gajaamg gajaagm gaajgma gaajgam gaajmga gaajmag gaajamg gaajagm
gaagjma gaagjam gaagmja gaagmaj gaagamj gaagajm gaamgja gaamgaj gaamjga gaamjag gaamajg
gaamagj gaaagmj gaaagjm gaaamgj gaaamjg gaaajmg gaaajgm gagajma gagajam gagamja gagamaj
gagaamj gagaajm gagjama gagjaam gagjmaa gagjmaa gagjama gagjaam gagmjaa gagmjaa gagmaja
gagmaaj gagmaaj gagmaja gagajma gagajam gagamja gagamaj gagaamj gagaajm gamagja gamagaj
gamajga gamajag gamaajg gamaagj gamgaja gamgaaj gamgjaa gamgjaa gamgaja gamgaaj gamjgaa
gamjgaa gamjaga gamjaag gamjaag gamjaga gamagja gamagaj gamajga gamajag gamaajg gamaagj
gaaagmj gaaagjm gaaamgj gaaamjg gaaajmg gaaajgm gaagamj gaagajm gaagmaj gaagmja gaagjma
gaagjam gaamgaj gaamgja gaamagj gaamajg gaamjag gaamjga gaajgma gaajgam gaajmga gaajmag
gaajamg gaajagm gjaagma gjaagam gjaamga gjaamag gjaaamg gjaaagm gjagama gjagaam gjagmaa
gjagmaa gjagama gjagaam gjamgaa gjamgaa gjamaga gjamaag gjamaag gjamaga gjaagma gjaagam
gjaamga gjaamag gjaaamg gjaaagm gjaagma gjaagam gjaamga gjaamag gjaaamg gjaaagm gjagama
gjagaam gjagmaa gjagmaa gjagama gjagaam gjamgaa gjamgaa gjamaga gjamaag gjamaag gjamaga
gjaagma gjaagam gjaamga gjaamag gjaaamg gjaaagm gjgaama gjgaaam gjgamaa gjgamaa gjgaama
gjgaaam gjgaama gjgaaam gjgamaa gjgamaa gjgaama gjgaaam gjgmaaa gjgmaaa gjgmaaa gjgmaaa
gjgmaaa gjgmaaa gjgaama gjgaaam gjgamaa gjgamaa gjgaama gjgaaam gjmagaa gjmagaa gjmaaga
gjmaaag gjmaaag gjmaaga gjmgaaa gjmgaaa gjmgaaa gjmgaaa gjmgaaa gjmgaaa gjmagaa gjmagaa
gjmaaga gjmaaag gjmaaag gjmaaga gjmagaa gjmagaa gjmaaga gjmaaag gjmaaag gjmaaga gjaagma
gjaagam gjaamga gjaamag gjaaamg gjaaagm gjagama gjagaam gjagmaa gjagmaa gjagama gjagaam
gjamgaa gjamgaa gjamaga gjamaag gjamaag gjamaga gjaagma gjaagam gjaamga gjaamag gjaaamg
gjaaagm gajagma gajagam gajamga gajamag gajaamg gajaagm gajgama gajgaam gajgmaa gajgmaa
gajgama gajgaam gajmgaa gajmgaa gajmaga gajmaag gajmaag gajmaga gajagma gajagam gajamga
gajamag gajaamg gajaagm gaajgma gaajgam gaajmga gaajmag gaajamg gaajagm gaagjma gaagjam
gaagmja gaagmaj gaagamj gaagajm gaamgja gaamgaj gaamjga gaamjag gaamajg gaamagj gaaagmj
gaaagjm gaaamgj gaaamjg gaaajmg gaaajgm gagajma gagajam gagamja gagamaj gagaamj gagaajm
gagjama gagjaam gagjmaa gagjmaa gagjama gagjaam gagmjaa gagmjaa gagmaja gagmaaj gagmaaj
gagmaja gagajma gagajam gagamja gagamaj gagaamj gagaajm gamagja gamagaj gamajga gamajag
gamaajg gamaagj gamgaja gamgaaj gamgjaa gamgjaa gamgaja gamgaaj gamjgaa gamjgaa gamjaga
gamjaag gamjaag gamjaga gamagja gamagaj gamajga gamajag gamaajg gamaagj gaaagmj gaaagjm
gaaamgj gaaamjg gaaajmg gaaajgm gaagamj gaagajm gaagmaj gaagmja gaagjma gaagjam gaamgaj
gaamgja gaamagj gaamajg gaamjag gaamjga gaajgma gaajgam gaajmga gaajmag gaajamg gaajagm
ggjaama ggjaaam ggjamaa ggjamaa ggjaama ggjaaam ggjaama ggjaaam ggjamaa ggjamaa ggjaama
ggjaaam ggjmaaa ggjmaaa ggjmaaa ggjmaaa ggjmaaa ggjmaaa ggjaama ggjaaam ggjamaa ggjamaa
