easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

mactetisque

pressed

radburn

inconvenience

shaftment

predictiveness

pagurine

redbed

condiction

helmetmaker

legalised

chirognomy

carelli

pontarf

filamentosus

sprachle

bauch

ptolemaical


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: lehrer
cipher variations:
mfisfs ngjtgt ohkuhu pilviv qjmwjw
rknxkx sloyly tmpzmz unqana vorbob
wpscpc xqtdqd yruere zsvfsf atwgtg
buxhuh cvyivi dwzjwj exakxk fyblyl
gzcmzm hadnan ibeobo jcfpcp kdgqdq

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: lehrer
Cipher: ovsivi

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: lehrer
Cipher: ABABA AABAA AABBB BAAAA AABAA BAAAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: lehrer
cipher variations:
mfisfsinwanaevkiviadyqdqwlmylystagtgkjcwjwgrqere
czemzmyhsuhuupgcpcqxukxkngjtgtjoxbobfwljwjbezrer
xmnzmztubhuhlkdxkxhsrfsfdafnanzitvivvqhdqdryvlyl
ohkuhukpycpcgxmkxkcfasfsynoanauvcivimleylyitsgtg
ebgoboajuwjwwriereszwmzmpilvivlqzdqdhynlyldgbtgt
zopbobvwdjwjnmfzmzjuthuhfchpcpbkvxkxxsjfsftaxnan
qjmwjwmraereizomzmehcuhuapqcpcwxekxkonganakvuivi
gdiqdqclwylyytkgtgubyoborknxkxnsbfsfjapnanfidviv
bqrdqdxyflylpohboblwvjwjhejrerdmxzmzzulhuhvczpcp
sloylyotcgtgkbqobogjewjwcrsereyzgmzmqpicpcmxwkxk
ifksfsenyanaavmiviwdaqdqtmpzmzpudhuhlcrpcphkfxkx
dstfsfzahnanrqjdqdnyxlyljgltgtfozbobbwnjwjxebrer
unqanaqveivimdsqdqilgylyetugtgabiobosrkereozymzm
khmuhugpacpccxokxkyfcsfsvorbobrwfjwjnetrerjmhzmz
fuvhuhbcjpcptslfsfpaznanlinvivhqbdqddyplylzgdtgt
wpscpcsxgkxkofusfsknianagvwivicdkqdqutmgtgqbaobo
mjowjwircereezqmzmaheuhuxqtdqdtyhlylpgvtgtlojbob
hwxjwjdelrervunhuhrcbpcpnkpxkxjsdfsffarnanbifviv
yruereuzimzmqhwuhumpkcpcixykxkefmsfswvoivisdcqdq
olqylyktegtggbsobocjgwjwzsvfsfvajnanrixvivnqldqd
jyzlylfgntgtxwpjwjtedrerpmrzmzlufhuhhctpcpdkhxkx
atwgtgwbkobosjywjwormerekzamzmghouhuyxqkxkufesfs
qnsanamvgiviiduqdqeliylybuxhuhxclpcptkzxkxpsnfsf
labnanhipvivzyrlylvgftgtrotbobnwhjwjjevrerfmjzmz
cvyiviydmqdqulaylyqtogtgmbcoboijqwjwazsmzmwhguhu
spucpcoxikxkkfwsfsgnkanadwzjwjzenrervmbzmzruphuh
ncdpcpjkrxkxbatnanxihvivtqvdqdpyjlyllgxtgtholbob
exakxkafosfswncanasvqiviodeqdqklsylycbuoboyjiwjw
urwereqzkmzmmhyuhuipmcpcfyblylbgptgtxodbobtwrjwj
pefrerlmtzmzdcvpcpzkjxkxvsxfsfralnannizvivjqndqd
gzcmzmchquhuypecpcuxskxkqfgsfsmnuanaedwqdqalkyly
wtygtgsbmoboojawjwkroerehadnandirvivzqfdqdvytlyl
rghtgtnovbobfexrerbmlzmzxuzhuhtcnpcppkbxkxlspfsf
ibeoboejswjwargerewzumzmshiuhuopwcpcgfysfscnmana
yvaiviudoqdqqlcylymtqgtgjcfpcpfktxkxbshfsfxavnan
tijvivpqxdqdhgztgtdonbobzwbjwjveprerrmdzmznurhuh
kdgqdqgluylyctigtgybwoboujkwjwqryereihauhuepocpc
axckxkwfqsfssneanaovsivilehrerhmvzmzdujhuhzcxpcp
vklxkxrszfsfjibvivfqpdqdbydlylxgrtgttofbobpwtjwj

