easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

eyeberry

bacardi

rippet

alkamine

aequabo

cariban

purplehaze

misperceive

convenat

epigone

splenoptosis

pererrat

snakes

desiliconization

uninquired

gadman

scandanavia

coinmates


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: lesesne
cipher variations:
mftftof ngugupg ohvhvqh piwiwri qjxjxsj
rkykytk slzlzul tmamavm unbnbwn vococxo
wpdpdyp xqeqezq yrfrfar zsgsgbs aththct
buiuidu cvjvjev dwkwkfw exlxlgx fymymhy
gznzniz haoaoja ibpbpkb jcqcqlc kdrdrmd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: lesesne
Cipher: ovhvhmv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: lesesne
Cipher: ABABA AABAA BAAAB AABAA BAAAB ABBAA AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: lesesne
cipher variations:
mftftofindndonevnvnovadxdxodwlhlholstrtrotkjljlojgrvrvor
czfzfozyhphpohupzpzopqxjxjoxngugupgjoeoepofwowopwbeyeype
xmimipmtususpulkmkmpkhswswpsdagagpaziqiqpivqaqapqrykykpy
ohvhvqhkpfpfqpgxpxpqxcfzfzqfynjnjqnuvtvtqvmlnlnqlitxtxqt
ebhbhqbajrjrqjwrbrbqrszlzlqzpiwiwrilqgqgrqhyqyqrydgagarg
zokokrovwuwurwnmomormjuyuyrufcicircbksksrkxscscrstamamra
qjxjxsjmrhrhsrizrzrszehbhbshaplplspwxvxvsxonpnpsnkvzvzsv
gdjdjsdcltltslytdtdstubnbnsbrkykytknsisitsjasastaficicti
bqmqmtqxywywtypoqoqtolwawatwhekektedmumutmzueuetuvcocotc
slzlzulotjtjutkbtbtubgjdjdujcrnrnuryzxzxuzqprprupmxbxbux
iflflufenvnvunavfvfuvwdpdpudtmamavmpukukvulcucuvchkekevk
dsosovszayayvarqsqsvqnycycvyjgmgmvgfowowvobwgwgvwxeqeqve
unbnbwnqvlvlwvmdvdvwdilflfwletptpwtabzbzwbsrtrtwrozdzdwz
khnhnwhgpxpxwpcxhxhwxyfrfrwfvococxorwmwmxwnewewxejmgmgxm
fuquqxubcacaxctsusuxspaeaexalioioxihqyqyxqdyiyixyzgsgsxg
wpdpdypsxnxnyxofxfxyfknhnhyngvrvryvcdbdbydutvtvytqbfbfyb
mjpjpyjirzrzyrezjzjyzahthtyhxqeqezqtyoyozypgygyzgloioizo
hwswszwdececzevuwuwzurcgcgzcnkqkqzkjsasazsfakakzabiuiuzi
yrfrfaruzpzpazqhzhzahmpjpjapixtxtaxefdfdafwvxvxavsdhdhad
olrlralktbtbatgblblabcjvjvajzsgsgbsvaqaqbariaiabinqkqkbq
jyuyubyfgegebgxwywybwteieibepmsmsbmlucucbuhcmcmbcdkwkwbk
aththctwbrbrcbsjbjbcjorlrlcrkzvzvczghfhfchyxzxzcxufjfjcf
qntntcnmvdvdcvidndncdelxlxclbuiuiduxcscsdctkckcdkpsmsmds
lawawdahigigdizyayadyvgkgkdgrououdonwewedwjeoeodefmymydm
cvjvjevydtdteduldldelqtntnetmbxbxebijhjhejazbzbezwhlhleh
spvpvepoxfxfexkfpfpefgnznzendwkwkfwzeueufevmemefmruouofu
ncycyfcjkikifkbacacfaximimfitqwqwfqpygygfylgqgqfghoaoafo
exlxlgxafvfvgfwnfnfgnsvpvpgvodzdzgdkljljglcbdbdgbyjnjngj
urxrxgrqzhzhgzmhrhrghipbpbgpfymymhybgwgwhgxogoghotwqwqhw
peaeahelmkmkhmdcecehczkokohkvsysyhsraiaihanisishijqcqchq
gznznizchxhxihyphphipuxrxrixqfbfbifmnlnlinedfdfidalplpil
wtztzitsbjbjibojtjtijkrdrdirhaoaojadiyiyjizqiqijqvysysjy
rgcgcjgnomomjofegegjebmqmqjmxuauajutckckjcpkukujklsesejs
ibpbpkbejzjzkjarjrjkrwztztkzshdhdkhopnpnkpgfhfhkfcnrnrkn
yvbvbkvudldlkdqlvlvklmtftfktjcqcqlcfkakalkbsksklsxauaula
tieielipqoqolqhgigilgdososlozwcwclwvememlermwmwlmnuguglu
kdrdrmdglblbmlctltlmtybvbvmbujfjfmjqrprpmrihjhjmheptptmp
axdxdmxwfnfnmfsnxnxmnovhvhmvlesesnehmcmcnmdumumnuzcwcwnc
vkgkgnkrsqsqnsjikiknifququnqbyeyenyxgogongtoyoynopwiwinw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: lesesne
Cipher: yrfrfar

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: lesesne
Cipher: 13513451343351

Extended Methods:
Method #1

Plaintext: lesesne
method variations:
qkxkxskvpcpcxpauhuhcufznznhz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
l e s e s n e 
1 5 3 5 3 3 5 
3 1 4 1 4 3 1 
They are then read out in rows:
15353353141431
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: lesesne
Cipher: vxnpqqc

Read more ...
Method #3

Plaintext: lesesne
method variations:
xlyloxa lyloxax yloxaxl
loxaxly oxaxlyl xaxlylo
axlylox

