easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

thirti

landholder

copresent

mismatch

childe

inscium

lungers

delaney

rafelson

fluffier

timorousnous

overcross

fuissentque

missies

obverse

aiebatque

obaeratorum

brushman


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: kliegel
cipher variations:
lmjfhfm mnkgign nolhjho opmikip pqnjljq
qrokmkr rsplnls stqmomt turnpnu uvsoqov
vwtprpw wxuqsqx xyvrtry yzwsusz zaxtvta
abyuwub bczvxvc cdawywd debxzxe efcyayf
fgdzbzg gheacah hifbdbi ijgcecj jkhdfdk

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: kliegel
Cipher: porvtvo

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: kliegel
Cipher: ABAAB ABABA ABAAA AABAA AABBA AABAA ABABA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: kliegel
cipher variations:
lmjfhfmfizntnizepvfvetafdrdanwvldlwhsltptsvkrjnjkpghrzrg
jcxzlzcdynhxhyxudpjpurqtxvxqmnkgigngjaouojafqwgwfubgeseb
oxwmemxitmuqutwlskoklqhisashkdyamadezoiyizyveqkqvsruywyr
nolhjhohkbpvpkbgrxhxgvchftfcpyxnfnyjunvrvuxmtlplmrijtbti
lezbnbefapjzjazwfrlrwtsvzxzsopmikipilcqwqlchsyiyhwdigugd
qzyogozkvowswvynumqmnsjkucujmfacocfgbqkakbaxgsmsxutwayat
pqnjljqjmdrxrmditzjzixejhvherazphpalwpxtxwzovnrnotklvdvk
ngbdpdghcrlblcbyhtntyvuxbzbuqrokmkrknesysnejuakajyfkiwif
sbaqiqbmxqyuyxapwosopulmwewlohceqehidsmcmdcziuouzwvycacv
rsplnlsloftztofkvblbkzgljxjgtcbrjrcnyrzvzybqxptpqvmnxfxm
pidfrfijetndnedajvpvaxwzdbdwstqmomtmpguaupglwcmclahmkykh
udcsksdozsawazcryquqrwnoygynqjegsgjkfuoeofebkwqwbyxaecex
turnpnunqhvbvqhmxdndmbinlzlivedtltepatbxbadszrvrsxopzhzo
rkfhthklgvpfpgfclxrxczybfdfyuvsoqovoriwcwrinyeoencjomamj
wfeumufqbucycbetaswstypqaiapslgiuilmhwqgqhgdmysydazcgegz
vwtprpwpsjxdxsjozfpfodkpnbnkxgfvnvgrcvdzdcfubtxtuzqrbjbq
tmhjvjmnixrhrihenztzebadhfhawxuqsqxqtkyeytkpagqgpelqocol
yhgwowhsdweaedgvcuyuvarsckcrunikwknojysisjifoauafcbeigib
xyvrtryrulzfzulqbhrhqfmrpdpmzihxpxitexfbfehwdvzvwbstdlds
vojlxlopkztjtkjgpbvbgdcfjhjcyzwsuszsvmagavmrcisirgnsqeqn
ajiyqyjufygcgfixewawxctuemetwpkmympqlaukulkhqcwchedgkikd
zaxtvtatwnbhbwnsdjtjshotrfrobkjzrzkvgzhdhgjyfxbxyduvfnfu
xqlnznqrmbvlvmlirdxdifehljleabyuwubuxocicxotekuktipusgsp
clkasalwhaieihkzgycyzevwgogvyrmoaorsncwmwnmjseyejgfimkmf
bczvxvcvypdjdypuflvlujqvthtqdmlbtbmxibjfjilahzdzafwxhphw
zsnpbpstodxnxonktfzfkhgjnlngcdawywdwzqekezqvgmwmvkrwuiur
enmcucnyjckgkjmbiaeabgxyiqixatoqcqtupeyoypolugaglihkomoh
debxzxexarflfarwhnxnwlsxvjvsfondvdozkdlhlkncjbfbchyzjrjy
buprdruvqfzpzqpmvhbhmjilpnpiefcyayfybsgmgbsxioyoxmtywkwt
gpoewepalemimlodkcgcdizakskzcvqsesvwrgaqarqnwicinkjmqoqj
fgdzbzgzcthnhctyjpzpynuzxlxuhqpfxfqbmfnjnmpeldhdejabltla
dwrtftwxshbrbsroxjdjolknrprkgheacahaduioiduzkqaqzovaymyv
irqgygrcngokonqfmeiefkbcmumbexsuguxyticsctspykekpmlosqsl
hifbdbibevjpjevalrbrapwbznzwjsrhzhsdohplporgnfjfglcdnvnc
fytvhvyzujdtdutqzlflqnmptrtmijgcecjcfwkqkfwbmscsbqxcaoax
ktsiaitepiqmqpshogkghmdeowodgzuwiwzavkeuevuramgmronqusun
jkhdfdkdgxlrlgxcntdtcrydbpbylutjbjufqjrnrqtiphlhinefpxpe
havxjxabwlfvfwvsbnhnsporvtvokliegelehymsmhydoueudszecqcz
mvukckvgrksosrujqimijofgqyqfibwykybcxmgwgxwtcoiotqpswuwp

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: kliegel
Cipher: xyvrtry

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: kliegel
Cipher: 52134251225113

Extended Methods:
Method #1

Plaintext: kliegel
method variations:
pqokmkquvtprpvzayuwuaefdzbzf

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
k l i e g e l 
5 1 4 5 2 5 1 
2 3 2 1 2 1 3 
They are then read out in rows:
51452512321213
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: kliegel
Cipher: eywfhfl

Read more ...
Method #3

Plaintext: kliegel
method variations:
bswfwax swfwaxb wfwaxbs
fwaxbsw waxbswf axbswfw
xbswfwa

