easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

starace

treverim

uouerimus

theemim

faroese

combats

amphisbaenian

alodian

undulative

undines

uthou

unaccoutred

undeservedly

hemiplegia

gyros

fossasque

cofathership

chirotony


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: laadan
cipher variations:
mbbebo nccfcp oddgdq peeher qffifs
rggjgt shhkhu tiiliv ujjmjw vkknkx
wlloly xmmpmz ynnqna zoorob appspc
bqqtqd crrure dssvsf ettwtg fuuxuh
gvvyvi hwwzwj ixxaxk jyybyl kzzczm

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: laadan
Cipher: ozzwzm

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: laadan
Cipher: ABABA AAAAA AAAAA AAABB AAAAA ABBAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: laadan
cipher variations:
mbbeboibbkboebbqboabbwbowbbcbosbbibokbbubogbbabo
cbbgboybbmboubbsboqbbybonccfcpjcclcpfccrcpbccxcp
xccdcptccjcplccvcphccbcpdcchcpzccncpvcctcprcczcp
oddgdqkddmdqgddsdqcddydqyddedquddkdqmddwdqiddcdq
eddidqaddodqwddudqsddadqpeeherleenerheeterdeezer
zeeferveelerneexerjeederfeejerbeeperxeeverteeber
qffifsmffofsiffufseffafsaffgfswffmfsoffyfskffefs
gffkfscffqfsyffwfsuffcfsrggjgtnggpgtjggvgtfggbgt
bgghgtxggngtpggzgtlggfgthgglgtdggrgtzggxgtvggdgt
shhkhuohhqhukhhwhughhchuchhihuyhhohuqhhahumhhghu
ihhmhuehhshuahhyhuwhhehutiilivpiirivliixivhiidiv
diijivziipivriibivniihivjiinivfiitivbiizivxiifiv
ujjmjwqjjsjwmjjyjwijjejwejjkjwajjqjwsjjcjwojjijw
kjjojwgjjujwcjjajwyjjgjwvkknkxrkktkxnkkzkxjkkfkx
fkklkxbkkrkxtkkdkxpkkjkxlkkpkxhkkvkxdkkbkxzkkhkx
wllolysllulyollalykllglygllmlycllslyullelyqllkly
mllqlyillwlyellclyallilyxmmpmztmmvmzpmmbmzlmmhmz
hmmnmzdmmtmzvmmfmzrmmlmznmmrmzjmmxmzfmmdmzbmmjmz
ynnqnaunnwnaqnncnamnninainnonaennunawnngnasnnmna
onnsnaknnynagnnenacnnknazoorobvooxobroodobnoojob
joopobfoovobxoohobtoonobpootobloozobhoofobdoolob
appspcwppypcsppepcoppkpckppqpcgppwpcyppipcuppopc
qppupcmppapcippgpceppmpcbqqtqdxqqzqdtqqfqdpqqlqd
lqqrqdhqqxqdzqqjqdvqqpqdrqqvqdnqqbqdjqqhqdfqqnqd
crrureyrrareurrgreqrrmremrrsreirryrearrkrewrrqre
srrwreorrcrekrriregrroredssvsfzssbsfvsshsfrssnsf
nsstsfjsszsfbsslsfxssrsftssxsfpssdsflssjsfhsspsf
ettwtgattctgwttitgsttotgottutgkttatgcttmtgyttstg
uttytgqttetgmttktgittqtgfuuxuhbuuduhxuujuhtuupuh
puuvuhluubuhduunuhzuutuhvuuzuhruufuhnuuluhjuuruh
gvvyvicvveviyvvkviuvvqviqvvwvimvvcvievvoviavvuvi
wvvavisvvgviovvmvikvvsvihwwzwjdwwfwjzwwlwjvwwrwj
rwwxwjnwwdwjfwwpwjbwwvwjxwwbwjtwwhwjpwwnwjlwwtwj
ixxaxkexxgxkaxxmxkwxxsxksxxyxkoxxexkgxxqxkcxxwxk
yxxcxkuxxixkqxxoxkmxxuxkjyybylfyyhylbyynylxyytyl
tyyzylpyyfylhyyryldyyxylzyydylvyyjylryypylnyyvyl
kzzczmgzzizmczzozmyzzuzmuzzazmqzzgzmizzszmezzyzm
azzezmwzzkzmszzqzmozzwzmlaadanhaajandaapanzaavan
vaabanraahanjaatanfaazanbaafanxaalantaaranpaaxan