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: lesesne

all 5040 cipher variations:
lesesne lesesen lesense lesenes leseens leseesn lessene lesseen lessnee lessnee lessene
lesseen lesnsee lesnsee lesnese lesnees lesnees lesnese lesesne lesesen lesense lesenes
leseens leseesn leessne leessen leesnse leesnes leesens leesesn leessne leessen leesnse
leesnes leesens leesesn leensse leenses leensse leenses leeness leeness leeesns leeessn
leeenss leeenss leeesns leeessn lesesne lesesen lesense lesenes leseens leseesn lessene
lesseen lessnee lessnee lessene lesseen lesnsee lesnsee lesnese lesnees lesnees lesnese
lesesne lesesen lesense lesenes leseens leseesn lenesse leneses lenesse leneses leneess
leneess lensese lensees lenssee lenssee lensese lensees lenssee lenssee lensese lensees
lensees lensese lenesse leneses lenesse leneses leneess leneess leeesns leeessn leeenss
leeenss leeesns leeessn leesens leesesn leesnes leesnse leessne leessen leenses leensse
leeness leeness leenses leensse leessne leessen leesnse leesnes leesens leesesn lseesne
lseesen lseense lseenes lseeens lseeesn lsesene lseseen lsesnee lsesnee lsesene lseseen
lsensee lsensee lsenese lsenees lsenees lsenese lseesne lseesen lseense lseenes lseeens
lseeesn lseesne lseesen lseense lseenes lseeens lseeesn lsesene lseseen lsesnee lsesnee
lsesene lseseen lsensee lsensee lsenese lsenees lsenees lsenese lseesne lseesen lseense
lseenes lseeens lseeesn lsseene lsseeen lssenee lssenee lsseene lsseeen lsseene lsseeen
lssenee lssenee lsseene lsseeen lssneee lssneee lssneee lssneee lssneee lssneee lsseene
lsseeen lssenee lssenee lsseene lsseeen lsnesee lsnesee lsneese lsneees lsneees lsneese
lsnseee lsnseee lsnseee lsnseee lsnseee lsnseee lsnesee lsnesee lsneese lsneees lsneees
lsneese lsnesee lsnesee lsneese lsneees lsneees lsneese lseesne lseesen lseense lseenes
lseeens lseeesn lsesene lseseen lsesnee lsesnee lsesene lseseen lsensee lsensee lsenese
lsenees lsenees lsenese lseesne lseesen lseense lseenes lseeens lseeesn lesesne lesesen
lesense lesenes leseens leseesn lessene lesseen lessnee lessnee lessene lesseen lesnsee
lesnsee lesnese lesnees lesnees lesnese lesesne lesesen lesense lesenes leseens leseesn
leessne leessen leesnse leesnes leesens leesesn leessne leessen leesnse leesnes leesens
leesesn leensse leenses leensse leenses leeness leeness leeesns leeessn leeenss leeenss
leeesns leeessn lesesne lesesen lesense lesenes leseens leseesn lessene lesseen lessnee
lessnee lessene lesseen lesnsee lesnsee lesnese lesnees lesnees lesnese lesesne lesesen
lesense lesenes leseens leseesn lenesse leneses lenesse leneses leneess leneess lensese
lensees lenssee lenssee lensese lensees lenssee lenssee lensese lensees lensees lensese
lenesse leneses lenesse leneses leneess leneess leeesns leeessn leeenss leeenss leeesns
leeessn leesens leesesn leesnes leesnse leessne leessen leenses leensse leeness leeness
leenses leensse leessne leessen leesnse leesnes leesens leesesn lsseene lsseeen lssenee
lssenee lsseene lsseeen lsseene lsseeen lssenee lssenee lsseene lsseeen lssneee lssneee
lssneee lssneee lssneee lssneee lsseene lsseeen lssenee lssenee lsseene lsseeen lsesene
lseseen lsesnee lsesnee lsesene lseseen lseesne lseesen lseense lseenes lseeens lseeesn
lsenese lsenees lsensee lsensee lsenese lsenees lseeens lseeesn lseenes lseense lseesne
lseesen lseesne lseesen lseense lseenes lseeens lseeesn lsesene lseseen lsesnee lsesnee
lsesene lseseen lsensee lsensee lsenese lsenees lsenees lsenese lseesne lseesen lseense
lseenes lseeens lseeesn lsneese lsneees lsnesee lsnesee lsneese lsneees lsneese lsneees
lsnesee lsnesee lsneese lsneees lsnseee lsnseee lsnseee lsnseee lsnseee lsnseee lsneese
lsneees lsnesee lsnesee lsneese lsneees lseeens lseeesn lseenes lseense lseesne lseesen
lseeens lseeesn lseenes lseense lseesne lseesen lsenees lsenese lsenees lsenese lsensee
lsensee lsesene lseseen lsesnee lsesnee lsesene lseseen lnsesee lnsesee lnseese lnseees
lnseees lnseese lnsseee lnsseee lnsseee lnsseee lnsseee lnsseee lnsesee lnsesee lnseese
lnseees lnseees lnseese lnsesee lnsesee lnseese lnseees lnseees lnseese lnessee lnessee
lnesese lnesees lnesees lnesese lnessee lnessee lnesese lnesees lnesees lnesese lneesse
lneeses lneesse lneeses lneeess lneeess lneeses lneesse lneeess lneeess lneeses lneesse
lnsesee lnsesee lnseese lnseees lnseees lnseese lnsseee lnsseee lnsseee lnsseee lnsseee
lnsseee lnsesee lnsesee lnseese lnseees lnseees lnseese lnsesee lnsesee lnseese lnseees
lnseees lnseese lneesse lneeses lneesse lneeses lneeess lneeess lnesese lnesees lnessee
lnessee lnesese lnesees lnessee lnessee lnesese lnesees lnesees lnesese lneesse lneeses
lneesse lneeses lneeess lneeess lneeses lneesse lneeess lneeess lneeses lneesse lnesees
lnesese lnesees lnesese lnessee lnessee lneeses lneesse lneeess lneeess lneeses lneesse
lnessee lnessee lnesese lnesees lnesees lnesese lesesne lesesen lesense lesenes leseens
leseesn lessene lesseen lessnee lessnee lessene lesseen lesnsee lesnsee lesnese lesnees
lesnees lesnese lesesne lesesen lesense lesenes leseens leseesn leessne leessen leesnse
leesnes leesens leesesn leessne leessen leesnse leesnes leesens leesesn leensse leenses
leensse leenses leeness leeness leeesns leeessn leeenss leeenss leeesns leeessn lesesne
lesesen lesense lesenes leseens leseesn lessene lesseen lessnee lessnee lessene lesseen
lesnsee lesnsee lesnese lesnees lesnees lesnese lesesne lesesen lesense lesenes leseens
leseesn lenesse leneses lenesse leneses leneess leneess lensese lensees lenssee lenssee
lensese lensees lenssee lenssee lensese lensees lensees lensese lenesse leneses lenesse
leneses leneess leneess leeesns leeessn leeenss leeenss leeesns leeessn leesens leesesn
leesnes leesnse leessne leessen leenses leensse leeness leeness leenses leensse leessne
