easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

trenaman

babylonite

pugilists

unjoyfulness

cravens

uncombine

campeche

njord

expansionary

biracial

syclone

flavimonas

gitonin

rosensfole

partitura

sunless

wieland

navigiisque


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: lebert
cipher variations:
mfcfsu ngdgtv ohehuw pifivx qjgjwy
rkhkxz slilya tmjmzb unknac volobd
wpmpce xqnqdf yroreg zspsfh atqtgi
buruhj cvsvik dwtwjl exuxkm fyvyln
gzwzmo haxanp ibyboq jczcpr kdadqs

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: lebert
Cipher: ovyvig

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: lebert
Cipher: ABABA AABAA AAAAB AABAA BAAAA BAABA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: lebert
cipher variations:
mfcfsuinenagevgvisadidqewlklyqstmtgckjqjwagrsrem
czuzmyyhwhukupypcwqxaxkingdgtvjofobhfwhwjtbejerf
xmlmzrtunuhdlkrkxbhstsfndavanzzixivlvqzqdxrybylj
ohehuwkpgpcigxixkucfkfsgynmnasuvoviemlslycitutgo
ebwboaajyjwmwrareyszczmkpifivxlqhqdjhyjylvdglgth
zonobtvwpwjfnmtmzdjuvuhpfcxcpbbkzkxnxsbsfztadanl
qjgjwymrirekizkzmwehmhuiapopcuwxqxkgonunaekvwviq
gdydqcclalyoytctgaubebomrkhkxznsjsfljalanxfinivj
bqpqdvxyrylhpovobflwxwjrhezerddmbmzpzuduhbvcfcpn
slilyaotktgmkbmboygjojwkcrqrewyzszmiqpwpcgmxyxks
ifafseencnaqavevicwdgdqotmjmzbpuluhnlcncpzhkpkxl
dsrsfxzatanjrqxqdhnyzyltjgbgtffodobrbwfwjdxeherp
unknacqvmviomdodqailqlymetstgyabuboksryreiozazmu
khchuggpepcscxgxkeyfifsqvolobdrwnwjpneperbjmrmzn
futuhzbcvcpltszsfjpabanvlidivhhqfqdtdyhylfzgjgtr
wpmpcesxoxkqofqfscknsnaogvuviacdwdqmutatgkqbcbow
mjejwiirgreuezizmgahkhusxqnqdftypylrpgrgtdlotobp
hwvwjbdexernvubuhlrcdcpxnkfkxjjshsfvfajanhbilivt
yroreguzqzmsqhshuempupcqixwxkcefyfsowvcvimsdedqy
olglykktitgwgbkboicjmjwuzspsfhvarantritivfnqvqdr
jyxyldfgzgtpxwdwjnteferzpmhmzllujuhxhclcpjdknkxv
atqtgiwbsbousjujwgorwreskzyzmeghahuqyxexkoufgfsa
qninammvkviyidmdqkelolywburuhjxctcpvtkvkxhpsxsft
lazanfhibivrzyfylpvghgtbrojobnnwlwjzjenerlfmpmzx
cvsvikydudqwulwlyiqtytgumbabogijcjwsazgzmqwhihuc
spkpcooxmxkakfofsmgnqnaydwtwjlzeverxvmxmzjruzuhv
ncbcphjkdkxtbahanrxijivdtqlqdppynylblgpgtnhorobz
exuxkmafwfsywnynaksvaviwodcdqiklelyucbibosyjkjwe
urmreqqzozmcmhqhuoipspcafyvylnbgxgtzxozobltwbwjx
pederjlmfmzvdcjcptzklkxfvsnsfrrapandnirivpjqtqdb
gzwzmochyhuaypapcmuxcxkyqfefskmngnawedkdqualmlyg
wtotgssbqboeojsjwqkrurechaxanpdizivbzqbqdnvydylz
rgfgtlnohobxfelervbmnmzhxupuhttcrcpfpktkxrlsvsfd
ibyboqejajwcarcreowzezmashghumopipcygfmfswcnonai
yvqviuudsdqgqlulysmtwtgejczcprfkbkxdbsdsfpxafanb
tihivnpqjqdzhgngtxdopobjzwrwjvveterhrmvmztnuxuhf
kdadqsglclyectetgqybgbocujijwoqrkreaihohuyepqpck
axsxkwwfufsisnwnauovyvigleberthmdmzfdufuhrzchcpd
vkjkxprslsfbjipivzfqrqdlbytylxxgvgtjtoxobvpwzwjh