ggjaama ggjaaam ggajama ggajaam ggajmaa ggajmaa ggajama ggajaam ggaajma ggaajam ggaamja
ggaamaj ggaaamj ggaaajm ggamaja ggamaaj ggamjaa ggamjaa ggamaja ggamaaj ggaaamj ggaaajm
ggaamaj ggaamja ggaajma ggaajam ggaajma ggaajam ggaamja ggaamaj ggaaamj ggaaajm ggajama
ggajaam ggajmaa ggajmaa ggajama ggajaam ggamjaa ggamjaa ggamaja ggamaaj ggamaaj ggamaja
ggaajma ggaajam ggaamja ggaamaj ggaaamj ggaaajm ggmaaja ggmaaaj ggmajaa ggmajaa ggmaaja
ggmaaaj ggmaaja ggmaaaj ggmajaa ggmajaa ggmaaja ggmaaaj ggmjaaa ggmjaaa ggmjaaa ggmjaaa
ggmjaaa ggmjaaa ggmaaja ggmaaaj ggmajaa ggmajaa ggmaaja ggmaaaj ggaaamj ggaaajm ggaamaj
ggaamja ggaajma ggaajam ggaaamj ggaaajm ggaamaj ggaamja ggaajma ggaajam ggamaaj ggamaja
ggamaaj ggamaja ggamjaa ggamjaa ggajama ggajaam ggajmaa ggajmaa ggajama ggajaam gmjagaa
gmjagaa gmjaaga gmjaaag gmjaaag gmjaaga gmjgaaa gmjgaaa gmjgaaa gmjgaaa gmjgaaa gmjgaaa
gmjagaa gmjagaa gmjaaga gmjaaag gmjaaag gmjaaga gmjagaa gmjagaa gmjaaga gmjaaag gmjaaag
gmjaaga gmajgaa gmajgaa gmajaga gmajaag gmajaag gmajaga gmagjaa gmagjaa gmagaja gmagaaj
gmagaaj gmagaja gmaagja gmaagaj gmaajga gmaajag gmaaajg gmaaagj gmaagaj gmaagja gmaaagj
gmaaajg gmaajag gmaajga gmgajaa gmgajaa gmgaaja gmgaaaj gmgaaaj gmgaaja gmgjaaa gmgjaaa
gmgjaaa gmgjaaa gmgjaaa gmgjaaa gmgajaa gmgajaa gmgaaja gmgaaaj gmgaaaj gmgaaja gmgajaa
gmgajaa gmgaaja gmgaaaj gmgaaaj gmgaaja gmaagja gmaagaj gmaajga gmaajag gmaaajg gmaaagj
gmagaja gmagaaj gmagjaa gmagjaa gmagaja gmagaaj gmajgaa gmajgaa gmajaga gmajaag gmajaag
gmajaga gmaagja gmaagaj gmaajga gmaajag gmaaajg gmaaagj gmaagaj gmaagja gmaaagj gmaaajg
gmaajag gmaajga gmagaaj gmagaja gmagaaj gmagaja gmagjaa gmagjaa gmaagaj gmaagja gmaaagj
gmaaajg gmaajag gmaajga gmajgaa gmajgaa gmajaga gmajaag gmajaag gmajaga gajagma gajagam
gajamga gajamag gajaamg gajaagm gajgama gajgaam gajgmaa gajgmaa gajgama gajgaam gajmgaa
gajmgaa gajmaga gajmaag gajmaag gajmaga gajagma gajagam gajamga gajamag gajaamg gajaagm
gaajgma gaajgam gaajmga gaajmag gaajamg gaajagm gaagjma gaagjam gaagmja gaagmaj gaagamj
gaagajm gaamgja gaamgaj gaamjga gaamjag gaamajg gaamagj gaaagmj gaaagjm gaaamgj gaaamjg
gaaajmg gaaajgm gagajma gagajam gagamja gagamaj gagaamj gagaajm gagjama gagjaam gagjmaa
gagjmaa gagjama gagjaam gagmjaa gagmjaa gagmaja gagmaaj gagmaaj gagmaja gagajma gagajam
gagamja gagamaj gagaamj gagaajm gamagja gamagaj gamajga gamajag gamaajg gamaagj gamgaja
gamgaaj gamgjaa gamgjaa gamgaja gamgaaj gamjgaa gamjgaa gamjaga gamjaag gamjaag gamjaga
gamagja gamagaj gamajga gamajag gamaajg gamaagj gaaagmj gaaagjm gaaamgj gaaamjg gaaajmg
gaaajgm gaagamj gaagajm gaagmaj gaagmja gaagjma gaagjam gaamgaj gaamgja gaamagj gaamajg
gaamjag gaamjga gaajgma gaajgam gaajmga gaajmag gaajamg gaajagm aajaggm aajagmg aajaggm
aajagmg aajamgg aajamgg aajgagm aajgamg aajggam aajggma aajgmga aajgmag aajggam aajggma