leessen leesnse leesnes leesens leesesn elsesne elsesen elsense elsenes elseens elseesn
elssene elsseen elssnee elssnee elssene elsseen elsnsee elsnsee elsnese elsnees elsnees
elsnese elsesne elsesen elsense elsenes elseens elseesn elessne elessen elesnse elesnes
elesens elesesn elessne elessen elesnse elesnes elesens elesesn elensse elenses elensse
elenses eleness eleness eleesns eleessn eleenss eleenss eleesns eleessn elsesne elsesen
elsense elsenes elseens elseesn elssene elsseen elssnee elssnee elssene elsseen elsnsee
elsnsee elsnese elsnees elsnees elsnese elsesne elsesen elsense elsenes elseens elseesn
elnesse elneses elnesse elneses elneess elneess elnsese elnsees elnssee elnssee elnsese
elnsees elnssee elnssee elnsese elnsees elnsees elnsese elnesse elneses elnesse elneses
elneess elneess eleesns eleessn eleenss eleenss eleesns eleessn elesens elesesn elesnes
elesnse elessne elessen elenses elensse eleness eleness elenses elensse elessne elessen
elesnse elesnes elesens elesesn eslesne eslesen eslense eslenes esleens esleesn eslsene
eslseen eslsnee eslsnee eslsene eslseen eslnsee eslnsee eslnese eslnees eslnees eslnese
eslesne eslesen eslense eslenes esleens esleesn eselsne eselsen eselnse eselnes eselens
eselesn eseslne eseslen esesnle esesnel esesenl eseseln esensle esensel esenlse esenles
esenels esenesl eseesnl eseesln eseensl eseenls eseelns eseelsn esselne esselen essenle
essenel esseenl esseeln esslene essleen esslnee esslnee esslene essleen essnlee essnlee
essnele essneel essneel essnele esselne esselen essenle essenel esseenl esseeln esnesle
esnesel esnelse esneles esneels esneesl esnsele esnseel esnslee esnslee esnsele esnseel
esnlsee esnlsee esnlese esnlees esnlees esnlese esnesle esnesel esnelse esneles esneels
esneesl eseesnl eseesln eseensl eseenls eseelns eseelsn esesenl eseseln esesnel esesnle
eseslne eseslen esensel esensle esenesl esenels esenles esenlse eselsne eselsen eselnse
eselnes eselens eselesn eeslsne eeslsen eeslnse eeslnes eeslens eeslesn eesslne eesslen
eessnle eessnel eessenl eesseln eesnsle eesnsel eesnlse eesnles eesnels eesnesl eesesnl
eesesln eesensl eesenls eeselns eeselsn eelssne eelssen eelsnse eelsnes eelsens eelsesn
eelssne eelssen eelsnse eelsnes eelsens eelsesn eelnsse eelnses eelnsse eelnses eelness
eelness eelesns eelessn eelenss eelenss eelesns eelessn eeslsne eeslsen eeslnse eeslnes
eeslens eeslesn eesslne eesslen eessnle eessnel eessenl eesseln eesnsle eesnsel eesnlse
eesnles eesnels eesnesl eesesnl eesesln eesensl eesenls eeselns eeselsn eenlsse eenlses
eenlsse eenlses eenless eenless eenslse eensles eenssle eenssel eensesl eensels eenssle
eenssel eenslse eensles eensels eensesl eenessl eenesls eenessl eenesls eenelss eenelss
eeelsns eeelssn eeelnss eeelnss eeelsns eeelssn eeeslns eeeslsn eeesnls eeesnsl eeessnl
eeessln eeensls eeenssl eeenlss eeenlss eeensls eeenssl eeessnl eeessln eeesnsl eeesnls
eeeslns eeeslsn esselne esselen essenle essenel esseenl esseeln esslene essleen esslnee
esslnee esslene essleen essnlee essnlee essnele essneel essneel essnele esselne esselen
essenle essenel esseenl esseeln eseslne eseslen esesnle esesnel esesenl eseseln eselsne
eselsen eselnse eselnes eselens eselesn esenlse esenles esensle esensel esenesl esenels
eseelns eseelsn eseenls eseensl eseesnl eseesln eslesne eslesen eslense eslenes esleens
esleesn eslsene eslseen eslsnee eslsnee eslsene eslseen eslnsee eslnsee eslnese eslnees
eslnees eslnese eslesne eslesen eslense eslenes esleens esleesn esnelse esneles esnesle
esnesel esneesl esneels esnlese esnlees esnlsee esnlsee esnlese esnlees esnslee esnslee
esnsele esnseel esnseel esnsele esnelse esneles esnesle esnesel esneesl esneels eseelns
eseelsn eseenls eseensl eseesnl eseesln eselens eselesn eselnes eselnse eselsne eselsen
esenles esenlse esenels esenesl esensel esensle eseslne eseslen esesnle esesnel esesenl
eseseln ensesle ensesel enselse enseles enseels enseesl enssele ensseel ensslee ensslee
enssele ensseel enslsee enslsee enslese enslees enslees enslese ensesle ensesel enselse
enseles enseels enseesl enessle enessel eneslse enesles enesels enesesl enessle enessel
eneslse enesles enesels enesesl enelsse enelses enelsse enelses eneless eneless eneesls
eneessl eneelss eneelss eneesls eneessl ensesle ensesel enselse enseles enseels enseesl
enssele ensseel ensslee ensslee enssele ensseel enslsee enslsee enslese enslees enslees
enslese ensesle ensesel enselse enseles enseels enseesl enlesse enleses enlesse enleses
enleess enleess enlsese enlsees enlssee enlssee enlsese enlsees enlssee enlssee enlsese
enlsees enlsees enlsese enlesse enleses enlesse enleses enleess enleess eneesls eneessl
eneelss eneelss eneesls eneessl enesels enesesl enesles eneslse enessle enessel enelses
enelsse eneless eneless enelses enelsse enessle enessel eneslse enesles enesels enesesl
eesesnl eesesln eesensl eesenls eeselns eeselsn eessenl eesseln eessnel eessnle eesslne
eesslen eesnsel eesnsle eesnesl eesnels eesnles eesnlse eeslsne eeslsen eeslnse eeslnes
eeslens eeslesn eeessnl eeessln eeesnsl eeesnls eeeslns eeeslsn eeessnl eeessln eeesnsl
eeesnls eeeslns eeeslsn eeenssl eeensls eeenssl eeensls eeenlss eeenlss eeelsns eeelssn
eeelnss eeelnss eeelsns eeelssn eesesnl eesesln eesensl eesenls eeselns eeselsn eessenl
eesseln eessnel eessnle eesslne eesslen eesnsel eesnsle eesnesl eesnels eesnles eesnlse
eeslsne eeslsen eeslnse eeslnes eeslens eeslesn eenessl eenesls eenessl eenesls eenelss
eenelss eensesl eensels eenssel eenssle eenslse eensles eenssel eenssle eensesl eensels
eensles eenslse eenlsse eenlses eenlsse eenlses eenless eenless eelesns eelessn eelenss
eelenss eelesns eelessn eelsens eelsesn eelsnes eelsnse eelssne eelssen eelnses eelnsse