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: lebert
Cipher: yroreg

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: lebert
Cipher: 135121512444

Extended Methods:
Method #1

Plaintext: lebert
method variations:
qkgkwyvpmpbdaurugifzwzmo

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
l e b e r t 
1 5 2 5 2 4 
3 1 1 1 4 4 
They are then read out in rows:
152524311144
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: lebert
Cipher: vwrcat

Read more ...
Method #3

Plaintext: lebert
method variations:
xfvftd fvftdx vftdxf
ftdxfv tdxfvf dxfvft

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: lebert

all 720 cipher variations:
lebert lebetr lebret lebrte lebtre lebter leebrt leebtr leerbt leertb leetrb
leetbr lerebt leretb lerbet lerbte lertbe lerteb leterb letebr letreb letrbe
letbre letber lbeert lbeetr lberet lberte lbetre lbeter lbeert lbeetr lberet
lberte lbetre lbeter lbreet lbrete lbreet lbrete lbrtee lbrtee lbtere lbteer
lbtree lbtree lbtere lbteer lebert lebetr lebret lebrte lebtre lebter leebrt
leebtr leerbt leertb leetrb leetbr lerebt leretb lerbet lerbte lertbe lerteb
leterb letebr letreb letrbe letbre letber lrbeet lrbete lrbeet lrbete lrbtee
lrbtee lrebet lrebte lreebt lreetb lreteb lretbe lreebt lreetb lrebet lrebte
lretbe lreteb lrteeb lrtebe lrteeb lrtebe lrtbee lrtbee ltbere ltbeer ltbree
ltbree ltbere ltbeer ltebre lteber lterbe ltereb lteerb lteebr ltrebe ltreeb
ltrbee ltrbee ltrebe ltreeb lteerb lteebr ltereb lterbe ltebre lteber elbert
elbetr elbret elbrte elbtre elbter elebrt elebtr elerbt elertb eletrb eletbr
elrebt elretb elrbet elrbte elrtbe elrteb elterb eltebr eltreb eltrbe eltbre
eltber eblert ebletr eblret eblrte ebltre eblter ebelrt ebeltr eberlt ebertl
ebetrl ebetlr ebrelt ebretl ebrlet ebrlte ebrtle ebrtel ebterl ebtelr ebtrel
ebtrle ebtlre ebtler eeblrt eebltr eebrlt eebrtl eebtrl eebtlr eelbrt eelbtr
eelrbt eelrtb eeltrb eeltbr eerlbt eerltb eerblt eerbtl eertbl eertlb eetlrb
eetlbr eetrlb eetrbl eetbrl eetblr erbelt erbetl erblet erblte erbtle erbtel
ereblt erebtl erelbt ereltb eretlb eretbl erlebt erletb erlbet erlbte erltbe
erlteb ertelb ertebl ertleb ertlbe ertble ertbel etberl etbelr etbrel etbrle
etblre etbler etebrl eteblr eterbl eterlb etelrb etelbr etrebl etrelb etrbel
etrble etrlbe etrleb etlerb etlebr etlreb etlrbe etlbre etlber belert beletr
belret belrte beltre belter beelrt beeltr beerlt beertl beetrl beetlr berelt
beretl berlet berlte bertle bertel beterl betelr betrel betrle betlre betler
bleert bleetr bleret blerte bletre bleter bleert bleetr bleret blerte bletre
bleter blreet blrete blreet blrete blrtee blrtee bltere blteer bltree bltree
bltere blteer belert beletr belret belrte beltre belter beelrt beeltr beerlt
beertl beetrl beetlr berelt beretl berlet berlte bertle bertel beterl betelr
betrel betrle betlre betler brleet brlete brleet brlete brltee brltee brelet