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: lehrer
Cipher: yruere

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: lehrer
Cipher: 135132245124

Extended Methods:
Method #1

Plaintext: lehrer
method variations:
qknwkwvpsbpbauxgugfzcmzm

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
l e h r e r 
1 5 3 2 5 2 
3 1 2 4 1 4 
They are then read out in rows:
153252312414
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: lehrer
Cipher: vhkcrq

Read more ...
Method #3

Plaintext: lehrer
method variations:
xlgyfd lgyfdx gyfdxl
yfdxlg fdxlgy dxlgyf

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: lehrer

all 720 cipher variations:
lehrer lehrre leherr leherr lehrer lehrre lerher lerhre lerehr lererh lerreh
lerrhe leerhr leerrh leehrr leehrr leerhr leerrh lerreh lerrhe lererh lerehr
lerher lerhre lherer lherre lheerr lheerr lherer lherre lhreer lhrere lhreer
lhrere lhrree lhrree lherer lherre lheerr lheerr lherer lherre lhrree lhrree
lhrere lhreer lhreer lhrere lrheer lrhere lrheer lrhere lrhree lrhree lreher
lrehre lreehr lreerh lrereh lrerhe lreehr lreerh lreher lrehre lrerhe lrereh
lrreeh lrrehe lrreeh lrrehe lrrhee lrrhee lehrer lehrre leherr leherr lehrer
lehrre lerher lerhre lerehr lererh lerreh lerrhe leerhr leerrh leehrr leehrr
leerhr leerrh lerreh lerrhe lererh lerehr lerher lerhre lrhree lrhree lrhere
lrheer lrheer lrhere lrrhee lrrhee lrrehe lrreeh lrreeh lrrehe lrerhe lrereh
lrehre lreher lreehr lreerh lrereh lrerhe lreerh lreehr lreher lrehre elhrer
elhrre elherr elherr elhrer elhrre elrher elrhre elrehr elrerh elrreh elrrhe
elerhr elerrh elehrr elehrr elerhr elerrh elrreh elrrhe elrerh elrehr elrher
elrhre ehlrer ehlrre ehlerr ehlerr ehlrer ehlrre ehrler ehrlre ehrelr ehrerl
ehrrel ehrrle eherlr eherrl ehelrr ehelrr eherlr eherrl ehrrel ehrrle ehrerl
ehrelr ehrler ehrlre erhler erhlre erhelr erherl erhrel erhrle erlher erlhre
erlehr erlerh erlreh erlrhe erelhr erelrh erehlr erehrl ererhl ererlh errleh
errlhe errelh errehl errhel errhle eehrlr eehrrl eehlrr eehlrr eehrlr eehrrl
eerhlr eerhrl eerlhr eerlrh eerrlh eerrhl eelrhr eelrrh eelhrr eelhrr eelrhr
eelrrh eerrlh eerrhl eerlrh eerlhr eerhlr eerhrl erhrel erhrle erherl erhelr
erhler erhlre errhel errhle errehl errelh errleh errlhe ererhl ererlh erehrl
erehlr erelhr erelrh erlreh erlrhe erlerh erlehr erlher erlhre helrer helrre
helerr helerr helrer helrre herler herlre herelr hererl herrel herrle heerlr
heerrl heelrr heelrr heerlr heerrl herrel herrle hererl herelr herler herlre
hlerer hlerre hleerr hleerr hlerer hlerre hlreer hlrere hlreer hlrere hlrree
hlrree hlerer hlerre hleerr hleerr hlerer hlerre hlrree hlrree hlrere hlreer
hlreer hlrere hrleer hrlere hrleer hrlere hrlree hrlree hreler hrelre hreelr
hreerl hrerel hrerle hreelr hreerl hreler hrelre hrerle hrerel hrreel hrrele
hrreel hrrele hrrlee hrrlee helrer helrre helerr helerr helrer helrre herler
