easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

suborns

flevensis

resonabitis

gerisparc

girardi

thicketed

quartzoid

potteen

corre

socials

gunghi

triunion

amphidiscophoran

werre

unimitative

stroogo

musico

nimblest


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: klecker
cipher variations:
lmfdlfs mngemgt nohfnhu opigoiv pqjhpjw
qrkiqkx rsljrly stmksmz tunltna uvomuob
vwpnvpc wxqowqd xyrpxre yzsqysf zatrztg
abusauh bcvtbvi cdwucwj dexvdxk efyweyl
fgzxfzm ghaygan hibzhbo ijcaicp jkdbjdq

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: klecker
Cipher: povxpvi

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: klecker
Cipher: ABAAB ABABA AABAA AAABA ABAAB AABAA BAAAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: klecker
cipher variations:
lmfdlfsfinhfnazevlzvitadptdqnwltnlyhstxhtgvkjfvjwpgrjpre
jcznjzmdyhrdhuxupvxpcrqxzrxkmngemgtgjoigobafwmawjubequer
oxmuomzituyiuhwlkgwkxqhskqsfkdaokaneziseivyvqwyqdsryasyl
nohfnhuhkpjhpcbgxnbxkvcfrvfspynvpnajuvzjvixmlhxlyritlrtg
lebplbofajtfjwzwrxzretszbtzmopigoivilqkiqdchyocylwdgswgt
qzowqobkvwakwjynmiymzsjumsuhmfcqmcpgbkugkxaxsyasfutacuan
pqjhpjwjmrljredizpdzmxehtxhurapxrpclwxblxkzonjznatkvntvi
ngdrndqhclvhlybytzbtgvubdvboqrkiqkxknsmksfejaqeanyfiuyiv
sbqysqdmxycmylapokaobulwouwjohesoeridmwimzczuacuhwvcewcp
rsljrlylotnltgfkbrfbozgjvzjwtcrztrenyzdnzmbqplbpcvmxpvxk
piftpfsjenxjnadavbdvixwdfxdqstmksmzmpuomuhglcsgcpahkwakx
udsausfozaeoancrqmcqdwnyqwylqjguqgtkfoykobebwcewjyxegyer
tunltnanqvpnvihmdthdqbilxblyvetbvtgpabfpbodsrndrexozrxzm
rkhvrhulgpzlpcfcxdfxkzyfhzfsuvomuoborwqowjineuiercjmycmz
wfucwuhqbcgqcpetsoesfypasyansliwsivmhqamqdgdyegylazgiagt
vwpnvpcpsxrpxkjofvjfsdknzdnaxgvdxvircdhrdqfutpftgzqbtzbo
tmjxtjwnirbnrehezfhzmbahjbhuwxqowqdqtysqylkpgwkgteloaeob
yhweywjsdeisergvuqguharcuacpunkyukxojscosfifagiancbikciv
xyrpxreruztrzmlqhxlhufmpbfpczixfzxktefjtfshwvrhvibsdvbdq
volzvlypktdptgjgbhjbodcjldjwyzsqysfsvausanmriymivgnqcgqd
ajygaylufgkugtixwsiwjctewcerwpmawmzqluequhkhcikcpedkmekx
zatrztgtwbvtbonsjznjwhordhrebkzhbzmvghlvhujyxtjxkdufxdfs
xqnbxnarmvfrvilidjldqfelnflyabusauhuxcwucpotkaokxipseisf
claicanwhimwivkzyukylevgyegtyrocyobsnwgswjmjekmergfmogmz
bcvtbvivydxvdqpulbplyjqtfjtgdmbjdboxijnxjwlazvlzmfwhzfhu
zspdzpctoxhtxknkflnfshgnphnacdwucwjwzeywerqvmcqmzkrugkuh
enckecpyjkoykxmbawmangxiagivatqeaqdupyiuylolgmogtihoqiob
dexvdxkxafzxfsrwndrnalsvhlvifodlfdqzklpzlyncbxnbohyjbhjw
burfbrevqzjvzmpmhnphujiprjpcefyweylybgaygtsxoesobmtwimwj
gpemgeralmqamzodcyocpizkcikxcvsgcsfwrakwanqnioqivkjqskqd
fgzxfzmzchbzhutypftpcnuxjnxkhqfnhfsbmnrbnapedzpdqjaldjly
dwthdtgxsblxborojprjwlkrtlreghayganadicaivuzqguqdovykoyl
irgoigtcnoscobqfeaqerkbmekmzexuieuhytcmycpspkqskxmlsumsf
hibzhbobejdbjwvarhvrepwzlpzmjshpjhudoptdpcrgfbrfslcnflna
fyvjfvizudnzdqtqlrtlynmtvntgijcaicpcfkeckxwbsiwsfqxamqan
ktiqkivepqueqdshgcsgtmdogmobgzwkgwjaveoaerurmsumzonuwouh
jkdbjdqdglfdlyxctjxtgrybnrbolujrljwfqrvfretihdthunephnpc
haxlhxkbwfpbfsvsntvnapovxpvikleckerehmgemzydukyuhszcoscp
mvksmkxgrswgsfujieuivofqioqdibymiylcxgqcgtwtouwobqpwyqwj

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: klecker
Cipher: xyrpxre

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: klecker
Cipher: 52135131525124

Extended Methods:
Method #1

Plaintext: klecker
method variations:
pqkhpkwuvpnupbzauszugefzxezm

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
k l e c k e r 
5 1 5 3 5 5 2 
2 3 1 1 2 1 4 
They are then read out in rows:
51535522311214
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: klecker
Cipher: epzgcfq

Read more ...
Method #3

Plaintext: klecker
method variations:
bxlvwfy xlvwfyb lvwfybx
vwfybxl wfybxlv fybxlvw
ybxlvwf