eelness eelness eelnses eelnsse eelssne eelssen eelsnse eelsnes eelsens eelsesn selesne
selesen selense selenes seleens seleesn selsene selseen selsnee selsnee selsene selseen
selnsee selnsee selnese selnees selnees selnese selesne selesen selense selenes seleens
seleesn seelsne seelsen seelnse seelnes seelens seelesn seeslne seeslen seesnle seesnel
seesenl seeseln seensle seensel seenlse seenles seenels seenesl seeesnl seeesln seeensl
seeenls seeelns seeelsn seselne seselen sesenle sesenel seseenl seseeln seslene sesleen
seslnee seslnee seslene sesleen sesnlee sesnlee sesnele sesneel sesneel sesnele seselne
seselen sesenle sesenel seseenl seseeln senesle senesel senelse seneles seneels seneesl
sensele senseel senslee senslee sensele senseel senlsee senlsee senlese senlees senlees
senlese senesle senesel senelse seneles seneels seneesl seeesnl seeesln seeensl seeenls
seeelns seeelsn seesenl seeseln seesnel seesnle seeslne seeslen seensel seensle seenesl
seenels seenles seenlse seelsne seelsen seelnse seelnes seelens seelesn sleesne sleesen
sleense sleenes sleeens sleeesn slesene sleseen slesnee slesnee slesene sleseen slensee
slensee slenese slenees slenees slenese sleesne sleesen sleense sleenes sleeens sleeesn
sleesne sleesen sleense sleenes sleeens sleeesn slesene sleseen slesnee slesnee slesene
sleseen slensee slensee slenese slenees slenees slenese sleesne sleesen sleense sleenes
sleeens sleeesn slseene slseeen slsenee slsenee slseene slseeen slseene slseeen slsenee
slsenee slseene slseeen slsneee slsneee slsneee slsneee slsneee slsneee slseene slseeen
slsenee slsenee slseene slseeen slnesee slnesee slneese slneees slneees slneese slnseee
slnseee slnseee slnseee slnseee slnseee slnesee slnesee slneese slneees slneees slneese
slnesee slnesee slneese slneees slneees slneese sleesne sleesen sleense sleenes sleeens
sleeesn slesene sleseen slesnee slesnee slesene sleseen slensee slensee slenese slenees
slenees slenese sleesne sleesen sleense sleenes sleeens sleeesn selesne selesen selense
selenes seleens seleesn selsene selseen selsnee selsnee selsene selseen selnsee selnsee
selnese selnees selnees selnese selesne selesen selense selenes seleens seleesn seelsne
seelsen seelnse seelnes seelens seelesn seeslne seeslen seesnle seesnel seesenl seeseln
seensle seensel seenlse seenles seenels seenesl seeesnl seeesln seeensl seeenls seeelns
seeelsn seselne seselen sesenle sesenel seseenl seseeln seslene sesleen seslnee seslnee
seslene sesleen sesnlee sesnlee sesnele sesneel sesneel sesnele seselne seselen sesenle
sesenel seseenl seseeln senesle senesel senelse seneles seneels seneesl sensele senseel
senslee senslee sensele senseel senlsee senlsee senlese senlees senlees senlese senesle
senesel senelse seneles seneels seneesl seeesnl seeesln seeensl seeenls seeelns seeelsn
seesenl seeseln seesnel seesnle seeslne seeslen seensel seensle seenesl seenels seenles
seenlse seelsne seelsen seelnse seelnes seelens seelesn ssleene ssleeen sslenee sslenee
ssleene ssleeen ssleene ssleeen sslenee sslenee ssleene ssleeen sslneee sslneee sslneee
sslneee sslneee sslneee ssleene ssleeen sslenee sslenee ssleene ssleeen sselene sseleen
sselnee sselnee sselene sseleen sseelne sseelen sseenle sseenel sseeenl sseeeln ssenele
sseneel ssenlee ssenlee ssenele sseneel sseeenl sseeeln sseenel sseenle sseelne sseelen
sseelne sseelen sseenle sseenel sseeenl sseeeln sselene sseleen sselnee sselnee sselene
sseleen ssenlee ssenlee ssenele sseneel sseneel ssenele sseelne sseelen sseenle sseenel
sseeenl sseeeln ssneele ssneeel ssnelee ssnelee ssneele ssneeel ssneele ssneeel ssnelee
ssnelee ssneele ssneeel ssnleee ssnleee ssnleee ssnleee ssnleee ssnleee ssneele ssneeel
ssnelee ssnelee ssneele ssneeel sseeenl sseeeln sseenel sseenle sseelne sseelen sseeenl
sseeeln sseenel sseenle sseelne sseelen sseneel ssenele sseneel ssenele ssenlee ssenlee
sselene sseleen sselnee sselnee sselene sseleen snlesee snlesee snleese snleees snleees
snleese snlseee snlseee snlseee snlseee snlseee snlseee snlesee snlesee snleese snleees
snleees snleese snlesee snlesee snleese snleees snleees snleese snelsee snelsee snelese
snelees snelees snelese sneslee sneslee snesele sneseel sneseel snesele sneesle sneesel
sneelse sneeles sneeels sneeesl sneesel sneesle sneeesl sneeels sneeles sneelse snselee
snselee snseele snseeel snseeel snseele snsleee snsleee snsleee snsleee snsleee snsleee
snselee snselee snseele snseeel snseeel snseele snselee snselee snseele snseeel snseeel
snseele sneesle sneesel sneelse sneeles sneeels sneeesl snesele sneseel sneslee sneslee
snesele sneseel snelsee snelsee snelese snelees snelees snelese sneesle sneesel sneelse
sneeles sneeels sneeesl sneesel sneesle sneeesl sneeels sneeles sneelse sneseel snesele
sneseel snesele sneslee sneslee sneesel sneesle sneeesl sneeels sneeles sneelse snelsee
snelsee snelese snelees snelees snelese selesne selesen selense selenes seleens seleesn
selsene selseen selsnee selsnee selsene selseen selnsee selnsee selnese selnees selnees
selnese selesne selesen selense selenes seleens seleesn seelsne seelsen seelnse seelnes
seelens seelesn seeslne seeslen seesnle seesnel seesenl seeseln seensle seensel seenlse
seenles seenels seenesl seeesnl seeesln seeensl seeenls seeelns seeelsn seselne seselen
sesenle sesenel seseenl seseeln seslene sesleen seslnee seslnee seslene sesleen sesnlee
sesnlee sesnele sesneel sesneel sesnele seselne seselen sesenle sesenel seseenl seseeln
senesle senesel senelse seneles seneels seneesl sensele senseel senslee senslee sensele
senseel senlsee senlsee senlese senlees senlees senlese senesle senesel senelse seneles
seneels seneesl seeesnl seeesln seeensl seeenls seeelns seeelsn seesenl seeseln seesnel
seesnle seeslne seeslen seensel seensle seenesl seenels seenles seenlse seelsne seelsen