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: laadan
Cipher: ynnqna

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: laadan
Cipher: 131111411133

Extended Methods:
Method #1

Plaintext: laadan
method variations:
qffifsvllolxaqqtqcfvvyvh

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
l a a d a n 
1 1 1 4 1 3 
3 1 1 1 1 3 
They are then read out in rows:
111413311113
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: laadan
Cipher: aqlcal

Read more ...
Method #3

Plaintext: laadan
method variations:
caqalc aqalcc qalcca
alccaq lccaqa ccaqal

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: laadan

all 720 cipher variations:
laadan laadna laaadn laaand laanad laanda ladaan ladana ladaan ladana ladnaa
ladnaa laadan laadna laaadn laaand laanad laanda landaa landaa lanada lanaad
lanaad lanada laadan laadna laaadn laaand laanad laanda ladaan ladana ladaan
ladana ladnaa ladnaa laadan laadna laaadn laaand laanad laanda landaa landaa
lanada lanaad lanaad lanada ldaaan ldaana ldaaan ldaana ldanaa ldanaa ldaaan
ldaana ldaaan ldaana ldanaa ldanaa ldaaan ldaana ldaaan ldaana ldanaa ldanaa
ldnaaa ldnaaa ldnaaa ldnaaa ldnaaa ldnaaa laadan laadna laaadn laaand laanad
laanda ladaan ladana ladaan ladana ladnaa ladnaa laadan laadna laaadn laaand
laanad laanda landaa landaa lanada lanaad lanaad lanada lnadaa lnadaa lnaada
lnaaad lnaaad lnaada lndaaa lndaaa lndaaa lndaaa lndaaa lndaaa lnadaa lnadaa
lnaada lnaaad lnaaad lnaada lnadaa lnadaa lnaada lnaaad lnaaad lnaada aladan
aladna alaadn alaand alanad alanda aldaan aldana aldaan aldana aldnaa aldnaa
aladan aladna alaadn alaand alanad alanda alndaa alndaa alnada alnaad alnaad
alnada aaldan aaldna aaladn aaland aalnad aalnda aadlan aadlna aadaln aadanl
aadnal aadnla aaadln aaadnl aaaldn aaalnd aaanld aaandl aandal aandla aanadl
aanald aanlad aanlda adalan adalna adaaln adaanl adanal adanla adlaan adlana
adlaan adlana adlnaa adlnaa adalan adalna adaaln adaanl adanal adanla adnlaa
adnlaa adnala adnaal adnaal adnala aaadln aaadnl aaaldn aaalnd aaanld aaandl
aadaln aadanl aadlan aadlna aadnla aadnal aaldan aaldna aaladn aaland aalnad
aalnda aandla aandal aanlda aanlad aanald aanadl anadal anadla anaadl anaald
analad analda andaal andala andaal andala andlaa andlaa anadal anadla anaadl
anaald analad analda anldaa anldaa anlada anlaad anlaad anlada aaldan aaldna
aaladn aaland aalnad aalnda aadlan aadlna aadaln aadanl aadnal aadnla aaadln
aaadnl aaaldn aaalnd aaanld aaandl aandal aandla aanadl aanald aanlad aanlda
aladan aladna alaadn alaand alanad alanda aldaan aldana aldaan aldana aldnaa
aldnaa aladan aladna alaadn alaand alanad alanda alndaa alndaa alnada alnaad
alnaad alnada adlaan adlana adlaan adlana adlnaa adlnaa adalan adalna adaaln
adaanl adanal adanla adaaln adaanl adalan adalna adanla adanal adnaal adnala
adnaal adnala adnlaa adnlaa aaldan aaldna aaladn aaland aalnad aalnda aadlan