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: klecker

all 5040 cipher variations:
klecker kleckre klecekr klecerk klecrek klecrke klekcer klekcre klekecr klekerc klekrec
klekrce kleekcr kleekrc kleeckr kleecrk kleerck kleerkc klerkec klerkce klerekc klereck
klercek klercke klceker klcekre klceekr klceerk klcerek klcerke klckeer klckere klckeer
klckere klckree klckree klceker klcekre klceekr klceerk klcerek klcerke klcrkee klcrkee
klcreke klcreek klcreek klcreke klkceer klkcere klkceer klkcere klkcree klkcree klkecer
klkecre klkeecr klkeerc klkerec klkerce klkeecr klkeerc klkecer klkecre klkerce klkerec
klkreec klkrece klkreec klkrece klkrcee klkrcee klecker kleckre klecekr klecerk klecrek
klecrke klekcer klekcre klekecr klekerc klekrec klekrce kleekcr kleekrc kleeckr kleecrk
kleerck kleerkc klerkec klerkce klerekc klereck klercek klercke klrckee klrckee klrceke
klrceek klrceek klrceke klrkcee klrkcee klrkece klrkeec klrkeec klrkece klrekce klrekec
klrecke klrecek klreeck klreekc klrekec klrekce klreekc klreeck klrecek klrecke kelcker
kelckre kelcekr kelcerk kelcrek kelcrke kelkcer kelkcre kelkecr kelkerc kelkrec kelkrce
kelekcr kelekrc keleckr kelecrk kelerck kelerkc kelrkec kelrkce kelrekc kelreck kelrcek
kelrcke keclker keclkre keclekr keclerk keclrek keclrke keckler kecklre keckelr keckerl
keckrel keckrle keceklr kecekrl kecelkr kecelrk kecerlk kecerkl kecrkel kecrkle kecrekl
kecrelk kecrlek kecrlke kekcler kekclre kekcelr kekcerl kekcrel kekcrle keklcer keklcre
keklecr keklerc keklrec keklrce kekelcr kekelrc kekeclr kekecrl kekercl kekerlc kekrlec
kekrlce kekrelc kekrecl kekrcel kekrcle keecklr keeckrl keeclkr keeclrk keecrlk keecrkl
keekclr keekcrl keeklcr keeklrc keekrlc keekrcl keelkcr keelkrc keelckr keelcrk keelrck
keelrkc keerklc keerkcl keerlkc keerlck keerclk keerckl kerckel kerckle kercekl kercelk
kerclek kerclke kerkcel kerkcle kerkecl kerkelc kerklec kerklce kerekcl kereklc kereckl
kereclk kerelck kerelkc kerlkec kerlkce kerlekc kerleck kerlcek kerlcke kcelker kcelkre
kcelekr kcelerk kcelrek kcelrke kcekler kceklre kcekelr kcekerl kcekrel kcekrle kceeklr
kceekrl kceelkr kceelrk kceerlk kceerkl kcerkel kcerkle kcerekl kcerelk kcerlek kcerlke
kcleker kclekre kcleekr kcleerk kclerek kclerke kclkeer kclkere kclkeer kclkere kclkree
kclkree kcleker kclekre kcleekr kcleerk kclerek kclerke kclrkee kclrkee kclreke kclreek
kclreek kclreke kckleer kcklere kckleer kcklere kcklree kcklree kckeler kckelre kckeelr
kckeerl kckerel kckerle kckeelr kckeerl kckeler kckelre kckerle kckerel kckreel kckrele
kckreel kckrele kckrlee kckrlee kcelker kcelkre kcelekr kcelerk kcelrek kcelrke kcekler
kceklre kcekelr kcekerl kcekrel kcekrle kceeklr kceekrl kceelkr kceelrk kceerlk kceerkl
kcerkel kcerkle kcerekl kcerelk kcerlek kcerlke kcrlkee kcrlkee kcrleke kcrleek kcrleek
kcrleke kcrklee kcrklee kcrkele kcrkeel kcrkeel kcrkele kcrekle kcrekel kcrelke kcrelek
kcreelk kcreekl kcrekel kcrekle kcreekl kcreelk kcrelek kcrelke kkecler kkeclre kkecelr
kkecerl kkecrel kkecrle kkelcer kkelcre kkelecr kkelerc kkelrec kkelrce kkeelcr kkeelrc
kkeeclr kkeecrl kkeercl kkeerlc kkerlec kkerlce kkerelc kkerecl kkercel kkercle kkceler
kkcelre kkceelr kkceerl kkcerel kkcerle kkcleer kkclere kkcleer kkclere kkclree kkclree
kkceler kkcelre kkceelr kkceerl kkcerel kkcerle kkcrlee kkcrlee kkcrele kkcreel kkcreel
kkcrele kklceer kklcere kklceer kklcere kklcree kklcree kklecer kklecre kkleecr kkleerc
kklerec kklerce kkleecr kkleerc kklecer kklecre kklerce kklerec kklreec kklrece kklreec
kklrece kklrcee kklrcee kkecler kkeclre kkecelr kkecerl kkecrel kkecrle kkelcer kkelcre
kkelecr kkelerc kkelrec kkelrce kkeelcr kkeelrc kkeeclr kkeecrl kkeercl kkeerlc kkerlec
kkerlce kkerelc kkerecl kkercel kkercle kkrclee kkrclee kkrcele kkrceel kkrceel kkrcele
kkrlcee kkrlcee kkrlece kkrleec kkrleec kkrlece kkrelce kkrelec kkrecle kkrecel kkreecl
kkreelc kkrelec kkrelce kkreelc kkreecl kkrecel kkrecle keecklr keeckrl keeclkr keeclrk
keecrlk keecrkl keekclr keekcrl keeklcr keeklrc keekrlc keekrcl keelkcr keelkrc keelckr
keelcrk keelrck keelrkc keerklc keerkcl keerlkc keerlck keerclk keerckl keceklr kecekrl
kecelkr kecelrk kecerlk kecerkl keckelr keckerl keckler kecklre keckrle keckrel keclker
keclkre keclekr keclerk keclrek keclrke kecrkle kecrkel kecrlke kecrlek kecrelk kecrekl
kekcelr kekcerl kekcler kekclre kekcrle kekcrel kekeclr kekecrl kekelcr kekelrc kekerlc
kekercl keklecr keklerc keklcer keklcre keklrce keklrec kekrelc kekrecl kekrlec kekrlce
kekrcle kekrcel kelcker kelckre kelcekr kelcerk kelcrek kelcrke kelkcer kelkcre kelkecr
kelkerc kelkrec kelkrce kelekcr kelekrc keleckr kelecrk kelerck kelerkc kelrkec kelrkce