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: kliegel

all 5040 cipher variations:
kliegel kliegle klieegl klieelg klieleg klielge kligeel kligele kligeel kligele kliglee
kliglee kliegel kliegle klieegl klieelg klieleg klielge klilgee klilgee klilege klileeg
klileeg klilege kleigel kleigle kleiegl kleielg kleileg kleilge klegiel klegile klegeil
klegeli kleglei kleglie kleegil kleegli kleeigl kleeilg kleelig kleelgi klelgei klelgie
klelegi kleleig klelieg klelige klgeiel klgeile klgeeil klgeeli klgelei klgelie klgieel
klgiele klgieel klgiele klgilee klgilee klgeiel klgeile klgeeil klgeeli klgelei klgelie
klgliee klgliee klgleie klgleei klgleei klgleie kleegil kleegli kleeigl kleeilg kleelig
kleelgi klegeil klegeli klegiel klegile kleglie kleglei kleigel kleigle kleiegl kleielg
kleileg kleilge klelgie klelgei klelige klelieg kleleig klelegi kllegei kllegie klleegi
klleeig klleieg klleige kllgeei kllgeie kllgeei kllgeie kllgiee kllgiee kllegei kllegie
klleegi klleeig klleieg klleige klligee klligee klliege kllieeg kllieeg klliege kilegel
kilegle kileegl kileelg kileleg kilelge kilgeel kilgele kilgeel kilgele kilglee kilglee
kilegel kilegle kileegl kileelg kileleg kilelge killgee killgee killege killeeg killeeg
killege kielgel kielgle kielegl kielelg kielleg kiellge kieglel kieglle kiegell kiegell
kieglel kieglle kieegll kieegll kieelgl kieellg kieellg kieelgl kielgel kielgle kielegl
kielelg kielleg kiellge kigelel kigelle kigeell kigeell kigelel kigelle kigleel kiglele
kigleel kiglele kigllee kigllee kigelel kigelle kigeell kigeell kigelel kigelle kigllee
kigllee kiglele kigleel kigleel kiglele kieegll kieegll kieelgl kieellg kieellg kieelgl
kiegell kiegell kieglel kieglle kieglle kieglel kielgel kielgle kielegl kielelg kielleg
kiellge kielgle kielgel kiellge kielleg kielelg kielegl kilegel kilegle kileegl kileelg
kileleg kilelge kilgeel kilgele kilgeel kilgele kilglee kilglee kilegel kilegle kileegl
kileelg kileleg kilelge killgee killgee killege killeeg killeeg killege keilgel keilgle
keilegl keilelg keilleg keillge keiglel keiglle keigell keigell keiglel keiglle keiegll
keiegll keielgl keiellg keiellg keielgl keilgel keilgle keilegl keilelg keilleg keillge
keligel keligle keliegl kelielg kelileg kelilge kelgiel kelgile kelgeil kelgeli kelglei
kelglie kelegil kelegli keleigl keleilg kelelig kelelgi kellgei kellgie kellegi kelleig
kellieg kellige kegliel keglile kegleil kegleli kegllei kegllie kegilel kegille kegiell
kegiell kegilel kegille kegeill kegeill kegelil kegelli kegelli kegelil kegliel keglile
kegleil kegleli kegllei kegllie keelgil keelgli keeligl keelilg keellig keellgi keeglil
keeglli keegill keegill keeglil keeglli keeigll keeigll keeilgl keeillg keeillg keeilgl
keelgil keelgli keeligl keelilg keellig keellgi kellgei kellgie kellegi kelleig kellieg
kellige kelglei kelglie kelgeli kelgeil kelgiel kelgile kelegli kelegil kelelgi kelelig
keleilg keleigl keligel keligle keliegl kelielg kelileg kelilge kgielel kgielle kgieell
kgieell kgielel kgielle kgileel kgilele kgileel kgilele kgillee kgillee kgielel kgielle
kgieell kgieell kgielel kgielle kgillee kgillee kgilele kgileel kgileel kgilele kgeilel
kgeille kgeiell kgeiell kgeilel kgeille kgeliel kgelile kgeleil kgeleli kgellei kgellie
kgeelil kgeelli kgeeill kgeeill kgeelil kgeelli kgellei kgellie kgeleli kgeleil kgeliel
kgelile kgleiel kgleile kgleeil kgleeli kglelei kglelie kglieel kgliele kglieel kgliele
kglilee kglilee kgleiel kgleile kgleeil kgleeli kglelei kglelie kglliee kglliee kglleie
kglleei kglleei kglleie kgeelil kgeelli kgeeill kgeeill kgeelil kgeelli kgeleil kgeleli
kgeliel kgelile kgellie kgellei kgeilel kgeille kgeiell kgeiell kgeilel kgeille kgellie
kgellei kgelile kgeliel kgeleil kgeleli kglelei kglelie kgleeli kgleeil kgleiel kgleile
kglleei kglleie kglleei kglleie kglliee kglliee kglelei kglelie kgleeli kgleeil kgleiel
kgleile kglilee kglilee kgliele kglieel kglieel kgliele keiegll keiegll keielgl keiellg
keiellg keielgl keigell keigell keiglel keiglle keiglle keiglel keilgel keilgle keilegl
keilelg keilleg keillge keilgle keilgel keillge keilleg keilelg keilegl keeigll keeigll
keeilgl keeillg keeillg keeilgl keegill keegill keeglil keeglli keeglli keeglil keelgil
keelgli keeligl keelilg keellig keellgi keelgli keelgil keellgi keellig keelilg keeligl
kegeill kegeill kegelil kegelli kegelli kegelil kegiell kegiell kegilel kegille kegille
kegilel kegliel keglile kegleil kegleli kegllei kegllie keglile kegliel kegllie kegllei
kegleli kegleil kelegil kelegli keleigl keleilg kelelig kelelgi kelgeil kelgeli kelgiel
kelgile kelglie kelglei keligel keligle keliegl kelielg kelileg kelilge kellgie kellgei
kellige kellieg kelleig kellegi kelegli kelegil kelelgi kelelig keleilg keleigl kelgeli
kelgeil kelglei kelglie kelgile kelgiel kellgei kellgie kellegi kelleig kellieg kellige
keligle keligel kelilge kelileg kelielg keliegl kliegel kliegle klieegl klieelg klieleg
klielge kligeel kligele kligeel kligele kliglee kliglee kliegel kliegle klieegl klieelg
klieleg klielge klilgee klilgee klilege klileeg klileeg klilege kleigel kleigle kleiegl
kleielg kleileg kleilge klegiel klegile klegeil klegeli kleglei kleglie kleegil kleegli
kleeigl kleeilg kleelig kleelgi klelgei klelgie klelegi kleleig klelieg klelige klgeiel
klgeile klgeeil klgeeli klgelei klgelie klgieel klgiele klgieel klgiele klgilee klgilee
klgeiel klgeile klgeeil klgeeli klgelei klgelie klgliee klgliee klgleie klgleei klgleei
klgleie kleegil kleegli kleeigl kleeilg kleelig kleelgi klegeil klegeli klegiel klegile
kleglie kleglei kleigel kleigle kleiegl kleielg kleileg kleilge klelgie klelgei klelige
klelieg kleleig klelegi kllegei kllegie klleegi klleeig klleieg klleige kllgeei kllgeie
kllgeei kllgeie kllgiee kllgiee kllegei kllegie klleegi klleeig klleieg klleige klligee
