easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

poulin

unconstitutionality

thermoscope

psyvax

jimoli

woodsilver

nashboro

attigeritque

skyscape

trefz

pustolov

compagney

secundaverunt

strater

breadthless

giampiero

scrapped

surprisers


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: kreese
cipher variations:
lsfftf mtggug nuhhvh oviiwi pwjjxj
qxkkyk ryllzl szmmam tannbn ubooco
vcppdp wdqqeq xerrfr yfssgs zgttht
ahuuiu bivvjv cjwwkw dkxxlx elyymy
fmzznz gnaaoa hobbpb ipccqc jqddrd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: kreese
Cipher: pivvhv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: kreese
Cipher: ABAAB BAAAA AABAA AABAA BAAAB AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: kreese
cipher variations:
lsfftffanndnzivvnvtqddxdnyllhlhgttrtvwjjljperrvr
jmzzfzduhhphxcppzprkxxjxmtgguggbooeoajwwowureeye
ozmmimihuusuwxkkmkqfsswsknaagaeviiqiydqqaqslyyky
nuhhvhhcppfpbkxxpxvsffzfpannjnjivvtvxyllnlrgttxt
lobbhbfwjjrjzerrbrtmzzlzoviiwiidqqgqclyyqywtggag
qbookokjwwuwyzmmomshuuyumpccicgxkkskafsscsunaama
pwjjxjjerrhrdmzzrzxuhhbhrcpplplkxxvxzannpntivvzv
nqddjdhylltlbgttdtvobbnbqxkkykkfssisenaasayviici
sdqqmqmlyywyabooqoujwwaworeekeizmmumchuueuwpccoc
ryllzllgttjtfobbtbzwjjdjterrnrnmzzxzbcpprpvkxxbx
psfflfjannvndivvfvxqddpdszmmammhuukugpccucaxkkek
ufssosonaayacdqqsqwlyycyqtggmgkboowoejwwgwyreeqe
tannbnnivvlvhqddvdbyllflvgttptpobbzbderrtrxmzzdz
ruhhnhlcppxpfkxxhxzsffrfuboocoojwwmwireeweczmmgm
whuuquqpccacefssusynaaeasviioimdqqyqglyyiyatggsg
vcppdppkxxnxjsffxfdannhnxivvrvrqddbdfgttvtzobbfb
twjjpjnerrzrhmzzjzbuhhthwdqqeqqlyyoyktggygebooio
yjwwswsreeceghuuwuapccgcuxkkqkofssasinaakacviiui
xerrfrrmzzpzluhhzhfcppjpzkxxtxtsffdfhivvxvbqddhd
vyllrlpgttbtjobblbdwjjvjyfssgssnaaqamviiaigdqqkq
alyyuyutggegijwwywcreeiewzmmsmqhuucukpccmcexkkwk
zgtthttobbrbnwjjbjherrlrbmzzvzvuhhfhjkxxzxdsffjf
xanntnrivvdvlqddndfyllxlahuuiuupccscoxkkckifssms
cnaawawviigiklyyayetggkgyboouosjwwewmreeoegzmmym
bivvjvvqddtdpylldljgttntdobbxbxwjjhjlmzzbzfuhhlh
zcppvptkxxfxnsffpfhannzncjwwkwwreeueqzmmemkhuuou
epccycyxkkikmnaacagviimiadqqwqulyygyotggqgibooao
dkxxlxxsffvfrannfnlivvpvfqddzdzylljlnobbdbhwjjnj
berrxrvmzzhzpuhhrhjcppbpelyymyytggwgsboogomjwwqw
greeaeazmmkmopccecixkkokcfssyswnaaiaqviisikdqqcq
fmzznzzuhhxhtcpphpnkxxrxhsffbfbannlnpqddfdjyllpl
dgttztxobbjbrwjjtjlerrdrgnaaoaaviiyiudqqiqolyysy
itggcgcboomoqreegekzmmqmehuuauypcckcsxkkukmfsses
hobbpbbwjjzjverrjrpmzztzjuhhdhdcppnprsffhflannrn
fivvbvzqddldtyllvlngttftipccqccxkkakwfssksqnaaua
kviieiedqqoqstggigmboosogjwwcwareemeuzmmwmohuugu
jqddrddyllblxgttltrobbvblwjjfjferrprtuhhjhncpptp
hkxxdxbsffnfvannxnpivvhvkreeseezmmcmyhuumuspccwc
mxkkgkgfssqsuviikiodqquqilyyeyctggogwbooyoqjwwiw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: kreese
Cipher: xerrfr

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: kreese
Cipher: 522451513451

Extended Methods:
Method #1

Plaintext: kreese
method variations:
pwkkxkubppcpzguuhuemzznz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
k r e e s e 
5 2 5 5 3 5 
2 4 1 1 4 1 
They are then read out in rows:
525535241141
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: kreese
Cipher: kzxrad