kelrekc kelreck kelrcek kelrcke kerckle kerckel kerclke kerclek kercelk kercekl kerkcle
kerkcel kerklce kerklec kerkelc kerkecl kerlkce kerlkec kerlcke kerlcek kerleck kerlekc
kereklc kerekcl kerelkc kerelck kereclk kereckl kreckel kreckle krecekl krecelk kreclek
kreclke krekcel krekcle krekecl krekelc kreklec kreklce kreekcl kreeklc kreeckl kreeclk
kreelck kreelkc krelkec krelkce krelekc kreleck krelcek krelcke krcekel krcekle krceekl
krceelk krcelek krcelke krckeel krckele krckeel krckele krcklee krcklee krcekel krcekle
krceekl krceelk krcelek krcelke krclkee krclkee krcleke krcleek krcleek krcleke krkceel
krkcele krkceel krkcele krkclee krkclee krkecel krkecle krkeecl krkeelc krkelec krkelce
krkeecl krkeelc krkecel krkecle krkelce krkelec krkleec krklece krkleec krklece krklcee
krklcee kreckel kreckle krecekl krecelk kreclek kreclke krekcel krekcle krekecl krekelc
kreklec kreklce kreekcl kreeklc kreeckl kreeclk kreelck kreelkc krelkec krelkce krelekc
kreleck krelcek krelcke krlckee krlckee krlceke krlceek krlceek krlceke krlkcee krlkcee
krlkece krlkeec krlkeec krlkece krlekce krlekec krlecke krlecek krleeck krleekc krlekec
krlekce krleekc krleeck krlecek krlecke lkecker lkeckre lkecekr lkecerk lkecrek lkecrke
lkekcer lkekcre lkekecr lkekerc lkekrec lkekrce lkeekcr lkeekrc lkeeckr lkeecrk lkeerck
lkeerkc lkerkec lkerkce lkerekc lkereck lkercek lkercke lkceker lkcekre lkceekr lkceerk
lkcerek lkcerke lkckeer lkckere lkckeer lkckere lkckree lkckree lkceker lkcekre lkceekr
lkceerk lkcerek lkcerke lkcrkee lkcrkee lkcreke lkcreek lkcreek lkcreke lkkceer lkkcere
lkkceer lkkcere lkkcree lkkcree lkkecer lkkecre lkkeecr lkkeerc lkkerec lkkerce lkkeecr
lkkeerc lkkecer lkkecre lkkerce lkkerec lkkreec lkkrece lkkreec lkkrece lkkrcee lkkrcee
lkecker lkeckre lkecekr lkecerk lkecrek lkecrke lkekcer lkekcre lkekecr lkekerc lkekrec
lkekrce lkeekcr lkeekrc lkeeckr lkeecrk lkeerck lkeerkc lkerkec lkerkce lkerekc lkereck
lkercek lkercke lkrckee lkrckee lkrceke lkrceek lkrceek lkrceke lkrkcee lkrkcee lkrkece
lkrkeec lkrkeec lkrkece lkrekce lkrekec lkrecke lkrecek lkreeck lkreekc lkrekec lkrekce
lkreekc lkreeck lkrecek lkrecke lekcker lekckre lekcekr lekcerk lekcrek lekcrke lekkcer
lekkcre lekkecr lekkerc lekkrec lekkrce lekekcr lekekrc lekeckr lekecrk lekerck lekerkc
lekrkec lekrkce lekrekc lekreck lekrcek lekrcke leckker leckkre leckekr leckerk leckrek
leckrke leckker leckkre leckekr leckerk leckrek leckrke lecekkr lecekrk lecekkr lecekrk
lecerkk lecerkk lecrkek lecrkke lecrekk lecrekk lecrkek lecrkke lekcker lekckre lekcekr
lekcerk lekcrek lekcrke lekkcer lekkcre lekkecr lekkerc lekkrec lekkrce lekekcr lekekrc
lekeckr lekecrk lekerck lekerkc lekrkec lekrkce lekrekc lekreck lekrcek lekrcke leeckkr
leeckrk leeckkr leeckrk leecrkk leecrkk leekckr leekcrk leekkcr leekkrc leekrkc leekrck
leekkcr leekkrc leekckr leekcrk leekrck leekrkc leerkkc leerkck leerkkc leerkck leerckk
leerckk lerckek lerckke lercekk lercekk lerckek lerckke lerkcek lerkcke lerkeck lerkekc
lerkkec lerkkce lerekck lerekkc lereckk lereckk lerekck lerekkc lerkkec lerkkce lerkekc
lerkeck lerkcek lerkcke lcekker lcekkre lcekekr lcekerk lcekrek lcekrke lcekker lcekkre
lcekekr lcekerk lcekrek lcekrke lceekkr lceekrk lceekkr lceekrk lceerkk lceerkk lcerkek
lcerkke lcerekk lcerekk lcerkek lcerkke lckeker lckekre lckeekr lckeerk lckerek lckerke
lckkeer lckkere lckkeer lckkere lckkree lckkree lckeker lckekre lckeekr lckeerk lckerek
lckerke lckrkee lckrkee lckreke lckreek lckreek lckreke lckkeer lckkere lckkeer lckkere
lckkree lckkree lckeker lckekre lckeekr lckeerk lckerek lckerke lckeekr lckeerk lckeker
lckekre lckerke lckerek lckreek lckreke lckreek lckreke lckrkee lckrkee lcekker lcekkre
lcekekr lcekerk lcekrek lcekrke lcekker lcekkre lcekekr lcekerk lcekrek lcekrke lceekkr
lceekrk lceekkr lceekrk lceerkk lceerkk lcerkek lcerkke lcerekk lcerekk lcerkek lcerkke
lcrkkee lcrkkee lcrkeke lcrkeek lcrkeek lcrkeke lcrkkee lcrkkee lcrkeke lcrkeek lcrkeek
lcrkeke lcrekke lcrekek lcrekke lcrekek lcreekk lcreekk lcrekek lcrekke lcreekk lcreekk
lcrekek lcrekke lkecker lkeckre lkecekr lkecerk lkecrek lkecrke lkekcer lkekcre lkekecr
lkekerc lkekrec lkekrce lkeekcr lkeekrc lkeeckr lkeecrk lkeerck lkeerkc lkerkec lkerkce
lkerekc lkereck lkercek lkercke lkceker lkcekre lkceekr lkceerk lkcerek lkcerke lkckeer
lkckere lkckeer lkckere lkckree lkckree lkceker lkcekre lkceekr lkceerk lkcerek lkcerke
lkcrkee lkcrkee lkcreke lkcreek lkcreek lkcreke lkkceer lkkcere lkkceer lkkcere lkkcree
lkkcree lkkecer lkkecre lkkeecr lkkeerc lkkerec lkkerce lkkeecr lkkeerc lkkecer lkkecre