klligee klliege kllieeg kllieeg klliege lkiegel lkiegle lkieegl lkieelg lkieleg lkielge
lkigeel lkigele lkigeel lkigele lkiglee lkiglee lkiegel lkiegle lkieegl lkieelg lkieleg
lkielge lkilgee lkilgee lkilege lkileeg lkileeg lkilege lkeigel lkeigle lkeiegl lkeielg
lkeileg lkeilge lkegiel lkegile lkegeil lkegeli lkeglei lkeglie lkeegil lkeegli lkeeigl
lkeeilg lkeelig lkeelgi lkelgei lkelgie lkelegi lkeleig lkelieg lkelige lkgeiel lkgeile
lkgeeil lkgeeli lkgelei lkgelie lkgieel lkgiele lkgieel lkgiele lkgilee lkgilee lkgeiel
lkgeile lkgeeil lkgeeli lkgelei lkgelie lkgliee lkgliee lkgleie lkgleei lkgleei lkgleie
lkeegil lkeegli lkeeigl lkeeilg lkeelig lkeelgi lkegeil lkegeli lkegiel lkegile lkeglie
lkeglei lkeigel lkeigle lkeiegl lkeielg lkeileg lkeilge lkelgie lkelgei lkelige lkelieg
lkeleig lkelegi lklegei lklegie lkleegi lkleeig lkleieg lkleige lklgeei lklgeie lklgeei
lklgeie lklgiee lklgiee lklegei lklegie lkleegi lkleeig lkleieg lkleige lkligee lkligee
lkliege lklieeg lklieeg lkliege likegel likegle likeegl likeelg likeleg likelge likgeel
likgele likgeel likgele likglee likglee likegel likegle likeegl likeelg likeleg likelge
liklgee liklgee liklege likleeg likleeg liklege liekgel liekgle liekegl liekelg liekleg
lieklge liegkel liegkle liegekl liegelk lieglek lieglke lieegkl lieeglk lieekgl lieeklg
lieelkg lieelgk lielgek lielgke lielegk lielekg lielkeg lielkge ligekel ligekle ligeekl
ligeelk ligelek ligelke ligkeel ligkele ligkeel ligkele ligklee ligklee ligekel ligekle
ligeekl ligeelk ligelek ligelke liglkee liglkee ligleke ligleek ligleek ligleke lieegkl
lieeglk lieekgl lieeklg lieelkg lieelgk liegekl liegelk liegkel liegkle lieglke lieglek
liekgel liekgle liekegl liekelg liekleg lieklge lielgke lielgek lielkge lielkeg lielekg
lielegk lilegek lilegke lileegk lileekg lilekeg lilekge lilgeek lilgeke lilgeek lilgeke
lilgkee lilgkee lilegek lilegke lileegk lileekg lilekeg lilekge lilkgee lilkgee lilkege
lilkeeg lilkeeg lilkege leikgel leikgle leikegl leikelg leikleg leiklge leigkel leigkle
leigekl leigelk leiglek leiglke leiegkl leieglk leiekgl leieklg leielkg leielgk leilgek
leilgke leilegk leilekg leilkeg leilkge lekigel lekigle lekiegl lekielg lekileg lekilge
lekgiel lekgile lekgeil lekgeli lekglei lekglie lekegil lekegli lekeigl lekeilg lekelig
lekelgi leklgei leklgie leklegi lekleig leklieg leklige legkiel legkile legkeil legkeli
legklei legklie legikel legikle legiekl legielk legilek legilke legeikl legeilk legekil
legekli legelki legelik legliek leglike legleik legleki leglkei leglkie leekgil leekgli
leekigl leekilg leeklig leeklgi leegkil leegkli leegikl leegilk leeglik leeglki leeigkl
leeiglk leeikgl leeiklg leeilkg leeilgk leelgik leelgki leeligk leelikg leelkig leelkgi
lelkgei lelkgie lelkegi lelkeig lelkieg lelkige lelgkei lelgkie lelgeki lelgeik lelgiek
lelgike lelegki lelegik lelekgi lelekig leleikg leleigk leligek leligke leliegk leliekg
lelikeg lelikge lgiekel lgiekle lgieekl lgieelk lgielek lgielke lgikeel lgikele lgikeel
lgikele lgiklee lgiklee lgiekel lgiekle lgieekl lgieelk lgielek lgielke lgilkee lgilkee
lgileke lgileek lgileek lgileke lgeikel lgeikle lgeiekl lgeielk lgeilek lgeilke lgekiel
lgekile lgekeil lgekeli lgeklei lgeklie lgeekil lgeekli lgeeikl lgeeilk lgeelik lgeelki
lgelkei lgelkie lgeleki lgeleik lgeliek lgelike lgkeiel lgkeile lgkeeil lgkeeli lgkelei
lgkelie lgkieel lgkiele lgkieel lgkiele lgkilee lgkilee lgkeiel lgkeile lgkeeil lgkeeli
lgkelei lgkelie lgkliee lgkliee lgkleie lgkleei lgkleei lgkleie lgeekil lgeekli lgeeikl
lgeeilk lgeelik lgeelki lgekeil lgekeli lgekiel lgekile lgeklie lgeklei lgeikel lgeikle
lgeiekl lgeielk lgeilek lgeilke lgelkie lgelkei lgelike lgeliek lgeleik lgeleki lglekei
lglekie lgleeki lgleeik lgleiek lgleike lglkeei lglkeie lglkeei lglkeie lglkiee lglkiee
lglekei lglekie lgleeki lgleeik lgleiek lgleike lglikee lglikee lglieke lglieek lglieek
lglieke leiegkl leieglk leiekgl leieklg leielkg leielgk leigekl leigelk leigkel leigkle
leiglke leiglek leikgel leikgle leikegl leikelg leikleg leiklge leilgke leilgek leilkge
leilkeg leilekg leilegk leeigkl leeiglk leeikgl leeiklg leeilkg leeilgk leegikl leegilk
leegkil leegkli leeglki leeglik leekgil leekgli leekigl leekilg leeklig leeklgi leelgki
leelgik leelkgi leelkig leelikg leeligk legeikl legeilk legekil legekli legelki legelik
legiekl legielk legikel legikle legilke legilek legkiel legkile legkeil legkeli legklei
legklie leglike legliek leglkie leglkei legleki legleik lekegil lekegli lekeigl lekeilg
lekelig lekelgi lekgeil lekgeli lekgiel lekgile lekglie lekglei lekigel lekigle lekiegl
lekielg lekileg lekilge leklgie leklgei leklige leklieg lekleig leklegi lelegki lelegik
lelekgi lelekig leleikg leleigk lelgeki lelgeik lelgkei lelgkie lelgike lelgiek lelkgei
lelkgie lelkegi lelkeig lelkieg lelkige leligke leligek lelikge lelikeg leliekg leliegk
lliegek lliegke llieegk llieekg lliekeg lliekge lligeek lligeke lligeek lligeke lligkee
lligkee lliegek lliegke llieegk llieekg lliekeg lliekge llikgee llikgee llikege llikeeg
llikeeg llikege lleigek lleigke lleiegk lleiekg lleikeg lleikge llegiek llegike llegeik
llegeki llegkei llegkie lleegik lleegki lleeigk lleeikg lleekig lleekgi llekgei llekgie
llekegi llekeig llekieg llekige llgeiek llgeike llgeeik llgeeki llgekei llgekie llgieek
llgieke llgieek llgieke llgikee llgikee llgeiek llgeike llgeeik llgeeki llgekei llgekie
llgkiee llgkiee llgkeie llgkeei llgkeei llgkeie lleegik lleegki lleeigk lleeikg lleekig
lleekgi llegeik llegeki llegiek llegike llegkie llegkei lleigek lleigke lleiegk lleiekg
lleikeg lleikge llekgie llekgei llekige llekieg llekeig llekegi llkegei llkegie llkeegi
llkeeig llkeieg llkeige llkgeei llkgeie llkgeei llkgeie llkgiee llkgiee llkegei llkegie