seelnse seelnes seelens seelesn eeslsne eeslsen eeslnse eeslnes eeslens eeslesn eesslne
eesslen eessnle eessnel eessenl eesseln eesnsle eesnsel eesnlse eesnles eesnels eesnesl
eesesnl eesesln eesensl eesenls eeselns eeselsn eelssne eelssen eelsnse eelsnes eelsens
eelsesn eelssne eelssen eelsnse eelsnes eelsens eelsesn eelnsse eelnses eelnsse eelnses
eelness eelness eelesns eelessn eelenss eelenss eelesns eelessn eeslsne eeslsen eeslnse
eeslnes eeslens eeslesn eesslne eesslen eessnle eessnel eessenl eesseln eesnsle eesnsel
eesnlse eesnles eesnels eesnesl eesesnl eesesln eesensl eesenls eeselns eeselsn eenlsse
eenlses eenlsse eenlses eenless eenless eenslse eensles eenssle eenssel eensesl eensels
eenssle eenssel eenslse eensles eensels eensesl eenessl eenesls eenessl eenesls eenelss
eenelss eeelsns eeelssn eeelnss eeelnss eeelsns eeelssn eeeslns eeeslsn eeesnls eeesnsl
eeessnl eeessln eeensls eeenssl eeenlss eeenlss eeensls eeenssl eeessnl eeessln eeesnsl
eeesnls eeeslns eeeslsn eselsne eselsen eselnse eselnes eselens eselesn eseslne eseslen
esesnle esesnel esesenl eseseln esensle esensel esenlse esenles esenels esenesl eseesnl
eseesln eseensl eseenls eseelns eseelsn eslesne eslesen eslense eslenes esleens esleesn
eslsene eslseen eslsnee eslsnee eslsene eslseen eslnsee eslnsee eslnese eslnees eslnees
eslnese eslesne eslesen eslense eslenes esleens esleesn esslene essleen esslnee esslnee
esslene essleen esselne esselen essenle essenel esseenl esseeln essnele essneel essnlee
essnlee essnele essneel esseenl esseeln essenel essenle esselne esselen esnlsee esnlsee
esnlese esnlees esnlees esnlese esnslee esnslee esnsele esnseel esnseel esnsele esnesle
esnesel esnelse esneles esneels esneesl esnesel esnesle esneesl esneels esneles esnelse
eselsne eselsen eselnse eselnes eselens eselesn eseslne eseslen esesnle esesnel esesenl
eseseln esensle esensel esenlse esenles esenels esenesl eseesnl eseesln eseensl eseenls
eseelns eseelsn elsesne elsesen elsense elsenes elseens elseesn elssene elsseen elssnee
elssnee elssene elsseen elsnsee elsnsee elsnese elsnees elsnees elsnese elsesne elsesen
elsense elsenes elseens elseesn elessne elessen elesnse elesnes elesens elesesn elessne
elessen elesnse elesnes elesens elesesn elensse elenses elensse elenses eleness eleness
eleesns eleessn eleenss eleenss eleesns eleessn elsesne elsesen elsense elsenes elseens
elseesn elssene elsseen elssnee elssnee elssene elsseen elsnsee elsnsee elsnese elsnees
elsnees elsnese elsesne elsesen elsense elsenes elseens elseesn elnesse elneses elnesse
elneses elneess elneess elnsese elnsees elnssee elnssee elnsese elnsees elnssee elnssee
elnsese elnsees elnsees elnsese elnesse elneses elnesse elneses elneess elneess eleesns
eleessn eleenss eleenss eleesns eleessn elesens elesesn elesnes elesnse elessne elessen
elenses elensse eleness eleness elenses elensse elessne elessen elesnse elesnes elesens
elesesn esslene essleen esslnee esslnee esslene essleen esselne esselen essenle essenel
esseenl esseeln essnele essneel essnlee essnlee essnele essneel esseenl esseeln essenel
essenle esselne esselen eslsene eslseen eslsnee eslsnee eslsene eslseen eslesne eslesen
eslense eslenes esleens esleesn eslnese eslnees eslnsee eslnsee eslnese eslnees esleens
esleesn eslenes eslense eslesne eslesen eselsne eselsen eselnse eselnes eselens eselesn
eseslne eseslen esesnle esesnel esesenl eseseln esensle esensel esenlse esenles esenels
esenesl eseesnl eseesln eseensl eseenls eseelns eseelsn esnlese esnlees esnlsee esnlsee
esnlese esnlees esnelse esneles esnesle esnesel esneesl esneels esnsele esnseel esnslee
esnslee esnsele esnseel esneesl esneels esnesel esnesle esnelse esneles eselens eselesn
eselnes eselnse eselsne eselsen eseelns eseelsn eseenls eseensl eseesnl eseesln esenels
esenesl esenles esenlse esensle esensel esesenl eseseln esesnel esesnle eseslne eseslen
enslsee enslsee enslese enslees enslees enslese ensslee ensslee enssele ensseel ensseel
enssele ensesle ensesel enselse enseles enseels enseesl ensesel ensesle enseesl enseels
enseles enselse enlssee enlssee enlsese enlsees enlsees enlsese enlssee enlssee enlsese
enlsees enlsees enlsese enlesse enleses enlesse enleses enleess enleess enleses enlesse
enleess enleess enleses enlesse enslsee enslsee enslese enslees enslees enslese ensslee
ensslee enssele ensseel ensseel enssele ensesle ensesel enselse enseles enseels enseesl
ensesel ensesle enseesl enseels enseles enselse enelsse enelses enelsse enelses eneless
eneless eneslse enesles enessle enessel enesesl enesels enessle enessel eneslse enesles
enesels enesesl eneessl eneesls eneessl eneesls eneelss eneelss enelses enelsse eneless
eneless enelses enelsse enesles eneslse enesels enesesl enessel enessle eneesls eneessl
eneelss eneelss eneesls eneessl enessel enessle enesesl enesels enesles eneslse eeslsne
eeslsen eeslnse eeslnes eeslens eeslesn eesslne eesslen eessnle eessnel eessenl eesseln
eesnsle eesnsel eesnlse eesnles eesnels eesnesl eesesnl eesesln eesensl eesenls eeselns
eeselsn eelssne eelssen eelsnse eelsnes eelsens eelsesn eelssne eelssen eelsnse eelsnes
eelsens eelsesn eelnsse eelnses eelnsse eelnses eelness eelness eelesns eelessn eelenss
eelenss eelesns eelessn eeslsne eeslsen eeslnse eeslnes eeslens eeslesn eesslne eesslen
eessnle eessnel eessenl eesseln eesnsle eesnsel eesnlse eesnles eesnels eesnesl eesesnl
eesesln eesensl eesenls eeselns eeselsn eenlsse eenlses eenlsse eenlses eenless eenless
eenslse eensles eenssle eenssel eensesl eensels eenssle eenssel eenslse eensles eensels
eensesl eenessl eenesls eenessl eenesls eenelss eenelss eeelsns eeelssn eeelnss eeelnss
eeelsns eeelssn eeeslns eeeslsn eeesnls eeesnsl eeessnl eeessln eeensls eeenssl eeenlss
eeenlss eeensls eeenssl eeessnl eeessln eeesnsl eeesnls eeeslns eeeslsn seselne seselen