lkkerce lkkerec lkkreec lkkrece lkkreec lkkrece lkkrcee lkkrcee lkecker lkeckre lkecekr
lkecerk lkecrek lkecrke lkekcer lkekcre lkekecr lkekerc lkekrec lkekrce lkeekcr lkeekrc
lkeeckr lkeecrk lkeerck lkeerkc lkerkec lkerkce lkerekc lkereck lkercek lkercke lkrckee
lkrckee lkrceke lkrceek lkrceek lkrceke lkrkcee lkrkcee lkrkece lkrkeec lkrkeec lkrkece
lkrekce lkrekec lkrecke lkrecek lkreeck lkreekc lkrekec lkrekce lkreekc lkreeck lkrecek
lkrecke leeckkr leeckrk leeckkr leeckrk leecrkk leecrkk leekckr leekcrk leekkcr leekkrc
leekrkc leekrck leekkcr leekkrc leekckr leekcrk leekrck leekrkc leerkkc leerkck leerkkc
leerkck leerckk leerckk lecekkr lecekrk lecekkr lecekrk lecerkk lecerkk leckekr leckerk
leckker leckkre leckrke leckrek leckker leckkre leckekr leckerk leckrek leckrke lecrkke
lecrkek lecrkke lecrkek lecrekk lecrekk lekcekr lekcerk lekcker lekckre lekcrke lekcrek
lekeckr lekecrk lekekcr lekekrc lekerkc lekerck lekkecr lekkerc lekkcer lekkcre lekkrce
lekkrec lekrekc lekreck lekrkec lekrkce lekrcke lekrcek lekcker lekckre lekcekr lekcerk
lekcrek lekcrke lekkcer lekkcre lekkecr lekkerc lekkrec lekkrce lekekcr lekekrc lekeckr
lekecrk lekerck lekerkc lekrkec lekrkce lekrekc lekreck lekrcek lekrcke lerckke lerckek
lerckke lerckek lercekk lercekk lerkcke lerkcek lerkkce lerkkec lerkekc lerkeck lerkkce
lerkkec lerkcke lerkcek lerkeck lerkekc lerekkc lerekck lerekkc lerekck lereckk lereckk
lreckek lreckke lrecekk lrecekk lreckek lreckke lrekcek lrekcke lrekeck lrekekc lrekkec
lrekkce lreekck lreekkc lreeckk lreeckk lreekck lreekkc lrekkec lrekkce lrekekc lrekeck
lrekcek lrekcke lrcekek lrcekke lrceekk lrceekk lrcekek lrcekke lrckeek lrckeke lrckeek
lrckeke lrckkee lrckkee lrcekek lrcekke lrceekk lrceekk lrcekek lrcekke lrckkee lrckkee
lrckeke lrckeek lrckeek lrckeke lrkceek lrkceke lrkceek lrkceke lrkckee lrkckee lrkecek
lrkecke lrkeeck lrkeekc lrkekec lrkekce lrkeeck lrkeekc lrkecek lrkecke lrkekce lrkekec
lrkkeec lrkkece lrkkeec lrkkece lrkkcee lrkkcee lreckek lreckke lrecekk lrecekk lreckek
lreckke lrekcek lrekcke lrekeck lrekekc lrekkec lrekkce lreekck lreekkc lreeckk lreeckk
lreekck lreekkc lrekkec lrekkce lrekekc lrekeck lrekcek lrekcke lrkckee lrkckee lrkceke
lrkceek lrkceek lrkceke lrkkcee lrkkcee lrkkece lrkkeec lrkkeec lrkkece lrkekce lrkekec
lrkecke lrkecek lrkeeck lrkeekc lrkekec lrkekce lrkeekc lrkeeck lrkecek lrkecke elkcker
elkckre elkcekr elkcerk elkcrek elkcrke elkkcer elkkcre elkkecr elkkerc elkkrec elkkrce
elkekcr elkekrc elkeckr elkecrk elkerck elkerkc elkrkec elkrkce elkrekc elkreck elkrcek
elkrcke elckker elckkre elckekr elckerk elckrek elckrke elckker elckkre elckekr elckerk
elckrek elckrke elcekkr elcekrk elcekkr elcekrk elcerkk elcerkk elcrkek elcrkke elcrekk
elcrekk elcrkek elcrkke elkcker elkckre elkcekr elkcerk elkcrek elkcrke elkkcer elkkcre
elkkecr elkkerc elkkrec elkkrce elkekcr elkekrc elkeckr elkecrk elkerck elkerkc elkrkec
elkrkce elkrekc elkreck elkrcek elkrcke eleckkr eleckrk eleckkr eleckrk elecrkk elecrkk
elekckr elekcrk elekkcr elekkrc elekrkc elekrck elekkcr elekkrc elekckr elekcrk elekrck
elekrkc elerkkc elerkck elerkkc elerkck elerckk elerckk elrckek elrckke elrcekk elrcekk
elrckek elrckke elrkcek elrkcke elrkeck elrkekc elrkkec elrkkce elrekck elrekkc elreckk
elreckk elrekck elrekkc elrkkec elrkkce elrkekc elrkeck elrkcek elrkcke eklcker eklckre
eklcekr eklcerk eklcrek eklcrke eklkcer eklkcre eklkecr eklkerc eklkrec eklkrce eklekcr
eklekrc ekleckr eklecrk eklerck eklerkc eklrkec eklrkce eklrekc eklreck eklrcek eklrcke
ekclker ekclkre ekclekr ekclerk ekclrek ekclrke ekckler ekcklre ekckelr ekckerl ekckrel
ekckrle ekceklr ekcekrl ekcelkr ekcelrk ekcerlk ekcerkl ekcrkel ekcrkle ekcrekl ekcrelk
ekcrlek ekcrlke ekkcler ekkclre ekkcelr ekkcerl ekkcrel ekkcrle ekklcer ekklcre ekklecr
ekklerc ekklrec ekklrce ekkelcr ekkelrc ekkeclr ekkecrl ekkercl ekkerlc ekkrlec ekkrlce
ekkrelc ekkrecl ekkrcel ekkrcle ekecklr ekeckrl ekeclkr ekeclrk ekecrlk ekecrkl ekekclr
ekekcrl ekeklcr ekeklrc ekekrlc ekekrcl ekelkcr ekelkrc ekelckr ekelcrk ekelrck ekelrkc
ekerklc ekerkcl ekerlkc ekerlck ekerclk ekerckl ekrckel ekrckle ekrcekl ekrcelk ekrclek
ekrclke ekrkcel ekrkcle ekrkecl ekrkelc ekrklec ekrklce ekrekcl ekreklc ekreckl ekreclk
ekrelck ekrelkc ekrlkec ekrlkce ekrlekc ekrleck ekrlcek ekrlcke ecklker ecklkre ecklekr
ecklerk ecklrek ecklrke eckkler eckklre eckkelr eckkerl eckkrel eckkrle eckeklr eckekrl
eckelkr eckelrk eckerlk eckerkl eckrkel eckrkle eckrekl eckrelk eckrlek eckrlke eclkker
eclkkre eclkekr eclkerk eclkrek eclkrke eclkker eclkkre eclkekr eclkerk eclkrek eclkrke
eclekkr eclekrk eclekkr eclekrk eclerkk eclerkk eclrkek eclrkke eclrekk eclrekk eclrkek