llkeegi llkeeig llkeieg llkeige llkigee llkigee llkiege llkieeg llkieeg llkiege ilkegel
ilkegle ilkeegl ilkeelg ilkeleg ilkelge ilkgeel ilkgele ilkgeel ilkgele ilkglee ilkglee
ilkegel ilkegle ilkeegl ilkeelg ilkeleg ilkelge ilklgee ilklgee ilklege ilkleeg ilkleeg
ilklege ilekgel ilekgle ilekegl ilekelg ilekleg ileklge ilegkel ilegkle ilegekl ilegelk
ileglek ileglke ileegkl ileeglk ileekgl ileeklg ileelkg ileelgk ilelgek ilelgke ilelegk
ilelekg ilelkeg ilelkge ilgekel ilgekle ilgeekl ilgeelk ilgelek ilgelke ilgkeel ilgkele
ilgkeel ilgkele ilgklee ilgklee ilgekel ilgekle ilgeekl ilgeelk ilgelek ilgelke ilglkee
ilglkee ilgleke ilgleek ilgleek ilgleke ileegkl ileeglk ileekgl ileeklg ileelkg ileelgk
ilegekl ilegelk ilegkel ilegkle ileglke ileglek ilekgel ilekgle ilekegl ilekelg ilekleg
ileklge ilelgke ilelgek ilelkge ilelkeg ilelekg ilelegk illegek illegke illeegk illeekg
illekeg illekge illgeek illgeke illgeek illgeke illgkee illgkee illegek illegke illeegk
illeekg illekeg illekge illkgee illkgee illkege illkeeg illkeeg illkege iklegel iklegle
ikleegl ikleelg ikleleg iklelge iklgeel iklgele iklgeel iklgele iklglee iklglee iklegel
iklegle ikleegl ikleelg ikleleg iklelge ikllgee ikllgee ikllege iklleeg iklleeg ikllege
ikelgel ikelgle ikelegl ikelelg ikelleg ikellge ikeglel ikeglle ikegell ikegell ikeglel
ikeglle ikeegll ikeegll ikeelgl ikeellg ikeellg ikeelgl ikelgel ikelgle ikelegl ikelelg
ikelleg ikellge ikgelel ikgelle ikgeell ikgeell ikgelel ikgelle ikgleel ikglele ikgleel
ikglele ikgllee ikgllee ikgelel ikgelle ikgeell ikgeell ikgelel ikgelle ikgllee ikgllee
ikglele ikgleel ikgleel ikglele ikeegll ikeegll ikeelgl ikeellg ikeellg ikeelgl ikegell
ikegell ikeglel ikeglle ikeglle ikeglel ikelgel ikelgle ikelegl ikelelg ikelleg ikellge
ikelgle ikelgel ikellge ikelleg ikelelg ikelegl iklegel iklegle ikleegl ikleelg ikleleg
iklelge iklgeel iklgele iklgeel iklgele iklglee iklglee iklegel iklegle ikleegl ikleelg
ikleleg iklelge ikllgee ikllgee ikllege iklleeg iklleeg ikllege ieklgel ieklgle ieklegl
ieklelg ieklleg iekllge iekglel iekglle iekgell iekgell iekglel iekglle iekegll iekegll
iekelgl iekellg iekellg iekelgl ieklgel ieklgle ieklegl ieklelg ieklleg iekllge ielkgel
ielkgle ielkegl ielkelg ielkleg ielklge ielgkel ielgkle ielgekl ielgelk ielglek ielglke
ielegkl ieleglk ielekgl ieleklg ielelkg ielelgk iellgek iellgke iellegk iellekg iellkeg
iellkge ieglkel ieglkle ieglekl ieglelk iegllek iegllke iegklel iegklle iegkell iegkell
iegklel iegklle iegekll iegekll iegelkl iegellk iegellk iegelkl ieglkel ieglkle ieglekl
ieglelk iegllek iegllke ieelgkl ieelglk ieelkgl ieelklg ieellkg ieellgk ieeglkl ieegllk
ieegkll ieegkll ieeglkl ieegllk ieekgll ieekgll ieeklgl ieekllg ieekllg ieeklgl ieelgkl
ieelglk ieelkgl ieelklg ieellkg ieellgk iellgek iellgke iellegk iellekg iellkeg iellkge
ielglek ielglke ielgelk ielgekl ielgkel ielgkle ieleglk ielegkl ielelgk ielelkg ieleklg
ielekgl ielkgel ielkgle ielkegl ielkelg ielkleg ielklge igkelel igkelle igkeell igkeell
igkelel igkelle igkleel igklele igkleel igklele igkllee igkllee igkelel igkelle igkeell
igkeell igkelel igkelle igkllee igkllee igklele igkleel igkleel igklele igeklel igeklle
igekell igekell igeklel igeklle igelkel igelkle igelekl igelelk igellek igellke igeelkl
igeellk igeekll igeekll igeelkl igeellk igellek igellke igelelk igelekl igelkel igelkle
iglekel iglekle igleekl igleelk iglelek iglelke iglkeel iglkele iglkeel iglkele iglklee
iglklee iglekel iglekle igleekl igleelk iglelek iglelke igllkee igllkee iglleke iglleek
iglleek iglleke igeelkl igeellk igeekll igeekll igeelkl igeellk igelekl igelelk igelkel
igelkle igellke igellek igeklel igeklle igekell igekell igeklel igeklle igellke igellek
igelkle igelkel igelekl igelelk iglelek iglelke igleelk igleekl iglekel iglekle iglleek
iglleke iglleek iglleke igllkee igllkee iglelek iglelke igleelk igleekl iglekel iglekle
iglklee iglklee iglkele iglkeel iglkeel iglkele iekegll iekegll iekelgl iekellg iekellg
iekelgl iekgell iekgell iekglel iekglle iekglle iekglel ieklgel ieklgle ieklegl ieklelg
ieklleg iekllge ieklgle ieklgel iekllge ieklleg ieklelg ieklegl ieekgll ieekgll ieeklgl
ieekllg ieekllg ieeklgl ieegkll ieegkll ieeglkl ieegllk ieegllk ieeglkl ieelgkl ieelglk
ieelkgl ieelklg ieellkg ieellgk ieelglk ieelgkl ieellgk ieellkg ieelklg ieelkgl iegekll
iegekll iegelkl iegellk iegellk iegelkl iegkell iegkell iegklel iegklle iegklle iegklel
ieglkel ieglkle ieglekl ieglelk iegllek iegllke ieglkle ieglkel iegllke iegllek ieglelk
ieglekl ielegkl ieleglk ielekgl ieleklg ielelkg ielelgk ielgekl ielgelk ielgkel ielgkle
ielglke ielglek ielkgel ielkgle ielkegl ielkelg ielkleg ielklge iellgke iellgek iellkge
iellkeg iellekg iellegk ieleglk ielegkl ielelgk ielelkg ieleklg ielekgl ielgelk ielgekl
ielglek ielglke ielgkle ielgkel iellgek iellgke iellegk iellekg iellkeg iellkge ielkgle
ielkgel ielklge ielkleg ielkelg ielkegl ilkegel ilkegle ilkeegl ilkeelg ilkeleg ilkelge
ilkgeel ilkgele ilkgeel ilkgele ilkglee ilkglee ilkegel ilkegle ilkeegl ilkeelg ilkeleg
ilkelge ilklgee ilklgee ilklege ilkleeg ilkleeg ilklege ilekgel ilekgle ilekegl ilekelg
ilekleg ileklge ilegkel ilegkle ilegekl ilegelk ileglek ileglke ileegkl ileeglk ileekgl
ileeklg ileelkg ileelgk ilelgek ilelgke ilelegk ilelekg ilelkeg ilelkge ilgekel ilgekle
ilgeekl ilgeelk ilgelek ilgelke ilgkeel ilgkele ilgkeel ilgkele ilgklee ilgklee ilgekel
ilgekle ilgeekl ilgeelk ilgelek ilgelke ilglkee ilglkee ilgleke ilgleek ilgleek ilgleke
ileegkl ileeglk ileekgl ileeklg ileelkg ileelgk ilegekl ilegelk ilegkel ilegkle ileglke
ileglek ilekgel ilekgle ilekegl ilekelg ilekleg ileklge ilelgke ilelgek ilelkge ilelkeg
ilelekg ilelegk illegek illegke illeegk illeekg illekeg illekge illgeek illgeke illgeek
illgeke illgkee illgkee illegek illegke illeegk illeekg illekeg illekge illkgee illkgee