brelte breelt breetl bretel bretle breelt breetl brelet brelte bretle bretel
brteel brtele brteel brtele brtlee brtlee btlere btleer btlree btlree btlere
btleer btelre bteler bterle bterel bteerl bteelr btrele btreel btrlee btrlee
btrele btreel bteerl bteelr bterel bterle btelre bteler eeblrt eebltr eebrlt
eebrtl eebtrl eebtlr eelbrt eelbtr eelrbt eelrtb eeltrb eeltbr eerlbt eerltb
eerblt eerbtl eertbl eertlb eetlrb eetlbr eetrlb eetrbl eetbrl eetblr ebelrt
ebeltr eberlt ebertl ebetrl ebetlr eblert ebletr eblret eblrte ebltre eblter
ebrlet ebrlte ebrelt ebretl ebrtel ebrtle ebtlre ebtler ebtrle ebtrel ebterl
ebtelr elbert elbetr elbret elbrte elbtre elbter elebrt elebtr elerbt elertb
eletrb eletbr elrebt elretb elrbet elrbte elrtbe elrteb elterb eltebr eltreb
eltrbe eltbre eltber erblet erblte erbelt erbetl erbtel erbtle erlbet erlbte
erlebt erletb erlteb erltbe erelbt ereltb ereblt erebtl eretbl eretlb ertleb
ertlbe ertelb ertebl ertbel ertble etblre etbler etbrle etbrel etberl etbelr
etlbre etlber etlrbe etlreb etlerb etlebr etrlbe etrleb etrble etrbel etrebl
etrelb etelrb etelbr eterlb eterbl etebrl eteblr rebelt rebetl reblet reblte
rebtle rebtel reeblt reebtl reelbt reeltb reetlb reetbl relebt reletb relbet
relbte reltbe relteb retelb retebl retleb retlbe retble retbel rbeelt rbeetl
rbelet rbelte rbetle rbetel rbeelt rbeetl rbelet rbelte rbetle rbetel rbleet
rblete rbleet rblete rbltee rbltee rbtele rbteel rbtlee rbtlee rbtele rbteel
rebelt rebetl reblet reblte rebtle rebtel reeblt reebtl reelbt reeltb reetlb
reetbl relebt reletb relbet relbte reltbe relteb retelb retebl retleb retlbe
retble retbel rlbeet rlbete rlbeet rlbete rlbtee rlbtee rlebet rlebte rleebt
rleetb rleteb rletbe rleebt rleetb rlebet rlebte rletbe rleteb rlteeb rltebe
rlteeb rltebe rltbee rltbee rtbele rtbeel rtblee rtblee rtbele rtbeel rteble
rtebel rtelbe rteleb rteelb rteebl rtlebe rtleeb rtlbee rtlbee rtlebe rtleeb
rteelb rteebl rteleb rtelbe rteble rtebel teberl tebelr tebrel tebrle teblre
tebler teebrl teeblr teerbl teerlb teelrb teelbr terebl terelb terbel terble
terlbe terleb telerb telebr telreb telrbe telbre telber tbeerl tbeelr tberel
tberle tbelre tbeler tbeerl tbeelr tberel tberle tbelre tbeler tbreel tbrele
tbreel tbrele tbrlee tbrlee tblere tbleer tblree tblree tblere tbleer teberl
tebelr tebrel tebrle teblre tebler teebrl teeblr teerbl teerlb teelrb teelbr
terebl terelb terbel terble terlbe terleb telerb telebr telreb telrbe telbre
telber trbeel trbele trbeel trbele trblee trblee trebel treble treebl treelb
treleb trelbe treebl treelb trebel treble trelbe treleb trleeb trlebe trleeb
trlebe trlbee trlbee tlbere tlbeer tlbree tlbree tlbere tlbeer tlebre tleber
tlerbe tlereb tleerb tleebr tlrebe tlreeb tlrbee tlrbee tlrebe tlreeb tleerb
tleebr tlereb tlerbe tlebre tleber

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us