eclrkke ecklker ecklkre ecklekr ecklerk ecklrek ecklrke eckkler eckklre eckkelr eckkerl
eckkrel eckkrle eckeklr eckekrl eckelkr eckelrk eckerlk eckerkl eckrkel eckrkle eckrekl
eckrelk eckrlek eckrlke ecelkkr ecelkrk ecelkkr ecelkrk ecelrkk ecelrkk eceklkr eceklrk
ecekklr ecekkrl ecekrkl ecekrlk ecekklr ecekkrl eceklkr eceklrk ecekrlk ecekrkl ecerkkl
ecerklk ecerkkl ecerklk ecerlkk ecerlkk ecrlkek ecrlkke ecrlekk ecrlekk ecrlkek ecrlkke
ecrklek ecrklke ecrkelk ecrkekl ecrkkel ecrkkle ecreklk ecrekkl ecrelkk ecrelkk ecreklk
ecrekkl ecrkkel ecrkkle ecrkekl ecrkelk ecrklek ecrklke ekkcler ekkclre ekkcelr ekkcerl
ekkcrel ekkcrle ekklcer ekklcre ekklecr ekklerc ekklrec ekklrce ekkelcr ekkelrc ekkeclr
ekkecrl ekkercl ekkerlc ekkrlec ekkrlce ekkrelc ekkrecl ekkrcel ekkrcle ekckler ekcklre
ekckelr ekckerl ekckrel ekckrle ekclker ekclkre ekclekr ekclerk ekclrek ekclrke ekcelkr
ekcelrk ekceklr ekcekrl ekcerkl ekcerlk ekcrlek ekcrlke ekcrelk ekcrekl ekcrkel ekcrkle
eklcker eklckre eklcekr eklcerk eklcrek eklcrke eklkcer eklkcre eklkecr eklkerc eklkrec
eklkrce eklekcr eklekrc ekleckr eklecrk eklerck eklerkc eklrkec eklrkce eklrekc eklreck
eklrcek eklrcke ekeclkr ekeclrk ekecklr ekeckrl ekecrkl ekecrlk ekelckr ekelcrk ekelkcr
ekelkrc ekelrkc ekelrck ekeklcr ekeklrc ekekclr ekekcrl ekekrcl ekekrlc ekerlkc ekerlck
ekerklc ekerkcl ekerckl ekerclk ekrclek ekrclke ekrcelk ekrcekl ekrckel ekrckle ekrlcek
ekrlcke ekrleck ekrlekc ekrlkec ekrlkce ekrelck ekrelkc ekreclk ekreckl ekrekcl ekreklc
ekrklec ekrklce ekrkelc ekrkecl ekrkcel ekrkcle eekcklr eekckrl eekclkr eekclrk eekcrlk
eekcrkl eekkclr eekkcrl eekklcr eekklrc eekkrlc eekkrcl eeklkcr eeklkrc eeklckr eeklcrk
eeklrck eeklrkc eekrklc eekrkcl eekrlkc eekrlck eekrclk eekrckl eeckklr eeckkrl eecklkr
eecklrk eeckrlk eeckrkl eeckklr eeckkrl eecklkr eecklrk eeckrlk eeckrkl eeclkkr eeclkrk
eeclkkr eeclkrk eeclrkk eeclrkk eecrklk eecrkkl eecrlkk eecrlkk eecrklk eecrkkl eekcklr
eekckrl eekclkr eekclrk eekcrlk eekcrkl eekkclr eekkcrl eekklcr eekklrc eekkrlc eekkrcl
eeklkcr eeklkrc eeklckr eeklcrk eeklrck eeklrkc eekrklc eekrkcl eekrlkc eekrlck eekrclk
eekrckl eelckkr eelckrk eelckkr eelckrk eelcrkk eelcrkk eelkckr eelkcrk eelkkcr eelkkrc
eelkrkc eelkrck eelkkcr eelkkrc eelkckr eelkcrk eelkrck eelkrkc eelrkkc eelrkck eelrkkc
eelrkck eelrckk eelrckk eercklk eerckkl eerclkk eerclkk eercklk eerckkl eerkclk eerkckl
eerklck eerklkc eerkklc eerkkcl eerlkck eerlkkc eerlckk eerlckk eerlkck eerlkkc eerkklc
eerkkcl eerklkc eerklck eerkclk eerkckl erkckel erkckle erkcekl erkcelk erkclek erkclke
erkkcel erkkcle erkkecl erkkelc erkklec erkklce erkekcl erkeklc erkeckl erkeclk erkelck
erkelkc erklkec erklkce erklekc erkleck erklcek erklcke erckkel erckkle erckekl erckelk
ercklek ercklke erckkel erckkle erckekl erckelk ercklek ercklke ercekkl erceklk ercekkl
erceklk ercelkk ercelkk erclkek erclkke erclekk erclekk erclkek erclkke erkckel erkckle
erkcekl erkcelk erkclek erkclke erkkcel erkkcle erkkecl erkkelc erkklec erkklce erkekcl
erkeklc erkeckl erkeclk erkelck erkelkc erklkec erklkce erklekc erkleck erklcek erklcke
ereckkl erecklk ereckkl erecklk ereclkk ereclkk erekckl erekclk erekkcl erekklc ereklkc
ereklck erekkcl erekklc erekckl erekclk ereklck ereklkc erelkkc erelkck erelkkc erelkck
erelckk erelckk erlckek erlckke erlcekk erlcekk erlckek erlckke erlkcek erlkcke erlkeck
erlkekc erlkkec erlkkce erlekck erlekkc erleckk erleckk erlekck erlekkc erlkkec erlkkce
erlkekc erlkeck erlkcek erlkcke clekker clekkre clekekr clekerk clekrek clekrke clekker
clekkre clekekr clekerk clekrek clekrke cleekkr cleekrk cleekkr cleekrk cleerkk cleerkk
clerkek clerkke clerekk clerekk clerkek clerkke clkeker clkekre clkeekr clkeerk clkerek
clkerke clkkeer clkkere clkkeer clkkere clkkree clkkree clkeker clkekre clkeekr clkeerk
clkerek clkerke clkrkee clkrkee clkreke clkreek clkreek clkreke clkkeer clkkere clkkeer
clkkere clkkree clkkree clkeker clkekre clkeekr clkeerk clkerek clkerke clkeekr clkeerk
clkeker clkekre clkerke clkerek clkreek clkreke clkreek clkreke clkrkee clkrkee clekker
clekkre clekekr clekerk clekrek clekrke clekker clekkre clekekr clekerk clekrek clekrke
cleekkr cleekrk cleekkr cleekrk cleerkk cleerkk clerkek clerkke clerekk clerekk clerkek
clerkke clrkkee clrkkee clrkeke clrkeek clrkeek clrkeke clrkkee clrkkee clrkeke clrkeek
clrkeek clrkeke clrekke clrekek clrekke clrekek clreekk clreekk clrekek clrekke clreekk
clreekk clrekek clrekke celkker celkkre celkekr celkerk celkrek celkrke celkker celkkre
celkekr celkerk celkrek celkrke celekkr celekrk celekkr celekrk celerkk celerkk celrkek
celrkke celrekk celrekk celrkek celrkke ceklker ceklkre ceklekr ceklerk ceklrek ceklrke