illkege illkeeg illkeeg illkege elikgel elikgle elikegl elikelg elikleg eliklge eligkel
eligkle eligekl eligelk eliglek eliglke eliegkl elieglk eliekgl elieklg elielkg elielgk
elilgek elilgke elilegk elilekg elilkeg elilkge elkigel elkigle elkiegl elkielg elkileg
elkilge elkgiel elkgile elkgeil elkgeli elkglei elkglie elkegil elkegli elkeigl elkeilg
elkelig elkelgi elklgei elklgie elklegi elkleig elklieg elklige elgkiel elgkile elgkeil
elgkeli elgklei elgklie elgikel elgikle elgiekl elgielk elgilek elgilke elgeikl elgeilk
elgekil elgekli elgelki elgelik elgliek elglike elgleik elgleki elglkei elglkie elekgil
elekgli elekigl elekilg eleklig eleklgi elegkil elegkli elegikl elegilk eleglik eleglki
eleigkl eleiglk eleikgl eleiklg eleilkg eleilgk elelgik elelgki eleligk elelikg elelkig
elelkgi ellkgei ellkgie ellkegi ellkeig ellkieg ellkige ellgkei ellgkie ellgeki ellgeik
ellgiek ellgike ellegki ellegik ellekgi ellekig elleikg elleigk elligek elligke elliegk
elliekg ellikeg ellikge eilkgel eilkgle eilkegl eilkelg eilkleg eilklge eilgkel eilgkle
eilgekl eilgelk eilglek eilglke eilegkl eileglk eilekgl eileklg eilelkg eilelgk eillgek
eillgke eillegk eillekg eillkeg eillkge eiklgel eiklgle eiklegl eiklelg eiklleg eikllge
eikglel eikglle eikgell eikgell eikglel eikglle eikegll eikegll eikelgl eikellg eikellg
eikelgl eiklgel eiklgle eiklegl eiklelg eiklleg eikllge eigklel eigklle eigkell eigkell
eigklel eigklle eiglkel eiglkle eiglekl eiglelk eigllek eigllke eigelkl eigellk eigekll
eigekll eigelkl eigellk eigllek eigllke eiglelk eiglekl eiglkel eiglkle eiekgll eiekgll
eieklgl eiekllg eiekllg eieklgl eiegkll eiegkll eieglkl eiegllk eiegllk eieglkl eielgkl
eielglk eielkgl eielklg eiellkg eiellgk eielglk eielgkl eiellgk eiellkg eielklg eielkgl
eilkgel eilkgle eilkegl eilkelg eilkleg eilklge eilgkel eilgkle eilgekl eilgelk eilglek
eilglke eilegkl eileglk eilekgl eileklg eilelkg eilelgk eillgek eillgke eillegk eillekg
eillkeg eillkge ekilgel ekilgle ekilegl ekilelg ekilleg ekillge ekiglel ekiglle ekigell
ekigell ekiglel ekiglle ekiegll ekiegll ekielgl ekiellg ekiellg ekielgl ekilgel ekilgle
ekilegl ekilelg ekilleg ekillge ekligel ekligle ekliegl eklielg eklileg eklilge eklgiel
eklgile eklgeil eklgeli eklglei eklglie eklegil eklegli ekleigl ekleilg eklelig eklelgi
ekllgei ekllgie ekllegi eklleig ekllieg ekllige ekgliel ekglile ekgleil ekgleli ekgllei
ekgllie ekgilel ekgille ekgiell ekgiell ekgilel ekgille ekgeill ekgeill ekgelil ekgelli
ekgelli ekgelil ekgliel ekglile ekgleil ekgleli ekgllei ekgllie ekelgil ekelgli ekeligl
ekelilg ekellig ekellgi ekeglil ekeglli ekegill ekegill ekeglil ekeglli ekeigll ekeigll
ekeilgl ekeillg ekeillg ekeilgl ekelgil ekelgli ekeligl ekelilg ekellig ekellgi ekllgei
ekllgie ekllegi eklleig ekllieg ekllige eklglei eklglie eklgeli eklgeil eklgiel eklgile
eklegli eklegil eklelgi eklelig ekleilg ekleigl ekligel ekligle ekliegl eklielg eklileg
eklilge egiklel egiklle egikell egikell egiklel egiklle egilkel egilkle egilekl egilelk
egillek egillke egielkl egiellk egiekll egiekll egielkl egiellk egillek egillke egilelk
egilekl egilkel egilkle egkilel egkille egkiell egkiell egkilel egkille egkliel egklile
egkleil egkleli egkllei egkllie egkelil egkelli egkeill egkeill egkelil egkelli egkllei
egkllie egkleli egkleil egkliel egklile eglkiel eglkile eglkeil eglkeli eglklei eglklie
eglikel eglikle egliekl eglielk eglilek eglilke egleikl egleilk eglekil eglekli eglelki
eglelik eglliek egllike eglleik eglleki egllkei egllkie egeklil egeklli egekill egekill
egeklil egeklli egelkil egelkli egelikl egelilk egellik egellki egeilkl egeillk egeikll
egeikll egeilkl egeillk egellik egellki egelilk egelikl egelkil egelkli eglklei eglklie
eglkeli eglkeil eglkiel eglkile egllkei egllkie eglleki eglleik eglliek egllike eglelki
eglelik eglekli eglekil egleikl egleilk eglilek eglilke eglielk egliekl eglikel eglikle
eeikgll eeikgll eeiklgl eeikllg eeikllg eeiklgl eeigkll eeigkll eeiglkl eeigllk eeigllk
eeiglkl eeilgkl eeilglk eeilkgl eeilklg eeillkg eeillgk eeilglk eeilgkl eeillgk eeillkg
eeilklg eeilkgl eekigll eekigll eekilgl eekillg eekillg eekilgl eekgill eekgill eekglil
eekglli eekglli eekglil eeklgil eeklgli eekligl eeklilg eekllig eekllgi eeklgli eeklgil
eekllgi eekllig eeklilg eekligl eegkill eegkill eegklil eegklli eegklli eegklil eegikll
eegikll eegilkl eegillk eegillk eegilkl eeglikl eeglilk eeglkil eeglkli eegllki eegllik
eeglilk eeglikl eegllik eegllki eeglkli eeglkil eelkgil eelkgli eelkigl eelkilg eelklig
eelklgi eelgkil eelgkli eelgikl eelgilk eelglik eelglki eeligkl eeliglk eelikgl eeliklg
eelilkg eelilgk eellgik eellgki eelligk eellikg eellkig eellkgi eelkgli eelkgil eelklgi
eelklig eelkilg eelkigl eelgkli eelgkil eelglki eelglik eelgilk eelgikl eellgki eellgik
eellkgi eellkig eellikg eelligk eeliglk eeligkl eelilgk eelilkg eeliklg eelikgl elikgel
elikgle elikegl elikelg elikleg eliklge eligkel eligkle eligekl eligelk eliglek eliglke
eliegkl elieglk eliekgl elieklg elielkg elielgk elilgek elilgke elilegk elilekg elilkeg
elilkge elkigel elkigle elkiegl elkielg elkileg elkilge elkgiel elkgile elkgeil elkgeli
elkglei elkglie elkegil elkegli elkeigl elkeilg elkelig elkelgi elklgei elklgie elklegi
elkleig elklieg elklige elgkiel elgkile elgkeil elgkeli elgklei elgklie elgikel elgikle
elgiekl elgielk elgilek elgilke elgeikl elgeilk elgekil elgekli elgelki elgelik elgliek
elglike elgleik elgleki elglkei elglkie elekgil elekgli elekigl elekilg eleklig eleklgi
elegkil elegkli elegikl elegilk eleglik eleglki eleigkl eleiglk eleikgl eleiklg eleilkg
eleilgk elelgik elelgki eleligk elelikg elelkig elelkgi ellkgei ellkgie ellkegi ellkeig
ellkieg ellkige ellgkei ellgkie ellgeki ellgeik ellgiek ellgike ellegki ellegik ellekgi
ellekig elleikg elleigk elligek elligke elliegk elliekg ellikeg ellikge gliekel gliekle