sesenle sesenel seseenl seseeln seslene sesleen seslnee seslnee seslene sesleen sesnlee
sesnlee sesnele sesneel sesneel sesnele seselne seselen sesenle sesenel seseenl seseeln
seeslne seeslen seesnle seesnel seesenl seeseln seelsne seelsen seelnse seelnes seelens
seelesn seenlse seenles seensle seensel seenesl seenels seeelns seeelsn seeenls seeensl
seeesnl seeesln selesne selesen selense selenes seleens seleesn selsene selseen selsnee
selsnee selsene selseen selnsee selnsee selnese selnees selnees selnese selesne selesen
selense selenes seleens seleesn senelse seneles senesle senesel seneesl seneels senlese
senlees senlsee senlsee senlese senlees senslee senslee sensele senseel senseel sensele
senelse seneles senesle senesel seneesl seneels seeelns seeelsn seeenls seeensl seeesnl
seeesln seelens seelesn seelnes seelnse seelsne seelsen seenles seenlse seenels seenesl
seensel seensle seeslne seeslen seesnle seesnel seesenl seeseln sseelne sseelen sseenle
sseenel sseeenl sseeeln sselene sseleen sselnee sselnee sselene sseleen ssenlee ssenlee
ssenele sseneel sseneel ssenele sseelne sseelen sseenle sseenel sseeenl sseeeln sseelne
sseelen sseenle sseenel sseeenl sseeeln sselene sseleen sselnee sselnee sselene sseleen
ssenlee ssenlee ssenele sseneel sseneel ssenele sseelne sseelen sseenle sseenel sseeenl
sseeeln ssleene ssleeen sslenee sslenee ssleene ssleeen ssleene ssleeen sslenee sslenee
ssleene ssleeen sslneee sslneee sslneee sslneee sslneee sslneee ssleene ssleeen sslenee
sslenee ssleene ssleeen ssnelee ssnelee ssneele ssneeel ssneeel ssneele ssnleee ssnleee
ssnleee ssnleee ssnleee ssnleee ssnelee ssnelee ssneele ssneeel ssneeel ssneele ssnelee
ssnelee ssneele ssneeel ssneeel ssneele sseelne sseelen sseenle sseenel sseeenl sseeeln
sselene sseleen sselnee sselnee sselene sseleen ssenlee ssenlee ssenele sseneel sseneel
ssenele sseelne sseelen sseenle sseenel sseeenl sseeeln seselne seselen sesenle sesenel
seseenl seseeln seslene sesleen seslnee seslnee seslene sesleen sesnlee sesnlee sesnele
sesneel sesneel sesnele seselne seselen sesenle sesenel seseenl seseeln seeslne seeslen
seesnle seesnel seesenl seeseln seelsne seelsen seelnse seelnes seelens seelesn seenlse
seenles seensle seensel seenesl seenels seeelns seeelsn seeenls seeensl seeesnl seeesln
selesne selesen selense selenes seleens seleesn selsene selseen selsnee selsnee selsene
selseen selnsee selnsee selnese selnees selnees selnese selesne selesen selense selenes
seleens seleesn senelse seneles senesle senesel seneesl seneels senlese senlees senlsee
senlsee senlese senlees senslee senslee sensele senseel senseel sensele senelse seneles
senesle senesel seneesl seneels seeelns seeelsn seeenls seeensl seeesnl seeesln seelens
seelesn seelnes seelnse seelsne seelsen seenles seenlse seenels seenesl seensel seensle
seeslne seeslen seesnle seesnel seesenl seeseln slseene slseeen slsenee slsenee slseene
slseeen slseene slseeen slsenee slsenee slseene slseeen slsneee slsneee slsneee slsneee
slsneee slsneee slseene slseeen slsenee slsenee slseene slseeen slesene sleseen slesnee
slesnee slesene sleseen sleesne sleesen sleense sleenes sleeens sleeesn slenese slenees
slensee slensee slenese slenees sleeens sleeesn sleenes sleense sleesne sleesen sleesne
sleesen sleense sleenes sleeens sleeesn slesene sleseen slesnee slesnee slesene sleseen
slensee slensee slenese slenees slenees slenese sleesne sleesen sleense sleenes sleeens
sleeesn slneese slneees slnesee slnesee slneese slneees slneese slneees slnesee slnesee
slneese slneees slnseee slnseee slnseee slnseee slnseee slnseee slneese slneees slnesee
slnesee slneese slneees sleeens sleeesn sleenes sleense sleesne sleesen sleeens sleeesn
sleenes sleense sleesne sleesen slenees slenese slenees slenese slensee slensee slesene
sleseen slesnee slesnee slesene sleseen snselee snselee snseele snseeel snseeel snseele
snsleee snsleee snsleee snsleee snsleee snsleee snselee snselee snseele snseeel snseeel
snseele snselee snselee snseele snseeel snseeel snseele sneslee sneslee snesele sneseel
sneseel snesele snelsee snelsee snelese snelees snelees snelese sneelse sneeles sneesle
sneesel sneeesl sneeels sneeles sneelse sneeels sneeesl sneesel sneesle snlesee snlesee
snleese snleees snleees snleese snlseee snlseee snlseee snlseee snlseee snlseee snlesee
snlesee snleese snleees snleees snleese snlesee snlesee snleese snleees snleees snleese
sneelse sneeles sneesle sneesel sneeesl sneeels snelese snelees snelsee snelsee snelese
snelees sneslee sneslee snesele sneseel sneseel snesele sneelse sneeles sneesle sneesel
sneeesl sneeels sneeles sneelse sneeels sneeesl sneesel sneesle snelees snelese snelees
snelese snelsee snelsee sneeles sneelse sneeels sneeesl sneesel sneesle sneslee sneslee
snesele sneseel sneseel snesele seselne seselen sesenle sesenel seseenl seseeln seslene
sesleen seslnee seslnee seslene sesleen sesnlee sesnlee sesnele sesneel sesneel sesnele
seselne seselen sesenle sesenel seseenl seseeln seeslne seeslen seesnle seesnel seesenl
seeseln seelsne seelsen seelnse seelnes seelens seelesn seenlse seenles seensle seensel
seenesl seenels seeelns seeelsn seeenls seeensl seeesnl seeesln selesne selesen selense
selenes seleens seleesn selsene selseen selsnee selsnee selsene selseen selnsee selnsee
selnese selnees selnees selnese selesne selesen selense selenes seleens seleesn senelse
seneles senesle senesel seneesl seneels senlese senlees senlsee senlsee senlese senlees
senslee senslee sensele senseel senseel sensele senelse seneles senesle senesel seneesl
seneels seeelns seeelsn seeenls seeensl seeesnl seeesln seelens seelesn seelnes seelnse
seelsne seelsen seenles seenlse seenels seenesl seensel seensle seeslne seeslen seesnle