cekkler cekklre cekkelr cekkerl cekkrel cekkrle cekeklr cekekrl cekelkr cekelrk cekerlk
cekerkl cekrkel cekrkle cekrekl cekrelk cekrlek cekrlke cekkler cekklre cekkelr cekkerl
cekkrel cekkrle ceklker ceklkre ceklekr ceklerk ceklrek ceklrke cekelkr cekelrk cekeklr
cekekrl cekerkl cekerlk cekrlek cekrlke cekrelk cekrekl cekrkel cekrkle ceekklr ceekkrl
ceeklkr ceeklrk ceekrlk ceekrkl ceekklr ceekkrl ceeklkr ceeklrk ceekrlk ceekrkl ceelkkr
ceelkrk ceelkkr ceelkrk ceelrkk ceelrkk ceerklk ceerkkl ceerlkk ceerlkk ceerklk ceerkkl
cerkkel cerkkle cerkekl cerkelk cerklek cerklke cerkkel cerkkle cerkekl cerkelk cerklek
cerklke cerekkl cereklk cerekkl cereklk cerelkk cerelkk cerlkek cerlkke cerlekk cerlekk
cerlkek cerlkke ckelker ckelkre ckelekr ckelerk ckelrek ckelrke ckekler ckeklre ckekelr
ckekerl ckekrel ckekrle ckeeklr ckeekrl ckeelkr ckeelrk ckeerlk ckeerkl ckerkel ckerkle
ckerekl ckerelk ckerlek ckerlke ckleker cklekre ckleekr ckleerk cklerek cklerke cklkeer
cklkere cklkeer cklkere cklkree cklkree ckleker cklekre ckleekr ckleerk cklerek cklerke
cklrkee cklrkee cklreke cklreek cklreek cklreke ckkleer ckklere ckkleer ckklere ckklree
ckklree ckkeler ckkelre ckkeelr ckkeerl ckkerel ckkerle ckkeelr ckkeerl ckkeler ckkelre
ckkerle ckkerel ckkreel ckkrele ckkreel ckkrele ckkrlee ckkrlee ckelker ckelkre ckelekr
ckelerk ckelrek ckelrke ckekler ckeklre ckekelr ckekerl ckekrel ckekrle ckeeklr ckeekrl
ckeelkr ckeelrk ckeerlk ckeerkl ckerkel ckerkle ckerekl ckerelk ckerlek ckerlke ckrlkee
ckrlkee ckrleke ckrleek ckrleek ckrleke ckrklee ckrklee ckrkele ckrkeel ckrkeel ckrkele
ckrekle ckrekel ckrelke ckrelek ckreelk ckreekl ckrekel ckrekle ckreekl ckreelk ckrelek
ckrelke ckekler ckeklre ckekelr ckekerl ckekrel ckekrle ckelker ckelkre ckelekr ckelerk
ckelrek ckelrke ckeelkr ckeelrk ckeeklr ckeekrl ckeerkl ckeerlk ckerlek ckerlke ckerelk
ckerekl ckerkel ckerkle ckkeler ckkelre ckkeelr ckkeerl ckkerel ckkerle ckkleer ckklere
ckkleer ckklere ckklree ckklree ckkeler ckkelre ckkeelr ckkeerl ckkerel ckkerle ckkrlee
ckkrlee ckkrele ckkreel ckkreel ckkrele cklkeer cklkere cklkeer cklkere cklkree cklkree
ckleker cklekre ckleekr ckleerk cklerek cklerke ckleekr ckleerk ckleker cklekre cklerke
cklerek cklreek cklreke cklreek cklreke cklrkee cklrkee ckekler ckeklre ckekelr ckekerl
ckekrel ckekrle ckelker ckelkre ckelekr ckelerk ckelrek ckelrke ckeelkr ckeelrk ckeeklr
ckeekrl ckeerkl ckeerlk ckerlek ckerlke ckerelk ckerekl ckerkel ckerkle ckrklee ckrklee
ckrkele ckrkeel ckrkeel ckrkele ckrlkee ckrlkee ckrleke ckrleek ckrleek ckrleke ckrelke
ckrelek ckrekle ckrekel ckreekl ckreelk ckrelek ckrelke ckreelk ckreekl ckrekel ckrekle
ceekklr ceekkrl ceeklkr ceeklrk ceekrlk ceekrkl ceekklr ceekkrl ceeklkr ceeklrk ceekrlk
ceekrkl ceelkkr ceelkrk ceelkkr ceelkrk ceelrkk ceelrkk ceerklk ceerkkl ceerlkk ceerlkk
ceerklk ceerkkl cekeklr cekekrl cekelkr cekelrk cekerlk cekerkl cekkelr cekkerl cekkler
cekklre cekkrle cekkrel ceklker ceklkre ceklekr ceklerk ceklrek ceklrke cekrkle cekrkel
cekrlke cekrlek cekrelk cekrekl cekkelr cekkerl cekkler cekklre cekkrle cekkrel cekeklr
cekekrl cekelkr cekelrk cekerlk cekerkl ceklekr ceklerk ceklker ceklkre ceklrke ceklrek
cekrelk cekrekl cekrlek cekrlke cekrkle cekrkel celkker celkkre celkekr celkerk celkrek
celkrke celkker celkkre celkekr celkerk celkrek celkrke celekkr celekrk celekkr celekrk
celerkk celerkk celrkek celrkke celrekk celrekk celrkek celrkke cerkkle cerkkel cerklke
cerklek cerkelk cerkekl cerkkle cerkkel cerklke cerklek cerkelk cerkekl cerlkke cerlkek
cerlkke cerlkek cerlekk cerlekk cereklk cerekkl cerelkk cerelkk cereklk cerekkl crekkel
crekkle crekekl crekelk creklek creklke crekkel crekkle crekekl crekelk creklek creklke
creekkl creeklk creekkl creeklk creelkk creelkk crelkek crelkke crelekk crelekk crelkek
crelkke crkekel crkekle crkeekl crkeelk crkelek crkelke crkkeel crkkele crkkeel crkkele
crkklee crkklee crkekel crkekle crkeekl crkeelk crkelek crkelke crklkee crklkee crkleke
crkleek crkleek crkleke crkkeel crkkele crkkeel crkkele crkklee crkklee crkekel crkekle
crkeekl crkeelk crkelek crkelke crkeekl crkeelk crkekel crkekle crkelke crkelek crkleek
crkleke crkleek crkleke crklkee crklkee crekkel crekkle crekekl crekelk creklek creklke
crekkel crekkle crekekl crekelk creklek creklke creekkl creeklk creekkl creeklk creelkk
creelkk crelkek crelkke crelekk crelekk crelkek crelkke crlkkee crlkkee crlkeke crlkeek
crlkeek crlkeke crlkkee crlkkee crlkeke crlkeek crlkeek crlkeke crlekke crlekek crlekke
crlekek crleekk crleekk crlekek crlekke crleekk crleekk crlekek crlekke klecker kleckre
klecekr klecerk klecrek klecrke klekcer klekcre klekecr klekerc klekrec klekrce kleekcr