aajgagm aajgamg aajgmag aajgmga aajmgga aajmgag aajmgga aajmgag aajmagg aajmagg aaajggm
aaajgmg aaajggm aaajgmg aaajmgg aaajmgg aaagjgm aaagjmg aaaggjm aaaggmj aaagmgj aaagmjg
aaaggjm aaaggmj aaagjgm aaagjmg aaagmjg aaagmgj aaamggj aaamgjg aaamggj aaamgjg aaamjgg
aaamjgg aagajgm aagajmg aagagjm aagagmj aagamgj aagamjg aagjagm aagjamg aagjgam aagjgma
aagjmga aagjmag aaggjam aaggjma aaggajm aaggamj aaggmaj aaggmja aagmjga aagmjag aagmgja
aagmgaj aagmagj aagmajg aagagjm aagagmj aagajgm aagajmg aagamjg aagamgj aaggajm aaggamj
aaggjam aaggjma aaggmja aaggmaj aagjgam aagjgma aagjagm aagjamg aagjmag aagjmga aagmgja
aagmgaj aagmjga aagmjag aagmajg aagmagj aamaggj aamagjg aamaggj aamagjg aamajgg aamajgg
aamgagj aamgajg aamggaj aamggja aamgjga aamgjag aamggaj aamggja aamgagj aamgajg aamgjag
aamgjga aamjgga aamjgag aamjgga aamjgag aamjagg aamjagg ajaaggm ajaagmg ajaaggm ajaagmg
ajaamgg ajaamgg ajagagm ajagamg ajaggam ajaggma ajagmga ajagmag ajaggam ajaggma ajagagm
ajagamg ajagmag ajagmga ajamgga ajamgag ajamgga ajamgag ajamagg ajamagg ajaaggm ajaagmg
ajaaggm ajaagmg ajaamgg ajaamgg ajagagm ajagamg ajaggam ajaggma ajagmga ajagmag ajaggam
ajaggma ajagagm ajagamg ajagmag ajagmga ajamgga ajamgag ajamgga ajamgag ajamagg ajamagg
ajgaagm ajgaamg ajgagam ajgagma ajgamga ajgamag ajgaagm ajgaamg ajgagam ajgagma ajgamga
ajgamag ajggaam ajggama ajggaam ajggama ajggmaa ajggmaa ajgmaga ajgmaag ajgmgaa ajgmgaa
ajgmaga ajgmaag ajgagam ajgagma ajgaagm ajgaamg ajgamag ajgamga ajggaam ajggama ajggaam
ajggama ajggmaa ajggmaa ajgagam ajgagma ajgaagm ajgaamg ajgamag ajgamga ajgmgaa ajgmgaa
ajgmaga ajgmaag ajgmaag ajgmaga ajmagga ajmagag ajmagga ajmagag ajmaagg ajmaagg ajmgaga
ajmgaag ajmggaa ajmggaa ajmgaga ajmgaag ajmggaa ajmggaa ajmgaga ajmgaag ajmgaag ajmgaga
ajmagga ajmagag ajmagga ajmagag ajmaagg ajmaagg aajaggm aajagmg aajaggm aajagmg aajamgg
aajamgg aajgagm aajgamg aajggam aajggma aajgmga aajgmag aajggam aajggma aajgagm aajgamg
aajgmag aajgmga aajmgga aajmgag aajmgga aajmgag aajmagg aajmagg aaajggm aaajgmg aaajggm
aaajgmg aaajmgg aaajmgg aaagjgm aaagjmg aaaggjm aaaggmj aaagmgj aaagmjg aaaggjm aaaggmj
aaagjgm aaagjmg aaagmjg aaagmgj aaamggj aaamgjg aaamggj aaamgjg aaamjgg aaamjgg aagajgm
aagajmg aagagjm aagagmj aagamgj aagamjg aagjagm aagjamg aagjgam aagjgma aagjmga aagjmag
aaggjam aaggjma aaggajm aaggamj aaggmaj aaggmja aagmjga aagmjag aagmgja aagmgaj aagmagj
aagmajg aagagjm aagagmj aagajgm aagajmg aagamjg aagamgj aaggajm aaggamj aaggjam aaggjma
aaggmja aaggmaj aagjgam aagjgma aagjagm aagjamg aagjmag aagjmga aagmgja aagmgaj aagmjga
aagmjag aagmajg aagmagj aamaggj aamagjg aamaggj aamagjg aamajgg aamajgg aamgagj aamgajg
aamggaj aamggja aamgjga aamgjag aamggaj aamggja aamgagj aamgajg aamgjag aamgjga aamjgga
aamjgag aamjgga aamjgag aamjagg aamjagg agjaagm agjaamg agjagam agjagma agjamga agjamag