seesnel seesenl seeseln nesesle nesesel neselse neseles neseels neseesl nessele nesseel
nesslee nesslee nessele nesseel neslsee neslsee neslese neslees neslees neslese nesesle
nesesel neselse neseles neseels neseesl neessle neessel neeslse neesles neesels neesesl
neessle neessel neeslse neesles neesels neesesl neelsse neelses neelsse neelses neeless
neeless neeesls neeessl neeelss neeelss neeesls neeessl nesesle nesesel neselse neseles
neseels neseesl nessele nesseel nesslee nesslee nessele nesseel neslsee neslsee neslese
neslees neslees neslese nesesle nesesel neselse neseles neseels neseesl nelesse neleses
nelesse neleses neleess neleess nelsese nelsees nelssee nelssee nelsese nelsees nelssee
nelssee nelsese nelsees nelsees nelsese nelesse neleses nelesse neleses neleess neleess
neeesls neeessl neeelss neeelss neeesls neeessl neesels neesesl neesles neeslse neessle
neessel neelses neelsse neeless neeless neelses neelsse neessle neessel neeslse neesles
neesels neesesl nseesle nseesel nseelse nseeles nseeels nseeesl nsesele nseseel nseslee
nseslee nsesele nseseel nselsee nselsee nselese nselees nselees nselese nseesle nseesel
nseelse nseeles nseeels nseeesl nseesle nseesel nseelse nseeles nseeels nseeesl nsesele
nseseel nseslee nseslee nsesele nseseel nselsee nselsee nselese nselees nselees nselese
nseesle nseesel nseelse nseeles nseeels nseeesl nsseele nsseeel nsselee nsselee nsseele
nsseeel nsseele nsseeel nsselee nsselee nsseele nsseeel nssleee nssleee nssleee nssleee
nssleee nssleee nsseele nsseeel nsselee nsselee nsseele nsseeel nslesee nslesee nsleese
nsleees nsleees nsleese nslseee nslseee nslseee nslseee nslseee nslseee nslesee nslesee
nsleese nsleees nsleees nsleese nslesee nslesee nsleese nsleees nsleees nsleese nseesle
nseesel nseelse nseeles nseeels nseeesl nsesele nseseel nseslee nseslee nsesele nseseel
nselsee nselsee nselese nselees nselees nselese nseesle nseesel nseelse nseeles nseeels
nseeesl nesesle nesesel neselse neseles neseels neseesl nessele nesseel nesslee nesslee
nessele nesseel neslsee neslsee neslese neslees neslees neslese nesesle nesesel neselse
neseles neseels neseesl neessle neessel neeslse neesles neesels neesesl neessle neessel
neeslse neesles neesels neesesl neelsse neelses neelsse neelses neeless neeless neeesls
neeessl neeelss neeelss neeesls neeessl nesesle nesesel neselse neseles neseels neseesl
nessele nesseel nesslee nesslee nessele nesseel neslsee neslsee neslese neslees neslees
neslese nesesle nesesel neselse neseles neseels neseesl nelesse neleses nelesse neleses
neleess neleess nelsese nelsees nelssee nelssee nelsese nelsees nelssee nelssee nelsese
nelsees nelsees nelsese nelesse neleses nelesse neleses neleess neleess neeesls neeessl
neeelss neeelss neeesls neeessl neesels neesesl neesles neeslse neessle neessel neelses
neelsse neeless neeless neelses neelsse neessle neessel neeslse neesles neesels neesesl
nsseele nsseeel nsselee nsselee nsseele nsseeel nsseele nsseeel nsselee nsselee nsseele
nsseeel nssleee nssleee nssleee nssleee nssleee nssleee nsseele nsseeel nsselee nsselee
nsseele nsseeel nsesele nseseel nseslee nseslee nsesele nseseel nseesle nseesel nseelse
nseeles nseeels nseeesl nselese nselees nselsee nselsee nselese nselees nseeels nseeesl
nseeles nseelse nseesle nseesel nseesle nseesel nseelse nseeles nseeels nseeesl nsesele
nseseel nseslee nseslee nsesele nseseel nselsee nselsee nselese nselees nselees nselese
nseesle nseesel nseelse nseeles nseeels nseeesl nsleese nsleees nslesee nslesee nsleese
nsleees nsleese nsleees nslesee nslesee nsleese nsleees nslseee nslseee nslseee nslseee
nslseee nslseee nsleese nsleees nslesee nslesee nsleese nsleees nseeels nseeesl nseeles
nseelse nseesle nseesel nseeels nseeesl nseeles nseelse nseesle nseesel nselees nselese
nselees nselese nselsee nselsee nsesele nseseel nseslee nseslee nsesele nseseel nlsesee
nlsesee nlseese nlseees nlseees nlseese nlsseee nlsseee nlsseee nlsseee nlsseee nlsseee
nlsesee nlsesee nlseese nlseees nlseees nlseese nlsesee nlsesee nlseese nlseees nlseees
nlseese nlessee nlessee nlesese nlesees nlesees nlesese nlessee nlessee nlesese nlesees
nlesees nlesese nleesse nleeses nleesse nleeses nleeess nleeess nleeses nleesse nleeess
nleeess nleeses nleesse nlsesee nlsesee nlseese nlseees nlseees nlseese nlsseee nlsseee
nlsseee nlsseee nlsseee nlsseee nlsesee nlsesee nlseese nlseees nlseees nlseese nlsesee
nlsesee nlseese nlseees nlseees nlseese nleesse nleeses nleesse nleeses nleeess nleeess
nlesese nlesees nlessee nlessee nlesese nlesees nlessee nlessee nlesese nlesees nlesees
nlesese nleesse nleeses nleesse nleeses nleeess nleeess nleeses nleesse nleeess nleeess
nleeses nleesse nlesees nlesese nlesees nlesese nlessee nlessee nleeses nleesse nleeess
nleeess nleeses nleesse nlessee nlessee nlesese nlesees nlesees nlesese nesesle nesesel
neselse neseles neseels neseesl nessele nesseel nesslee nesslee nessele nesseel neslsee
neslsee neslese neslees neslees neslese nesesle nesesel neselse neseles neseels neseesl
neessle neessel neeslse neesles neesels neesesl neessle neessel neeslse neesles neesels
neesesl neelsse neelses neelsse neelses neeless neeless neeesls neeessl neeelss neeelss
neeesls neeessl nesesle nesesel neselse neseles neseels neseesl nessele nesseel nesslee
nesslee nessele nesseel neslsee neslsee neslese neslees neslees neslese nesesle nesesel
neselse neseles neseels neseesl nelesse neleses nelesse neleses neleess neleess nelsese
nelsees nelssee nelssee nelsese nelsees nelssee nelssee nelsese nelsees nelsees nelsese
nelesse neleses nelesse neleses neleess neleess neeesls neeessl neeelss neeelss neeesls
neeessl neesels neesesl neesles neeslse neessle neessel neelses neelsse neeless neeless
neelses neelsse neessle neessel neeslse neesles neesels neesesl eesesnl eesesln eesensl