glieekl glieelk glielek glielke glikeel glikele glikeel glikele gliklee gliklee gliekel
gliekle glieekl glieelk glielek glielke glilkee glilkee glileke glileek glileek glileke
gleikel gleikle gleiekl gleielk gleilek gleilke glekiel glekile glekeil glekeli gleklei
gleklie gleekil gleekli gleeikl gleeilk gleelik gleelki glelkei glelkie gleleki gleleik
gleliek glelike glkeiel glkeile glkeeil glkeeli glkelei glkelie glkieel glkiele glkieel
glkiele glkilee glkilee glkeiel glkeile glkeeil glkeeli glkelei glkelie glkliee glkliee
glkleie glkleei glkleei glkleie gleekil gleekli gleeikl gleeilk gleelik gleelki glekeil
glekeli glekiel glekile gleklie gleklei gleikel gleikle gleiekl gleielk gleilek gleilke
glelkie glelkei glelike gleliek gleleik gleleki gllekei gllekie glleeki glleeik glleiek
glleike gllkeei gllkeie gllkeei gllkeie gllkiee gllkiee gllekei gllekie glleeki glleeik
glleiek glleike gllikee gllikee gllieke gllieek gllieek gllieke gilekel gilekle gileekl
gileelk gilelek gilelke gilkeel gilkele gilkeel gilkele gilklee gilklee gilekel gilekle
gileekl gileelk gilelek gilelke gillkee gillkee gilleke gilleek gilleek gilleke gielkel
gielkle gielekl gielelk giellek giellke gieklel gieklle giekell giekell gieklel gieklle
gieekll gieekll gieelkl gieellk gieellk gieelkl gielkel gielkle gielekl gielelk giellek
giellke gikelel gikelle gikeell gikeell gikelel gikelle gikleel giklele gikleel giklele
gikllee gikllee gikelel gikelle gikeell gikeell gikelel gikelle gikllee gikllee giklele
gikleel gikleel giklele gieekll gieekll gieelkl gieellk gieellk gieelkl giekell giekell
gieklel gieklle gieklle gieklel gielkel gielkle gielekl gielelk giellek giellke gielkle
gielkel giellke giellek gielelk gielekl gilekel gilekle gileekl gileelk gilelek gilelke
gilkeel gilkele gilkeel gilkele gilklee gilklee gilekel gilekle gileekl gileelk gilelek
gilelke gillkee gillkee gilleke gilleek gilleek gilleke geilkel geilkle geilekl geilelk
geillek geillke geiklel geiklle geikell geikell geiklel geiklle geiekll geiekll geielkl
geiellk geiellk geielkl geilkel geilkle geilekl geilelk geillek geillke gelikel gelikle
geliekl gelielk gelilek gelilke gelkiel gelkile gelkeil gelkeli gelklei gelklie gelekil
gelekli geleikl geleilk gelelik gelelki gellkei gellkie gelleki gelleik gelliek gellike
gekliel geklile gekleil gekleli gekllei gekllie gekilel gekille gekiell gekiell gekilel
gekille gekeill gekeill gekelil gekelli gekelli gekelil gekliel geklile gekleil gekleli
gekllei gekllie geelkil geelkli geelikl geelilk geellik geellki geeklil geeklli geekill
geekill geeklil geeklli geeikll geeikll geeilkl geeillk geeillk geeilkl geelkil geelkli
geelikl geelilk geellik geellki gellkei gellkie gelleki gelleik gelliek gellike gelklei
gelklie gelkeli gelkeil gelkiel gelkile gelekli gelekil gelelki gelelik geleilk geleikl
gelikel gelikle geliekl gelielk gelilek gelilke gkielel gkielle gkieell gkieell gkielel
gkielle gkileel gkilele gkileel gkilele gkillee gkillee gkielel gkielle gkieell gkieell
gkielel gkielle gkillee gkillee gkilele gkileel gkileel gkilele gkeilel gkeille gkeiell
gkeiell gkeilel gkeille gkeliel gkelile gkeleil gkeleli gkellei gkellie gkeelil gkeelli
gkeeill gkeeill gkeelil gkeelli gkellei gkellie gkeleli gkeleil gkeliel gkelile gkleiel
gkleile gkleeil gkleeli gklelei gklelie gklieel gkliele gklieel gkliele gklilee gklilee
gkleiel gkleile gkleeil gkleeli gklelei gklelie gklliee gklliee gklleie gklleei gklleei
gklleie gkeelil gkeelli gkeeill gkeeill gkeelil gkeelli gkeleil gkeleli gkeliel gkelile
gkellie gkellei gkeilel gkeille gkeiell gkeiell gkeilel gkeille gkellie gkellei gkelile
gkeliel gkeleil gkeleli gklelei gklelie gkleeli gkleeil gkleiel gkleile gklleei gklleie
gklleei gklleie gklliee gklliee gklelei gklelie gkleeli gkleeil gkleiel gkleile gklilee
gklilee gkliele gklieel gklieel gkliele geiekll geiekll geielkl geiellk geiellk geielkl
geikell geikell geiklel geiklle geiklle geiklel geilkel geilkle geilekl geilelk geillek
geillke geilkle geilkel geillke geillek geilelk geilekl geeikll geeikll geeilkl geeillk
geeillk geeilkl geekill geekill geeklil geeklli geeklli geeklil geelkil geelkli geelikl
geelilk geellik geellki geelkli geelkil geellki geellik geelilk geelikl gekeill gekeill
gekelil gekelli gekelli gekelil gekiell gekiell gekilel gekille gekille gekilel gekliel
geklile gekleil gekleli gekllei gekllie geklile gekliel gekllie gekllei gekleli gekleil
gelekil gelekli geleikl geleilk gelelik gelelki gelkeil gelkeli gelkiel gelkile gelklie
gelklei gelikel gelikle geliekl gelielk gelilek gelilke gellkie gellkei gellike gelliek
gelleik gelleki gelekli gelekil gelelki gelelik geleilk geleikl gelkeli gelkeil gelklei
gelklie gelkile gelkiel gellkei gellkie gelleki gelleik gelliek gellike gelikle gelikel
gelilke gelilek gelielk geliekl gliekel gliekle glieekl glieelk glielek glielke glikeel
glikele glikeel glikele gliklee gliklee gliekel gliekle glieekl glieelk glielek glielke
glilkee glilkee glileke glileek glileek glileke gleikel gleikle gleiekl gleielk gleilek
gleilke glekiel glekile glekeil glekeli gleklei gleklie gleekil gleekli gleeikl gleeilk
gleelik gleelki glelkei glelkie gleleki gleleik gleliek glelike glkeiel glkeile glkeeil
glkeeli glkelei glkelie glkieel glkiele glkieel glkiele glkilee glkilee glkeiel glkeile
glkeeil glkeeli glkelei glkelie glkliee glkliee glkleie glkleei glkleei glkleie gleekil
gleekli gleeikl gleeilk gleelik gleelki glekeil glekeli glekiel glekile gleklie gleklei
gleikel gleikle gleiekl gleielk gleilek gleilke glelkie glelkei glelike gleliek gleleik
gleleki gllekei gllekie glleeki glleeik glleiek glleike gllkeei gllkeie gllkeei gllkeie
gllkiee gllkiee gllekei gllekie glleeki glleeik glleiek glleike gllikee gllikee gllieke