herlre herelr hererl herrel herrle heerlr heerrl heelrr heelrr heerlr heerrl
herrel herrle hererl herelr herler herlre hrlree hrlree hrlere hrleer hrleer
hrlere hrrlee hrrlee hrrele hrreel hrreel hrrele hrerle hrerel hrelre hreler
hreelr hreerl hrerel hrerle hreerl hreelr hreler hrelre rehler rehlre rehelr
reherl rehrel rehrle relher relhre relehr relerh relreh relrhe reelhr reelrh
reehlr reehrl reerhl reerlh rerleh rerlhe rerelh rerehl rerhel rerhle rheler
rhelre rheelr rheerl rherel rherle rhleer rhlere rhleer rhlere rhlree rhlree
rheler rhelre rheelr rheerl rherel rherle rhrlee rhrlee rhrele rhreel rhreel
rhrele rlheer rlhere rlheer rlhere rlhree rlhree rleher rlehre rleehr rleerh
rlereh rlerhe rleehr rleerh rleher rlehre rlerhe rlereh rlreeh rlrehe rlreeh
rlrehe rlrhee rlrhee rehler rehlre rehelr reherl rehrel rehrle relher relhre
relehr relerh relreh relrhe reelhr reelrh reehlr reehrl reerhl reerlh rerleh
rerlhe rerelh rerehl rerhel rerhle rrhlee rrhlee rrhele rrheel rrheel rrhele
rrlhee rrlhee rrlehe rrleeh rrleeh rrlehe rrelhe rreleh rrehle rrehel rreehl
rreelh rreleh rrelhe rreelh rreehl rrehel rrehle eehrlr eehrrl eehlrr eehlrr
eehrlr eehrrl eerhlr eerhrl eerlhr eerlrh eerrlh eerrhl eelrhr eelrrh eelhrr
eelhrr eelrhr eelrrh eerrlh eerrhl eerlrh eerlhr eerhlr eerhrl eherlr eherrl
ehelrr ehelrr eherlr eherrl ehrelr ehrerl ehrler ehrlre ehrrle ehrrel ehlrer
ehlrre ehlerr ehlerr ehlrer ehlrre ehrrle ehrrel ehrlre ehrler ehrelr ehrerl
erhelr erherl erhler erhlre erhrle erhrel erehlr erehrl erelhr erelrh ererlh
ererhl erlehr erlerh erlher erlhre erlrhe erlreh errelh errehl errleh errlhe
errhle errhel elhrer elhrre elherr elherr elhrer elhrre elrher elrhre elrehr
elrerh elrreh elrrhe elerhr elerrh elehrr elehrr elerhr elerrh elrreh elrrhe
elrerh elrehr elrher elrhre erhrle erhrel erhlre erhler erhelr erherl errhle
errhel errlhe errleh errelh errehl erlrhe erlreh erlhre erlher erlehr erlerh
ererlh ererhl erelrh erelhr erehlr erehrl rehrel rehrle reherl rehelr rehler
rehlre rerhel rerhle rerehl rerelh rerleh rerlhe reerhl reerlh reehrl reehlr
reelhr reelrh relreh relrhe relerh relehr relher relhre rherel rherle rheerl
rheelr rheler rhelre rhreel rhrele rhreel rhrele rhrlee rhrlee rherel rherle
rheerl rheelr rheler rhelre rhlree rhlree rhlere rhleer rhleer rhlere rrheel
rrhele rrheel rrhele rrhlee rrhlee rrehel rrehle rreehl rreelh rreleh rrelhe
rreehl rreelh rrehel rrehle rrelhe rreleh rrleeh rrlehe rrleeh rrlehe rrlhee
rrlhee rehrel rehrle reherl rehelr rehler rehlre rerhel rerhle rerehl rerelh
rerleh rerlhe reerhl reerlh reehrl reehlr reelhr reelrh relreh relrhe relerh
relehr relher relhre rlhree rlhree rlhere rlheer rlheer rlhere rlrhee rlrhee
rlrehe rlreeh rlreeh rlrehe rlerhe rlereh rlehre rleher rleehr rleerh rlereh
rlerhe rleerh rleehr rleher rlehre

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us