eesenls eeselns eeselsn eessenl eesseln eessnel eessnle eesslne eesslen eesnsel eesnsle
eesnesl eesnels eesnles eesnlse eeslsne eeslsen eeslnse eeslnes eeslens eeslesn eeessnl
eeessln eeesnsl eeesnls eeeslns eeeslsn eeessnl eeessln eeesnsl eeesnls eeeslns eeeslsn
eeenssl eeensls eeenssl eeensls eeenlss eeenlss eeelsns eeelssn eeelnss eeelnss eeelsns
eeelssn eesesnl eesesln eesensl eesenls eeselns eeselsn eessenl eesseln eessnel eessnle
eesslne eesslen eesnsel eesnsle eesnesl eesnels eesnles eesnlse eeslsne eeslsen eeslnse
eeslnes eeslens eeslesn eenessl eenesls eenessl eenesls eenelss eenelss eensesl eensels
eenssel eenssle eenslse eensles eenssel eenssle eensesl eensels eensles eenslse eenlsse
eenlses eenlsse eenlses eenless eenless eelesns eelessn eelenss eelenss eelesns eelessn
eelsens eelsesn eelsnes eelsnse eelssne eelssen eelnses eelnsse eelness eelness eelnses
eelnsse eelssne eelssen eelsnse eelsnes eelsens eelsesn eseesnl eseesln eseensl eseenls
eseelns eseelsn esesenl eseseln esesnel esesnle eseslne eseslen esensel esensle esenesl
esenels esenles esenlse eselsne eselsen eselnse eselnes eselens eselesn eseesnl eseesln
eseensl eseenls eseelns eseelsn esesenl eseseln esesnel esesnle eseslne eseslen esensel
esensle esenesl esenels esenles esenlse eselsne eselsen eselnse eselnes eselens eselesn
esseenl esseeln essenel essenle esselne esselen esseenl esseeln essenel essenle esselne
esselen essneel essnele essneel essnele essnlee essnlee esslene essleen esslnee esslnee
esslene essleen esnesel esnesle esneesl esneels esneles esnelse esnseel esnsele esnseel
esnsele esnslee esnslee esnesel esnesle esneesl esneels esneles esnelse esnlsee esnlsee
esnlese esnlees esnlees esnlese eslesne eslesen eslense eslenes esleens esleesn eslsene
eslseen eslsnee eslsnee eslsene eslseen eslnsee eslnsee eslnese eslnees eslnees eslnese
eslesne eslesen eslense eslenes esleens esleesn eesesnl eesesln eesensl eesenls eeselns
eeselsn eessenl eesseln eessnel eessnle eesslne eesslen eesnsel eesnsle eesnesl eesnels
eesnles eesnlse eeslsne eeslsen eeslnse eeslnes eeslens eeslesn eeessnl eeessln eeesnsl
eeesnls eeeslns eeeslsn eeessnl eeessln eeesnsl eeesnls eeeslns eeeslsn eeenssl eeensls
eeenssl eeensls eeenlss eeenlss eeelsns eeelssn eeelnss eeelnss eeelsns eeelssn eesesnl
eesesln eesensl eesenls eeselns eeselsn eessenl eesseln eessnel eessnle eesslne eesslen
eesnsel eesnsle eesnesl eesnels eesnles eesnlse eeslsne eeslsen eeslnse eeslnes eeslens
eeslesn eenessl eenesls eenessl eenesls eenelss eenelss eensesl eensels eenssel eenssle
eenslse eensles eenssel eenssle eensesl eensels eensles eenslse eenlsse eenlses eenlsse
eenlses eenless eenless eelesns eelessn eelenss eelenss eelesns eelessn eelsens eelsesn
eelsnes eelsnse eelssne eelssen eelnses eelnsse eelness eelness eelnses eelnsse eelssne
eelssen eelsnse eelsnes eelsens eelsesn esseenl esseeln essenel essenle esselne esselen
esseenl esseeln essenel essenle esselne esselen essneel essnele essneel essnele essnlee
essnlee esslene essleen esslnee esslnee esslene essleen esesenl eseseln esesnel esesnle
eseslne eseslen eseesnl eseesln eseensl eseenls eseelns eseelsn esenesl esenels esensel
esensle esenlse esenles eselens eselesn eselnes eselnse eselsne eselsen eseesnl eseesln
eseensl eseenls eseelns eseelsn esesenl eseseln esesnel esesnle eseslne eseslen esensel
esensle esenesl esenels esenles esenlse eselsne eselsen eselnse eselnes eselens eselesn
esneesl esneels esnesel esnesle esnelse esneles esneesl esneels esnesel esnesle esnelse
esneles esnseel esnsele esnseel esnsele esnslee esnslee esnlese esnlees esnlsee esnlsee
esnlese esnlees esleens esleesn eslenes eslense eslesne eslesen esleens esleesn eslenes
eslense eslesne eslesen eslnees eslnese eslnees eslnese eslnsee eslnsee eslsene eslseen
eslsnee eslsnee eslsene eslseen ensesel ensesle enseesl enseels enseles enselse ensseel
enssele ensseel enssele ensslee ensslee ensesel ensesle enseesl enseels enseles enselse
enslsee enslsee enslese enslees enslees enslese enessel enessle enesesl enesels enesles
eneslse enessel enessle enesesl enesels enesles eneslse eneessl eneesls eneessl eneesls
eneelss eneelss enelses enelsse eneless eneless enelses enelsse ensesel ensesle enseesl
enseels enseles enselse ensseel enssele ensseel enssele ensslee ensslee ensesel ensesle
enseesl enseels enseles enselse enslsee enslsee enslese enslees enslees enslese eneessl
eneesls eneessl eneesls eneelss eneelss enesesl enesels enessel enessle eneslse enesles
enessel enessle enesesl enesels enesles eneslse enelsse enelses enelsse enelses eneless
eneless enleses enlesse enleess enleess enleses enlesse enlsees enlsese enlsees enlsese
enlssee enlssee enleses enlesse enleess enleess enleses enlesse enlssee enlssee enlsese
enlsees enlsees enlsese elsesne elsesen elsense elsenes elseens elseesn elssene elsseen
elssnee elssnee elssene elsseen elsnsee elsnsee elsnese elsnees elsnees elsnese elsesne
elsesen elsense elsenes elseens elseesn elessne elessen elesnse elesnes elesens elesesn
elessne elessen elesnse elesnes elesens elesesn elensse elenses elensse elenses eleness
eleness eleesns eleessn eleenss eleenss eleesns eleessn elsesne elsesen elsense elsenes
elseens elseesn elssene elsseen elssnee elssnee elssene elsseen elsnsee elsnsee elsnese
elsnees elsnees elsnese elsesne elsesen elsense elsenes elseens elseesn elnesse elneses
elnesse elneses elneess elneess elnsese elnsees elnssee elnssee elnsese elnsees elnssee
elnssee elnsese elnsees elnsees elnsese elnesse elneses elnesse elneses elneess elneess
eleesns eleessn eleenss eleenss eleesns eleessn elesens elesesn elesnes elesnse elessne
elessen elenses elensse eleness eleness elenses elensse elessne elessen elesnse elesnes
elesens elesesn

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us