gllieek gllieek gllieke eliegkl elieglk eliekgl elieklg elielkg elielgk eligekl eligelk
eligkel eligkle eliglke eliglek elikgel elikgle elikegl elikelg elikleg eliklge elilgke
elilgek elilkge elilkeg elilekg elilegk eleigkl eleiglk eleikgl eleiklg eleilkg eleilgk
elegikl elegilk elegkil elegkli eleglki eleglik elekgil elekgli elekigl elekilg eleklig
eleklgi elelgki elelgik elelkgi elelkig elelikg eleligk elgeikl elgeilk elgekil elgekli
elgelki elgelik elgiekl elgielk elgikel elgikle elgilke elgilek elgkiel elgkile elgkeil
elgkeli elgklei elgklie elglike elgliek elglkie elglkei elgleki elgleik elkegil elkegli
elkeigl elkeilg elkelig elkelgi elkgeil elkgeli elkgiel elkgile elkglie elkglei elkigel
elkigle elkiegl elkielg elkileg elkilge elklgie elklgei elklige elklieg elkleig elklegi
ellegki ellegik ellekgi ellekig elleikg elleigk ellgeki ellgeik ellgkei ellgkie ellgike
ellgiek ellkgei ellkgie ellkegi ellkeig ellkieg ellkige elligke elligek ellikge ellikeg
elliekg elliegk eilegkl eileglk eilekgl eileklg eilelkg eilelgk eilgekl eilgelk eilgkel
eilgkle eilglke eilglek eilkgel eilkgle eilkegl eilkelg eilkleg eilklge eillgke eillgek
eillkge eillkeg eillekg eillegk eielgkl eielglk eielkgl eielklg eiellkg eiellgk eieglkl
eiegllk eiegkll eiegkll eieglkl eiegllk eiekgll eiekgll eieklgl eiekllg eiekllg eieklgl
eielgkl eielglk eielkgl eielklg eiellkg eiellgk eigelkl eigellk eigekll eigekll eigelkl
eigellk eiglekl eiglelk eiglkel eiglkle eigllke eigllek eigklel eigklle eigkell eigkell
eigklel eigklle eigllke eigllek eiglkle eiglkel eiglekl eiglelk eikegll eikegll eikelgl
eikellg eikellg eikelgl eikgell eikgell eikglel eikglle eikglle eikglel eiklgel eiklgle
eiklegl eiklelg eiklleg eikllge eiklgle eiklgel eikllge eiklleg eiklelg eiklegl eilegkl
eileglk eilekgl eileklg eilelkg eilelgk eilgekl eilgelk eilgkel eilgkle eilglke eilglek
eilkgel eilkgle eilkegl eilkelg eilkleg eilklge eillgke eillgek eillkge eillkeg eillekg
eillegk eeilgkl eeilglk eeilkgl eeilklg eeillkg eeillgk eeiglkl eeigllk eeigkll eeigkll
eeiglkl eeigllk eeikgll eeikgll eeiklgl eeikllg eeikllg eeiklgl eeilgkl eeilglk eeilkgl
eeilklg eeillkg eeillgk eeligkl eeliglk eelikgl eeliklg eelilkg eelilgk eelgikl eelgilk
eelgkil eelgkli eelglki eelglik eelkgil eelkgli eelkigl eelkilg eelklig eelklgi eellgki
eellgik eellkgi eellkig eellikg eelligk eeglikl eeglilk eeglkil eeglkli eegllki eegllik
eegilkl eegillk eegikll eegikll eegilkl eegillk eegkill eegkill eegklil eegklli eegklli
eegklil eeglikl eeglilk eeglkil eeglkli eegllki eegllik eeklgil eeklgli eekligl eeklilg
eekllig eekllgi eekglil eekglli eekgill eekgill eekglil eekglli eekigll eekigll eekilgl
eekillg eekillg eekilgl eeklgil eeklgli eekligl eeklilg eekllig eekllgi eellgki eellgik
eellkgi eellkig eellikg eelligk eelglki eelglik eelgkli eelgkil eelgikl eelgilk eelkgli
eelkgil eelklgi eelklig eelkilg eelkigl eeligkl eeliglk eelikgl eeliklg eelilkg eelilgk
egielkl egiellk egiekll egiekll egielkl egiellk egilekl egilelk egilkel egilkle egillke
egillek egiklel egiklle egikell egikell egiklel egiklle egillke egillek egilkle egilkel
egilekl egilelk egeilkl egeillk egeikll egeikll egeilkl egeillk egelikl egelilk egelkil
egelkli egellki egellik egeklil egeklli egekill egekill egeklil egeklli egellki egellik
egelkli egelkil egelikl egelilk egleikl egleilk eglekil eglekli eglelki eglelik egliekl
eglielk eglikel eglikle eglilke eglilek eglkiel eglkile eglkeil eglkeli eglklei eglklie
egllike eglliek egllkie egllkei eglleki eglleik egkelil egkelli egkeill egkeill egkelil
egkelli egkleil egkleli egkliel egklile egkllie egkllei egkilel egkille egkiell egkiell
egkilel egkille egkllie egkllei egklile egkliel egkleil egkleli eglelki eglelik eglekli
eglekil egleikl egleilk eglleki eglleik egllkei egllkie egllike eglliek eglklei eglklie
eglkeli eglkeil eglkiel eglkile eglilke eglilek eglikle eglikel egliekl eglielk ekiegll
ekiegll ekielgl ekiellg ekiellg ekielgl ekigell ekigell ekiglel ekiglle ekiglle ekiglel
ekilgel ekilgle ekilegl ekilelg ekilleg ekillge ekilgle ekilgel ekillge ekilleg ekilelg
ekilegl ekeigll ekeigll ekeilgl ekeillg ekeillg ekeilgl ekegill ekegill ekeglil ekeglli
ekeglli ekeglil ekelgil ekelgli ekeligl ekelilg ekellig ekellgi ekelgli ekelgil ekellgi
ekellig ekelilg ekeligl ekgeill ekgeill ekgelil ekgelli ekgelli ekgelil ekgiell ekgiell
ekgilel ekgille ekgille ekgilel ekgliel ekglile ekgleil ekgleli ekgllei ekgllie ekglile
ekgliel ekgllie ekgllei ekgleli ekgleil eklegil eklegli ekleigl ekleilg eklelig eklelgi
eklgeil eklgeli eklgiel eklgile eklglie eklglei ekligel ekligle ekliegl eklielg eklileg
eklilge ekllgie ekllgei ekllige ekllieg eklleig ekllegi eklegli eklegil eklelgi eklelig
ekleilg ekleigl eklgeli eklgeil eklglei eklglie eklgile eklgiel ekllgei ekllgie ekllegi
eklleig ekllieg ekllige ekligle ekligel eklilge eklileg eklielg ekliegl eliegkl elieglk
eliekgl elieklg elielkg elielgk eligekl eligelk eligkel eligkle eliglke eliglek elikgel
elikgle elikegl elikelg elikleg eliklge elilgke elilgek elilkge elilkeg elilekg elilegk
eleigkl eleiglk eleikgl eleiklg eleilkg eleilgk elegikl elegilk elegkil elegkli eleglki
eleglik elekgil elekgli elekigl elekilg eleklig eleklgi elelgki elelgik elelkgi elelkig
elelikg eleligk elgeikl elgeilk elgekil elgekli elgelki elgelik elgiekl elgielk elgikel
elgikle elgilke elgilek elgkiel elgkile elgkeil elgkeli elgklei elgklie elglike elgliek
elglkie elglkei elgleki elgleik elkegil elkegli elkeigl elkeilg elkelig elkelgi elkgeil
elkgeli elkgiel elkgile elkglie elkglei elkigel elkigle elkiegl elkielg elkileg elkilge
elklgie elklgei elklige elklieg elkleig elklegi ellegki ellegik ellekgi ellekig elleikg
elleigk ellgeki ellgeik ellgkei ellgkie ellgike ellgiek ellkgei ellkgie ellkegi ellkeig
ellkieg ellkige elligke elligek ellikge ellikeg elliekg elliegk lliegek lliegke llieegk
