easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

levamenque

mesitylene

baryecoia

defacingly

brabhm

immeshing

chaconne

photojournalists

embolomycotic

possets

harvestman

slevin

mirish

mcphaul

laetoque

chloropalladic

wanderoo

cooncan


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: macrae
cipher variations:
nbdsbf ocetcg pdfudh qegvei rfhwfj
sgixgk thjyhl uikzim vjlajn wkmbko
xlnclp ymodmq znpenr aoqfos bprgpt
cqshqu drtirv esujsw ftvktx guwluy
hvxmvz iwynwa jxzoxb kyapyc lzbqzd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: macrae
Cipher: nzxizv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: macrae
Cipher: ABABB AAAAA AAABA BAAAA AAAAA AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: macrae
cipher variations:
nbdsbflbhabnjblibvhbpqbdfbtybldbxgbtzbfwbjxbjebr
vbnmbztbrubhrbvcbppbzkbxocetcgmcibcokcmjcwicqrce
gcuzcmecyhcuacgxckyckfcswconcaucsvciscwdcqqcalcy
pdfudhndjcdpldnkdxjdrsdfhdvadnfdzidvbdhydlzdlgdt
xdpodbvdtwdjtdxedrrdbmdzqegveioekdeqmeoleykesteg
iewbeogeajewceizemaemheuyeqpecweuxekueyfessecnea
rfhwfjpflefrnfpmfzlftufhjfxcfphfbkfxdfjafnbfnifv
zfrqfdxfvyflvfzgfttfdofbsgixgkqgmfgsogqngamguvgi
kgydgqigclgyegkbgocgojgwagsrgeygwzgmwgahguugepgc
thjyhlrhnghtphrohbnhvwhjlhzehrjhdmhzfhlchpdhpkhx
bhtshfzhxahnxhbihvvhfqhduikzimsiohiuqispicoiwxik
miafiskieniagimdiqeiqliyciutigaiybioyicjiwwigrie
vjlajntjpijvrjtqjdpjxyjlnjbgjtljfojbhjnejrfjrmjz
djvujhbjzcjpzjdkjxxjhsjfwkmbkoukqjkwskurkeqkyzkm
okchkumkgpkcikofksgksnkaekwvkickadkqakelkyykitkg
xlnclpvlrklxtlvslfrlzalnpldilvnlhqldjlpglthltolb
flxwljdlbelrblfmlzzljulhymodmqwmslmyumwtmgsmabmo
qmejmwomirmekmqhmuimupmcgmyxmkemcfmscmgnmaamkvmi
znpenrxntmnzvnxunhtnbcnprnfknxpnjsnflnrinvjnvqnd
hnzynlfndgntdnhonbbnlwnjaoqfosyounoawoyvoiuocdoq
sogloyqoktogmosjowkowroeioazomgoehoueoipoccomxok
bprgptzpvopbxpzwpjvpdeprtphmpzrpluphnptkpxlpxspf
jpbapnhpfipvfpjqpddpnyplcqshquaqwpqcyqaxqkwqefqs
uqinqasqmvqioqulqymqytqgkqcbqoiqgjqwgqkrqeeqozqm
drtirvbrxqrdzrbyrlxrfgrtvrjorbtrnwrjprvmrznrzurh
lrdcrpjrhkrxhrlsrffrparnesujswcsyrseasczsmysghsu
wskpscusoxskqswnsaosavsimsedsqksilsyismtsggsqbso
ftvktxdtzstfbtdatnzthitvxtlqtdvtpytlrtxotbptbwtj
ntfetrltjmtzjtnuthhtrctpguwluyeuatugcuebuoauijuw
yumruewuqzumsuypucqucxukougfusmuknuakuovuiiusduq
hvxmvzfvbuvhdvfcvpbvjkvxzvnsvfxvravntvzqvdrvdyvl
pvhgvtnvlovblvpwvjjvtevriwynwagwcvwiewgdwqcwklwy
awotwgywsbwouwarweswezwmqwihwuowmpwcmwqxwkkwufws
jxzoxbhxdwxjfxhexrdxlmxzbxpuxhzxtcxpvxbsxftxfaxn
rxjixvpxnqxdnxryxllxvgxtkyapyciyexykgyifyseymnya
cyqvyiayudyqwyctyguygbyosykjywqyoryeoyszymmywhyu
lzbqzdjzfyzlhzjgztfznozbdzrwzjbzvezrxzduzhvzhczp
tzlkzxrzpszfpztaznnzxizvmacraekagzamiakhaugaopac
easxakcawfasyaevaiwaidaquamlaysaqtagqaubaooayjaw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: macrae
Cipher: znpenr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: macrae
Cipher: 231131241151