kleekrc kleeckr kleecrk kleerck kleerkc klerkec klerkce klerekc klereck klercek klercke
klceker klcekre klceekr klceerk klcerek klcerke klckeer klckere klckeer klckere klckree
klckree klceker klcekre klceekr klceerk klcerek klcerke klcrkee klcrkee klcreke klcreek
klcreek klcreke klkceer klkcere klkceer klkcere klkcree klkcree klkecer klkecre klkeecr
klkeerc klkerec klkerce klkeecr klkeerc klkecer klkecre klkerce klkerec klkreec klkrece
klkreec klkrece klkrcee klkrcee klecker kleckre klecekr klecerk klecrek klecrke klekcer
klekcre klekecr klekerc klekrec klekrce kleekcr kleekrc kleeckr kleecrk kleerck kleerkc
klerkec klerkce klerekc klereck klercek klercke klrckee klrckee klrceke klrceek klrceek
klrceke klrkcee klrkcee klrkece klrkeec klrkeec klrkece klrekce klrekec klrecke klrecek
klreeck klreekc klrekec klrekce klreekc klreeck klrecek klrecke kelcker kelckre kelcekr
kelcerk kelcrek kelcrke kelkcer kelkcre kelkecr kelkerc kelkrec kelkrce kelekcr kelekrc
keleckr kelecrk kelerck kelerkc kelrkec kelrkce kelrekc kelreck kelrcek kelrcke keclker
keclkre keclekr keclerk keclrek keclrke keckler kecklre keckelr keckerl keckrel keckrle
keceklr kecekrl kecelkr kecelrk kecerlk kecerkl kecrkel kecrkle kecrekl kecrelk kecrlek
kecrlke kekcler kekclre kekcelr kekcerl kekcrel kekcrle keklcer keklcre keklecr keklerc
keklrec keklrce kekelcr kekelrc kekeclr kekecrl kekercl kekerlc kekrlec kekrlce kekrelc
kekrecl kekrcel kekrcle keecklr keeckrl keeclkr keeclrk keecrlk keecrkl keekclr keekcrl
keeklcr keeklrc keekrlc keekrcl keelkcr keelkrc keelckr keelcrk keelrck keelrkc keerklc
keerkcl keerlkc keerlck keerclk keerckl kerckel kerckle kercekl kercelk kerclek kerclke
kerkcel kerkcle kerkecl kerkelc kerklec kerklce kerekcl kereklc kereckl kereclk kerelck
kerelkc kerlkec kerlkce kerlekc kerleck kerlcek kerlcke kcelker kcelkre kcelekr kcelerk
kcelrek kcelrke kcekler kceklre kcekelr kcekerl kcekrel kcekrle kceeklr kceekrl kceelkr
kceelrk kceerlk kceerkl kcerkel kcerkle kcerekl kcerelk kcerlek kcerlke kcleker kclekre
kcleekr kcleerk kclerek kclerke kclkeer kclkere kclkeer kclkere kclkree kclkree kcleker
kclekre kcleekr kcleerk kclerek kclerke kclrkee kclrkee kclreke kclreek kclreek kclreke
kckleer kcklere kckleer kcklere kcklree kcklree kckeler kckelre kckeelr kckeerl kckerel
kckerle kckeelr kckeerl kckeler kckelre kckerle kckerel kckreel kckrele kckreel kckrele
kckrlee kckrlee kcelker kcelkre kcelekr kcelerk kcelrek kcelrke kcekler kceklre kcekelr
kcekerl kcekrel kcekrle kceeklr kceekrl kceelkr kceelrk kceerlk kceerkl kcerkel kcerkle
kcerekl kcerelk kcerlek kcerlke kcrlkee kcrlkee kcrleke kcrleek kcrleek kcrleke kcrklee
kcrklee kcrkele kcrkeel kcrkeel kcrkele kcrekle kcrekel kcrelke kcrelek kcreelk kcreekl
kcrekel kcrekle kcreekl kcreelk kcrelek kcrelke kkecler kkeclre kkecelr kkecerl kkecrel
kkecrle kkelcer kkelcre kkelecr kkelerc kkelrec kkelrce kkeelcr kkeelrc kkeeclr kkeecrl
kkeercl kkeerlc kkerlec kkerlce kkerelc kkerecl kkercel kkercle kkceler kkcelre kkceelr
kkceerl kkcerel kkcerle kkcleer kkclere kkcleer kkclere kkclree kkclree kkceler kkcelre
kkceelr kkceerl kkcerel kkcerle kkcrlee kkcrlee kkcrele kkcreel kkcreel kkcrele kklceer
kklcere kklceer kklcere kklcree kklcree kklecer kklecre kkleecr kkleerc kklerec kklerce
kkleecr kkleerc kklecer kklecre kklerce kklerec kklreec kklrece kklreec kklrece kklrcee
kklrcee kkecler kkeclre kkecelr kkecerl kkecrel kkecrle kkelcer kkelcre kkelecr kkelerc
kkelrec kkelrce kkeelcr kkeelrc kkeeclr kkeecrl kkeercl kkeerlc kkerlec kkerlce kkerelc
kkerecl kkercel kkercle kkrclee kkrclee kkrcele kkrceel kkrceel kkrcele kkrlcee kkrlcee
kkrlece kkrleec kkrleec kkrlece kkrelce kkrelec kkrecle kkrecel kkreecl kkreelc kkrelec
kkrelce kkreelc kkreecl kkrecel kkrecle keecklr keeckrl keeclkr keeclrk keecrlk keecrkl
keekclr keekcrl keeklcr keeklrc keekrlc keekrcl keelkcr keelkrc keelckr keelcrk keelrck
keelrkc keerklc keerkcl keerlkc keerlck keerclk keerckl keceklr kecekrl kecelkr kecelrk
kecerlk kecerkl keckelr keckerl keckler kecklre keckrle keckrel keclker keclkre keclekr
keclerk keclrek keclrke kecrkle kecrkel kecrlke kecrlek kecrelk kecrekl kekcelr kekcerl
kekcler kekclre kekcrle kekcrel kekeclr kekecrl kekelcr kekelrc kekerlc kekercl keklecr
keklerc keklcer keklcre keklrce keklrec kekrelc kekrecl kekrlec kekrlce kekrcle kekrcel
kelcker kelckre kelcekr kelcerk kelcrek kelcrke kelkcer kelkcre kelkecr kelkerc kelkrec
kelkrce kelekcr kelekrc keleckr kelecrk kelerck kelerkc kelrkec kelrkce kelrekc kelreck
kelrcek kelrcke kerckle kerckel kerclke kerclek kercelk kercekl kerkcle kerkcel kerklce