Read more ...
Method #3

Plaintext: kreese
method variations:
gyvlyv yvlyvg vlyvgy
lyvgyv yvgyvl vgyvly

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: kreese

all 720 cipher variations:
kreese kreees kresee kresee kreese kreees kreese kreees kresee kresee kreese
kreees krseee krseee krseee krseee krseee krseee kreese kreees kresee kresee
kreese kreees kerese kerees kersee kersee kerese kerees keerse keeres keesre
keeser keeesr keeers kesere keseer kesree kesree kesere keseer keeesr keeers
keeser keesre keerse keeres keerse keeres keesre keeser keeesr keeers kerese
kerees kersee kersee kerese kerees kesree kesree kesere keseer keseer kesere
keerse keeres keesre keeser keeesr keeers kseere kseeer kseree kseree kseere
kseeer kseere kseeer kseree kseree kseere kseeer ksreee ksreee ksreee ksreee
ksreee ksreee kseere kseeer kseree kseree kseere kseeer keeesr keeers keeser
keesre keerse keeres keeesr keeers keeser keesre keerse keeres keseer kesere
keseer kesere kesree kesree kerese kerees kersee kersee kerese kerees rkeese
rkeees rkesee rkesee rkeese rkeees rkeese rkeees rkesee rkesee rkeese rkeees
rkseee rkseee rkseee rkseee rkseee rkseee rkeese rkeees rkesee rkesee rkeese
rkeees rekese rekees reksee reksee rekese rekees reekse reekes reeske reesek
reeesk reeeks reseke reseek reskee reskee reseke reseek reeesk reeeks reesek
reeske reekse reekes reekse reekes reeske reesek reeesk reeeks rekese rekees
reksee reksee rekese rekees reskee reskee reseke reseek reseek reseke reekse
reekes reeske reesek reeesk reeeks rseeke rseeek rsekee rsekee rseeke rseeek
rseeke rseeek rsekee rsekee rseeke rseeek rskeee rskeee rskeee rskeee rskeee
rskeee rseeke rseeek rsekee rsekee rseeke rseeek reeesk reeeks reesek reeske
reekse reekes reeesk reeeks reesek reeske reekse reekes reseek reseke reseek
reseke reskee reskee rekese rekees reksee reksee rekese rekees erkese erkees
erksee erksee erkese erkees erekse erekes ereske eresek ereesk ereeks erseke
erseek erskee erskee erseke erseek ereesk ereeks eresek ereske erekse erekes
ekrese ekrees ekrsee ekrsee ekrese ekrees ekerse ekeres ekesre ekeser ekeesr
ekeers eksere ekseer eksree eksree eksere ekseer ekeesr ekeers ekeser ekesre
ekerse ekeres eekrse eekres eeksre eekser eekesr eekers eerkse eerkes eerske
eersek eeresk eereks eesrke eesrek eeskre eesker eesekr eeserk eeersk eeerks
eeesrk eeeskr eeeksr eeekrs eskere eskeer eskree eskree eskere eskeer esekre
eseker eserke eserek eseerk eseekr esreke esreek esrkee esrkee esreke esreek
eseerk eseekr eserek eserke esekre eseker eekesr eekers eekser eeksre eekrse
eekres eeeksr eeekrs eeeskr eeesrk eeersk eeerks eesekr eeserk eesker eeskre
eesrke eesrek eeresk eereks eersek eerske eerkse eerkes erekse erekes ereske
eresek ereesk ereeks erkese erkees erksee erksee erkese erkees erskee erskee
erseke erseek erseek erseke erekse erekes ereske eresek ereesk ereeks eerkse
eerkes eerske eersek eeresk eereks eekrse eekres eeksre eekser eekesr eekers
eeskre eesker eesrke eesrek eeserk eesekr eeeksr eeekrs eeeskr eeesrk eeersk
eeerks ekerse ekeres ekesre ekeser ekeesr ekeers ekrese ekrees ekrsee ekrsee
ekrese ekrees eksree eksree eksere ekseer ekseer eksere ekerse ekeres ekesre
ekeser ekeesr ekeers esekre eseker eserke eserek eseerk eseekr eskere eskeer
eskree eskree eskere eskeer esrkee esrkee esreke esreek esreek esreke esekre
eseker eserke eserek eseerk eseekr eeeksr eeekrs eeeskr eeesrk eeersk eeerks
eekesr eekers eekser eeksre eekrse eekres eesker eeskre eesekr eeserk eesrek
eesrke eerkse eerkes eerske eersek eeresk eereks sreeke sreeek srekee srekee
sreeke sreeek sreeke sreeek srekee srekee sreeke sreeek srkeee srkeee srkeee
srkeee srkeee srkeee sreeke sreeek srekee srekee sreeke sreeek sereke sereek
serkee serkee sereke sereek seerke seerek seekre seeker seeekr seeerk sekere
sekeer sekree sekree sekere sekeer seeekr seeerk seeker seekre seerke seerek
seerke seerek seekre seeker seeekr seeerk sereke sereek serkee serkee sereke
sereek sekree sekree sekere sekeer sekeer sekere seerke seerek seekre seeker
seeekr seeerk skeere skeeer skeree skeree skeere skeeer skeere skeeer skeree
skeree skeere skeeer skreee skreee skreee skreee skreee skreee skeere skeeer
skeree skeree skeere skeeer seeekr seeerk seeker seekre seerke seerek seeekr
seeerk seeker seekre seerke seerek sekeer sekere sekeer sekere sekree sekree
sereke sereek serkee serkee sereke sereek ereesk ereeks eresek ereske erekse
erekes ereesk ereeks eresek ereske erekse erekes erseek erseke erseek erseke
erskee erskee erkese erkees erksee erksee erkese erkees eeresk eereks eersek
eerske eerkse eerkes eeersk eeerks eeesrk eeeskr eeeksr eeekrs eeserk eesekr
eesrek eesrke eeskre eesker eekesr eekers eekser eeksre eekrse eekres eeersk
eeerks eeesrk eeeskr eeeksr eeekrs eeresk eereks eersek eerske eerkse eerkes
eesrek eesrke eeserk eesekr eesker eeskre eekrse eekres eeksre eekser eekesr
eekers eseerk eseekr eserek eserke esekre eseker eseerk eseekr eserek eserke
esekre eseker esreek esreke esreek esreke esrkee esrkee eskere eskeer eskree
eskree eskere eskeer ekeesr ekeers ekeser ekesre ekerse ekeres ekeesr ekeers
ekeser ekesre ekerse ekeres ekseer eksere ekseer eksere eksree eksree ekrese
ekrees ekrsee ekrsee ekrese ekrees

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us