Extended Methods:
Method #1

Plaintext: macrae
method variations:
rfhwfkwlnblpbqsgqugvxmvz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
m a c r a e 
2 1 3 2 1 5 
3 1 1 4 1 1 
They are then read out in rows:
213215311411
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: macrae
Cipher: bhvcqa

Read more ...
Method #3

Plaintext: macrae
method variations:
clfdvf lfdvfc fdvfcl
dvfclf vfclfd fclfdv

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: macrae

all 720 cipher variations:
macrae macrea macare macaer macear macera marcae marcea marace maraec mareac
mareca maarce maarec maacre maacer maaecr maaerc maerac maerca maearc maeacr
maecar maecra mcarae mcarea mcaare mcaaer mcaear mcaera mcraae mcraea mcraae
mcraea mcreaa mcreaa mcarae mcarea mcaare mcaaer mcaear mcaera mceraa mceraa
mceara mceaar mceaar mceara mrcaae mrcaea mrcaae mrcaea mrceaa mrceaa mracae
mracea mraace mraaec mraeac mraeca mraace mraaec mracae mracea mraeca mraeac
mreaac mreaca mreaac mreaca mrecaa mrecaa macrae macrea macare macaer macear
macera marcae marcea marace maraec mareac mareca maarce maarec maacre maacer
maaecr maaerc maerac maerca maearc maeacr maecar maecra mecraa mecraa mecara
mecaar mecaar mecara mercaa mercaa meraca meraac meraac meraca mearca mearac
meacra meacar meaacr meaarc mearac mearca meaarc meaacr meacar meacra amcrae
amcrea amcare amcaer amcear amcera amrcae amrcea amrace amraec amreac amreca
amarce amarec amacre amacer amaecr amaerc amerac amerca amearc ameacr amecar
amecra acmrae acmrea acmare acmaer acmear acmera acrmae acrmea acrame acraem
acream acrema acarme acarem acamre acamer acaemr acaerm aceram acerma acearm
aceamr acemar acemra arcmae arcmea arcame arcaem arceam arcema armcae armcea
armace armaec armeac armeca aramce aramec aracme aracem araecm araemc aremac
aremca areamc areacm arecam arecma aacrme aacrem aacmre aacmer aacemr aacerm
aarcme aarcem aarmce aarmec aaremc aarecm aamrce aamrec aamcre aamcer aamecr
aamerc aaermc aaercm aaemrc aaemcr aaecmr aaecrm aecram aecrma aecarm aecamr
aecmar aecmra aercam aercma aeracm aeramc aermac aermca aearcm aearmc aeacrm
aeacmr aeamcr aeamrc aemrac aemrca aemarc aemacr aemcar aemcra camrae camrea
camare camaer camear camera carmae carmea carame caraem caream carema caarme
caarem caamre caamer caaemr caaerm caeram caerma caearm caeamr caemar caemra
cmarae cmarea cmaare cmaaer cmaear cmaera cmraae cmraea cmraae cmraea cmreaa
cmreaa cmarae cmarea cmaare cmaaer cmaear cmaera cmeraa cmeraa cmeara cmeaar
cmeaar cmeara crmaae crmaea crmaae crmaea crmeaa crmeaa cramae cramea craame
craaem craeam craema craame craaem cramae cramea craema craeam creaam creama
creaam creama cremaa cremaa camrae camrea camare camaer camear camera carmae
carmea carame caraem caream carema caarme caarem caamre caamer caaemr caaerm