aadlna aadaln aadanl aadnal aadnla aaadln aaadnl aaaldn aaalnd aaanld aaandl
aandal aandla aanadl aanald aanlad aanlda anldaa anldaa anlada anlaad anlaad
anlada andlaa andlaa andala andaal andaal andala anadla anadal analda analad
anaald anaadl anadal anadla anaadl anaald analad analda daalan daalna daaaln
daaanl daanal daanla dalaan dalana dalaan dalana dalnaa dalnaa daalan daalna
daaaln daaanl daanal daanla danlaa danlaa danala danaal danaal danala daalan
daalna daaaln daaanl daanal daanla dalaan dalana dalaan dalana dalnaa dalnaa
daalan daalna daaaln daaanl daanal daanla danlaa danlaa danala danaal danaal
danala dlaaan dlaana dlaaan dlaana dlanaa dlanaa dlaaan dlaana dlaaan dlaana
dlanaa dlanaa dlaaan dlaana dlaaan dlaana dlanaa dlanaa dlnaaa dlnaaa dlnaaa
dlnaaa dlnaaa dlnaaa daalan daalna daaaln daaanl daanal daanla dalaan dalana
dalaan dalana dalnaa dalnaa daalan daalna daaaln daaanl daanal daanla danlaa
danlaa danala danaal danaal danala dnalaa dnalaa dnaala dnaaal dnaaal dnaala
dnlaaa dnlaaa dnlaaa dnlaaa dnlaaa dnlaaa dnalaa dnalaa dnaala dnaaal dnaaal
dnaala dnalaa dnalaa dnaala dnaaal dnaaal dnaala aaadln aaadnl aaaldn aaalnd
aaanld aaandl aadaln aadanl aadlan aadlna aadnla aadnal aaldan aaldna aaladn
aaland aalnad aalnda aandla aandal aanlda aanlad aanald aanadl aaadln aaadnl
aaaldn aaalnd aaanld aaandl aadaln aadanl aadlan aadlna aadnla aadnal aaldan
aaldna aaladn aaland aalnad aalnda aandla aandal aanlda aanlad aanald aanadl
adaaln adaanl adalan adalna adanla adanal adaaln adaanl adalan adalna adanla
adanal adlaan adlana adlaan adlana adlnaa adlnaa adnala adnaal adnlaa adnlaa
adnala adnaal aladan aladna alaadn alaand alanad alanda aldaan aldana aldaan
aldana aldnaa aldnaa aladan aladna alaadn alaand alanad alanda alndaa alndaa
alnada alnaad alnaad alnada anadla anadal analda analad anaald anaadl andala
andaal andlaa andlaa andala andaal anldaa anldaa anlada anlaad anlaad anlada
anadla anadal analda analad anaald anaadl naadal naadla naaadl naaald naalad
naalda nadaal nadala nadaal nadala nadlaa nadlaa naadal naadla naaadl naaald
naalad naalda naldaa naldaa nalada nalaad nalaad nalada naadal naadla naaadl
naaald naalad naalda nadaal nadala nadaal nadala nadlaa nadlaa naadal naadla
naaadl naaald naalad naalda naldaa naldaa nalada nalaad nalaad nalada ndaaal
ndaala ndaaal ndaala ndalaa ndalaa ndaaal ndaala ndaaal ndaala ndalaa ndalaa
ndaaal ndaala ndaaal ndaala ndalaa ndalaa ndlaaa ndlaaa ndlaaa ndlaaa ndlaaa
ndlaaa naadal naadla naaadl naaald naalad naalda nadaal nadala nadaal nadala
nadlaa nadlaa naadal naadla naaadl naaald naalad naalda naldaa naldaa nalada
nalaad nalaad nalada nladaa nladaa nlaada nlaaad nlaaad nlaada nldaaa nldaaa
nldaaa nldaaa nldaaa nldaaa nladaa nladaa nlaada nlaaad nlaaad nlaada nladaa
nladaa nlaada nlaaad nlaaad nlaada

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us