agjaagm agjaamg agjagam agjagma agjamga agjamag agjgaam agjgama agjgaam agjgama agjgmaa
agjgmaa agjmaga agjmaag agjmgaa agjmgaa agjmaga agjmaag agajagm agajamg agajgam agajgma
agajmga agajmag agaajgm agaajmg agaagjm agaagmj agaamgj agaamjg agagajm agagamj agagjam
agagjma agagmja agagmaj agamagj agamajg agamgaj agamgja agamjga agamjag agaajgm agaajmg
agaagjm agaagmj agaamgj agaamjg agajagm agajamg agajgam agajgma agajmga agajmag agagjam
agagjma agagajm agagamj agagmaj agagmja agamjga agamjag agamgja agamgaj agamagj agamajg
aggaajm aggaamj aggajam aggajma aggamja aggamaj aggaajm aggaamj aggajam aggajma aggamja
aggamaj aggjaam aggjama aggjaam aggjama aggjmaa aggjmaa aggmaja aggmaaj aggmjaa aggmjaa
aggmaja aggmaaj agmaagj agmaajg agmagaj agmagja agmajga agmajag agmaagj agmaajg agmagaj
agmagja agmajga agmajag agmgaaj agmgaja agmgaaj agmgaja agmgjaa agmgjaa agmjaga agmjaag
agmjgaa agmjgaa agmjaga agmjaag agjagam agjagma agjaagm agjaamg agjamag agjamga agjgaam
agjgama agjgaam agjgama agjgmaa agjgmaa agjagam agjagma agjaagm agjaamg agjamag agjamga
agjmgaa agjmgaa agjmaga agjmaag agjmaag agjmaga agajgam agajgma agajagm agajamg agajmag
agajmga agagjam agagjma agagajm agagamj agagmaj agagmja agaagjm agaagmj agaajgm agaajmg
agaamjg agaamgj agamgaj agamgja agamagj agamajg agamjag agamjga aggajam aggajma aggaajm
aggaamj aggamaj aggamja aggjaam aggjama aggjaam aggjama aggjmaa aggjmaa aggajam aggajma
aggaajm aggaamj aggamaj aggamja aggmjaa aggmjaa aggmaja aggmaaj aggmaaj aggmaja agaagjm
agaagmj agaajgm agaajmg agaamjg agaamgj agagajm agagamj agagjam agagjma agagmja agagmaj
agajgam agajgma agajagm agajamg agajmag agajmga agamgja agamgaj agamjga agamjag agamajg
agamagj agmagaj agmagja agmaagj agmaajg agmajag agmajga agmgaaj agmgaja agmgaaj agmgaja
agmgjaa agmgjaa agmagaj agmagja agmaagj agmaajg agmajag agmajga agmjgaa agmjgaa agmjaga
agmjaag agmjaag agmjaga amjagga amjagag amjagga amjagag amjaagg amjaagg amjgaga amjgaag
amjggaa amjggaa amjgaga amjgaag amjggaa amjggaa amjgaga amjgaag amjgaag amjgaga amjagga
amjagag amjagga amjagag amjaagg amjaagg amajgga amajgag amajgga amajgag amajagg amajagg
amagjga amagjag amaggja amaggaj amagagj amagajg amaggja amaggaj amagjga amagjag amagajg
amagagj amaaggj amaagjg amaaggj amaagjg amaajgg amaajgg amgajga amgajag amgagja amgagaj
amgaagj amgaajg amgjaga amgjaag amgjgaa amgjgaa amgjaga amgjaag amggjaa amggjaa amggaja
amggaaj amggaaj amggaja amgajga amgajag amgagja amgagaj amgaagj amgaajg amgagja amgagaj
amgajga amgajag amgaajg amgaagj amggaja amggaaj amggjaa amggjaa amggaja amggaaj amgjgaa
amgjgaa amgjaga amgjaag amgjaag amgjaga amgagja amgagaj amgajga amgajag amgaajg amgaagj
amaaggj amaagjg amaaggj amaagjg amaajgg amaajgg amagagj amagajg amaggaj amaggja amagjga
amagjag amaggaj amaggja amagagj amagajg amagjag amagjga amajgga amajgag amajgga amajgag
amajagg amajagg

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us