llieekg lliekeg lliekge lligeek lligeke lligeek lligeke lligkee lligkee lliegek lliegke
llieegk llieekg lliekeg lliekge llikgee llikgee llikege llikeeg llikeeg llikege lleigek
lleigke lleiegk lleiekg lleikeg lleikge llegiek llegike llegeik llegeki llegkei llegkie
lleegik lleegki lleeigk lleeikg lleekig lleekgi llekgei llekgie llekegi llekeig llekieg
llekige llgeiek llgeike llgeeik llgeeki llgekei llgekie llgieek llgieke llgieek llgieke
llgikee llgikee llgeiek llgeike llgeeik llgeeki llgekei llgekie llgkiee llgkiee llgkeie
llgkeei llgkeei llgkeie lleegik lleegki lleeigk lleeikg lleekig lleekgi llegeik llegeki
llegiek llegike llegkie llegkei lleigek lleigke lleiegk lleiekg lleikeg lleikge llekgie
llekgei llekige llekieg llekeig llekegi llkegei llkegie llkeegi llkeeig llkeieg llkeige
llkgeei llkgeie llkgeei llkgeie llkgiee llkgiee llkegei llkegie llkeegi llkeeig llkeieg
llkeige llkigee llkigee llkiege llkieeg llkieeg llkiege lilegek lilegke lileegk lileekg
lilekeg lilekge lilgeek lilgeke lilgeek lilgeke lilgkee lilgkee lilegek lilegke lileegk
lileekg lilekeg lilekge lilkgee lilkgee lilkege lilkeeg lilkeeg lilkege lielgek lielgke
lielegk lielekg lielkeg lielkge lieglek lieglke liegelk liegekl liegkel liegkle lieeglk
lieegkl lieelgk lieelkg lieeklg lieekgl liekgel liekgle liekegl liekelg liekleg lieklge
ligelek ligelke ligeelk ligeekl ligekel ligekle ligleek ligleke ligleek ligleke liglkee
liglkee ligelek ligelke ligeelk ligeekl ligekel ligekle ligklee ligklee ligkele ligkeel
ligkeel ligkele lieeglk lieegkl lieelgk lieelkg lieeklg lieekgl liegelk liegekl lieglek
lieglke liegkle liegkel lielgek lielgke lielegk lielekg lielkeg lielkge liekgle liekgel
lieklge liekleg liekelg liekegl likegel likegle likeegl likeelg likeleg likelge likgeel
likgele likgeel likgele likglee likglee likegel likegle likeegl likeelg likeleg likelge
liklgee liklgee liklege likleeg likleeg liklege leilgek leilgke leilegk leilekg leilkeg
leilkge leiglek leiglke leigelk leigekl leigkel leigkle leieglk leiegkl leielgk leielkg
leieklg leiekgl leikgel leikgle leikegl leikelg leikleg leiklge leligek leligke leliegk
leliekg lelikeg lelikge lelgiek lelgike lelgeik lelgeki lelgkei lelgkie lelegik lelegki
leleigk leleikg lelekig lelekgi lelkgei lelkgie lelkegi lelkeig lelkieg lelkige legliek
leglike legleik legleki leglkei leglkie legilek legilke legielk legiekl legikel legikle
legeilk legeikl legelik legelki legekli legekil legkiel legkile legkeil legkeli legklei
legklie leelgik leelgki leeligk leelikg leelkig leelkgi leeglik leeglki leegilk leegikl
leegkil leegkli leeiglk leeigkl leeilgk leeilkg leeiklg leeikgl leekgil leekgli leekigl
leekilg leeklig leeklgi leklgei leklgie leklegi lekleig leklieg leklige lekglei lekglie
lekgeli lekgeil lekgiel lekgile lekegli lekegil lekelgi lekelig lekeilg lekeigl lekigel
lekigle lekiegl lekielg lekileg lekilge lgielek lgielke lgieelk lgieekl lgiekel lgiekle
lgileek lgileke lgileek lgileke lgilkee lgilkee lgielek lgielke lgieelk lgieekl lgiekel
lgiekle lgiklee lgiklee lgikele lgikeel lgikeel lgikele lgeilek lgeilke lgeielk lgeiekl
lgeikel lgeikle lgeliek lgelike lgeleik lgeleki lgelkei lgelkie lgeelik lgeelki lgeeilk
lgeeikl lgeekil lgeekli lgeklei lgeklie lgekeli lgekeil lgekiel lgekile lgleiek lgleike
lgleeik lgleeki lglekei lglekie lglieek lglieke lglieek lglieke lglikee lglikee lgleiek
lgleike lgleeik lgleeki lglekei lglekie lglkiee lglkiee lglkeie lglkeei lglkeei lglkeie
lgeelik lgeelki lgeeilk lgeeikl lgeekil lgeekli lgeleik lgeleki lgeliek lgelike lgelkie
lgelkei lgeilek lgeilke lgeielk lgeiekl lgeikel lgeikle lgeklie lgeklei lgekile lgekiel
lgekeil lgekeli lgkelei lgkelie lgkeeli lgkeeil lgkeiel lgkeile lgkleei lgkleie lgkleei
lgkleie lgkliee lgkliee lgkelei lgkelie lgkeeli lgkeeil lgkeiel lgkeile lgkilee lgkilee
lgkiele lgkieel lgkieel lgkiele leieglk leiegkl leielgk leielkg leieklg leiekgl leigelk
leigekl leiglek leiglke leigkle leigkel leilgek leilgke leilegk leilekg leilkeg leilkge
leikgle leikgel leiklge leikleg leikelg leikegl leeiglk leeigkl leeilgk leeilkg leeiklg
leeikgl leegilk leegikl leeglik leeglki leegkli leegkil leelgik leelgki leeligk leelikg
leelkig leelkgi leekgli leekgil leeklgi leeklig leekilg leekigl legeilk legeikl legelik
legelki legekli legekil legielk legiekl legilek legilke legikle legikel legliek leglike
legleik legleki leglkei leglkie legkile legkiel legklie legklei legkeli legkeil lelegik
lelegki leleigk leleikg lelekig lelekgi lelgeik lelgeki lelgiek lelgike lelgkie lelgkei
leligek leligke leliegk leliekg lelikeg lelikge lelkgie lelkgei lelkige lelkieg lelkeig
lelkegi lekegli lekegil lekelgi lekelig lekeilg lekeigl lekgeli lekgeil lekglei lekglie
lekgile lekgiel leklgei leklgie leklegi lekleig leklieg leklige lekigle lekigel lekilge
lekileg lekielg lekiegl lkiegel lkiegle lkieegl lkieelg lkieleg lkielge lkigeel lkigele
lkigeel lkigele lkiglee lkiglee lkiegel lkiegle lkieegl lkieelg lkieleg lkielge lkilgee
lkilgee lkilege lkileeg lkileeg lkilege lkeigel lkeigle lkeiegl lkeielg lkeileg lkeilge
lkegiel lkegile lkegeil lkegeli lkeglei lkeglie lkeegil lkeegli lkeeigl lkeeilg lkeelig
lkeelgi lkelgei lkelgie lkelegi lkeleig lkelieg lkelige lkgeiel lkgeile lkgeeil lkgeeli
lkgelei lkgelie lkgieel lkgiele lkgieel lkgiele lkgilee lkgilee lkgeiel lkgeile lkgeeil
lkgeeli lkgelei lkgelie lkgliee lkgliee lkgleie lkgleei lkgleei lkgleie lkeegil lkeegli
lkeeigl lkeeilg lkeelig lkeelgi lkegeil lkegeli lkegiel lkegile lkeglie lkeglei lkeigel
lkeigle lkeiegl lkeielg lkeileg lkeilge lkelgie lkelgei lkelige lkelieg lkeleig lkelegi
lklegei lklegie lkleegi lkleeig lkleieg lkleige lklgeei lklgeie lklgeei lklgeie lklgiee
lklgiee lklegei lklegie lkleegi lkleeig lkleieg lkleige lkligee lkligee lkliege lklieeg
lklieeg lkliege

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us