caeram caerma caearm caeamr caemar caemra cemraa cemraa cemara cemaar cemaar
cemara cermaa cermaa cerama ceraam ceraam cerama cearma cearam ceamra ceamar
ceaamr ceaarm cearam cearma ceaarm ceaamr ceamar ceamra racmae racmea racame
racaem raceam racema ramcae ramcea ramace ramaec rameac rameca raamce raamec
raacme raacem raaecm raaemc raemac raemca raeamc raeacm raecam raecma rcamae
rcamea rcaame rcaaem rcaeam rcaema rcmaae rcmaea rcmaae rcmaea rcmeaa rcmeaa
rcamae rcamea rcaame rcaaem rcaeam rcaema rcemaa rcemaa rceama rceaam rceaam
rceama rmcaae rmcaea rmcaae rmcaea rmceaa rmceaa rmacae rmacea rmaace rmaaec
rmaeac rmaeca rmaace rmaaec rmacae rmacea rmaeca rmaeac rmeaac rmeaca rmeaac
rmeaca rmecaa rmecaa racmae racmea racame racaem raceam racema ramcae ramcea
ramace ramaec rameac rameca raamce raamec raacme raacem raaecm raaemc raemac
raemca raeamc raeacm raecam raecma recmaa recmaa recama recaam recaam recama
remcaa remcaa remaca remaac remaac remaca reamca reamac reacma reacam reaacm
reaamc reamac reamca reaamc reaacm reacam reacma aacrme aacrem aacmre aacmer
aacemr aacerm aarcme aarcem aarmce aarmec aaremc aarecm aamrce aamrec aamcre
aamcer aamecr aamerc aaermc aaercm aaemrc aaemcr aaecmr aaecrm acarme acarem
acamre acamer acaemr acaerm acrame acraem acrmae acrmea acrema acream acmrae
acmrea acmare acmaer acmear acmera acerma aceram acemra acemar aceamr acearm
arcame arcaem arcmae arcmea arcema arceam aracme aracem aramce aramec araemc
araecm armace armaec armcae armcea armeca armeac areamc areacm aremac aremca
arecma arecam amcrae amcrea amcare amcaer amcear amcera amrcae amrcea amrace
amraec amreac amreca amarce amarec amacre amacer amaecr amaerc amerac amerca
amearc ameacr amecar amecra aecrma aecram aecmra aecmar aecamr aecarm aercma
aercam aermca aermac aeramc aeracm aemrca aemrac aemcra aemcar aemacr aemarc
aearmc aearcm aeamrc aeamcr aeacmr aeacrm eacram eacrma eacarm eacamr eacmar
eacmra earcam earcma earacm earamc earmac earmca eaarcm eaarmc eaacrm eaacmr
eaamcr eaamrc eamrac eamrca eamarc eamacr eamcar eamcra ecaram ecarma ecaarm
ecaamr ecamar ecamra ecraam ecrama ecraam ecrama ecrmaa ecrmaa ecaram ecarma
ecaarm ecaamr ecamar ecamra ecmraa ecmraa ecmara ecmaar ecmaar ecmara ercaam
ercama ercaam ercama ercmaa ercmaa eracam eracma eraacm eraamc eramac eramca
eraacm eraamc eracam eracma eramca eramac ermaac ermaca ermaac ermaca ermcaa
ermcaa eacram eacrma eacarm eacamr eacmar eacmra earcam earcma earacm earamc
earmac earmca eaarcm eaarmc eaacrm eaacmr eaamcr eaamrc eamrac eamrca eamarc
eamacr eamcar eamcra emcraa emcraa emcara emcaar emcaar emcara emrcaa emrcaa
emraca emraac emraac emraca emarca emarac emacra emacar emaacr emaarc emarac
emarca emaarc emaacr emacar emacra

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us