kerklec kerkelc kerkecl kerlkce kerlkec kerlcke kerlcek kerleck kerlekc kereklc kerekcl
kerelkc kerelck kereclk kereckl kreckel kreckle krecekl krecelk kreclek kreclke krekcel
krekcle krekecl krekelc kreklec kreklce kreekcl kreeklc kreeckl kreeclk kreelck kreelkc
krelkec krelkce krelekc kreleck krelcek krelcke krcekel krcekle krceekl krceelk krcelek
krcelke krckeel krckele krckeel krckele krcklee krcklee krcekel krcekle krceekl krceelk
krcelek krcelke krclkee krclkee krcleke krcleek krcleek krcleke krkceel krkcele krkceel
krkcele krkclee krkclee krkecel krkecle krkeecl krkeelc krkelec krkelce krkeecl krkeelc
krkecel krkecle krkelce krkelec krkleec krklece krkleec krklece krklcee krklcee kreckel
kreckle krecekl krecelk kreclek kreclke krekcel krekcle krekecl krekelc kreklec kreklce
kreekcl kreeklc kreeckl kreeclk kreelck kreelkc krelkec krelkce krelekc kreleck krelcek
krelcke krlckee krlckee krlceke krlceek krlceek krlceke krlkcee krlkcee krlkece krlkeec
krlkeec krlkece krlekce krlekec krlecke krlecek krleeck krleekc krlekec krlekce krleekc
krleeck krlecek krlecke eleckkr eleckrk eleckkr eleckrk elecrkk elecrkk elekckr elekcrk
elekkcr elekkrc elekrkc elekrck elekkcr elekkrc elekckr elekcrk elekrck elekrkc elerkkc
elerkck elerkkc elerkck elerckk elerckk elcekkr elcekrk elcekkr elcekrk elcerkk elcerkk
elckekr elckerk elckker elckkre elckrke elckrek elckker elckkre elckekr elckerk elckrek
elckrke elcrkke elcrkek elcrkke elcrkek elcrekk elcrekk elkcekr elkcerk elkcker elkckre
elkcrke elkcrek elkeckr elkecrk elkekcr elkekrc elkerkc elkerck elkkecr elkkerc elkkcer
elkkcre elkkrce elkkrec elkrekc elkreck elkrkec elkrkce elkrcke elkrcek elkcker elkckre
elkcekr elkcerk elkcrek elkcrke elkkcer elkkcre elkkecr elkkerc elkkrec elkkrce elkekcr
elkekrc elkeckr elkecrk elkerck elkerkc elkrkec elkrkce elkrekc elkreck elkrcek elkrcke
elrckke elrckek elrckke elrckek elrcekk elrcekk elrkcke elrkcek elrkkce elrkkec elrkekc
elrkeck elrkkce elrkkec elrkcke elrkcek elrkeck elrkekc elrekkc elrekck elrekkc elrekck
elreckk elreckk eelckkr eelckrk eelckkr eelckrk eelcrkk eelcrkk eelkckr eelkcrk eelkkcr
eelkkrc eelkrkc eelkrck eelkkcr eelkkrc eelkckr eelkcrk eelkrck eelkrkc eelrkkc eelrkck
eelrkkc eelrkck eelrckk eelrckk eeclkkr eeclkrk eeclkkr eeclkrk eeclrkk eeclrkk eecklkr
eecklrk eeckklr eeckkrl eeckrkl eeckrlk eeckklr eeckkrl eecklkr eecklrk eeckrlk eeckrkl
eecrkkl eecrklk eecrkkl eecrklk eecrlkk eecrlkk eekclkr eekclrk eekcklr eekckrl eekcrkl
eekcrlk eeklckr eeklcrk eeklkcr eeklkrc eeklrkc eeklrck eekklcr eekklrc eekkclr eekkcrl
eekkrcl eekkrlc eekrlkc eekrlck eekrklc eekrkcl eekrckl eekrclk eekcklr eekckrl eekclkr
eekclrk eekcrlk eekcrkl eekkclr eekkcrl eekklcr eekklrc eekkrlc eekkrcl eeklkcr eeklkrc
eeklckr eeklcrk eeklrck eeklrkc eekrklc eekrkcl eekrlkc eekrlck eekrclk eekrckl eerckkl
eercklk eerckkl eercklk eerclkk eerclkk eerkckl eerkclk eerkkcl eerkklc eerklkc eerklck
eerkkcl eerkklc eerkckl eerkclk eerklck eerklkc eerlkkc eerlkck eerlkkc eerlkck eerlckk
eerlckk ecelkkr ecelkrk ecelkkr ecelkrk ecelrkk ecelrkk eceklkr eceklrk ecekklr ecekkrl
ecekrkl ecekrlk ecekklr ecekkrl eceklkr eceklrk ecekrlk ecekrkl ecerkkl ecerklk ecerkkl
ecerklk ecerlkk ecerlkk eclekkr eclekrk eclekkr eclekrk eclerkk eclerkk eclkekr eclkerk
eclkker eclkkre eclkrke eclkrek eclkker eclkkre eclkekr eclkerk eclkrek eclkrke eclrkke
eclrkek eclrkke eclrkek eclrekk eclrekk ecklekr ecklerk ecklker ecklkre ecklrke ecklrek
eckelkr eckelrk eckeklr eckekrl eckerkl eckerlk eckkelr eckkerl eckkler eckklre eckkrle
eckkrel eckrekl eckrelk eckrkel eckrkle eckrlke eckrlek ecklker ecklkre ecklekr ecklerk
ecklrek ecklrke eckkler eckklre eckkelr eckkerl eckkrel eckkrle eckeklr eckekrl eckelkr
eckelrk eckerlk eckerkl eckrkel eckrkle eckrekl eckrelk eckrlek eckrlke ecrlkke ecrlkek
ecrlkke ecrlkek ecrlekk ecrlekk ecrklke ecrklek ecrkkle ecrkkel ecrkekl ecrkelk ecrkkle
ecrkkel ecrklke ecrklek ecrkelk ecrkekl ecrekkl ecreklk ecrekkl ecreklk ecrelkk ecrelkk
ekeclkr ekeclrk ekecklr ekeckrl ekecrkl ekecrlk ekelckr ekelcrk ekelkcr ekelkrc ekelrkc
ekelrck ekeklcr ekeklrc ekekclr ekekcrl ekekrcl ekekrlc ekerlkc ekerlck ekerklc ekerkcl
ekerckl ekerclk ekcelkr ekcelrk ekceklr ekcekrl ekcerkl ekcerlk ekclekr ekclerk ekclker
ekclkre ekclrke ekclrek ekckler ekcklre ekckelr ekckerl ekckrel ekckrle ekcrlke ekcrlek
ekcrkle ekcrkel ekcrekl ekcrelk eklcekr eklcerk eklcker eklckre eklcrke eklcrek ekleckr
eklecrk eklekcr eklekrc eklerkc eklerck eklkecr eklkerc eklkcer eklkcre eklkrce eklkrec
eklrekc eklreck eklrkec eklrkce eklrcke eklrcek ekkcler ekkclre ekkcelr ekkcerl ekkcrel
ekkcrle ekklcer ekklcre ekklecr ekklerc ekklrec ekklrce ekkelcr ekkelrc ekkeclr ekkecrl
ekkercl ekkerlc ekkrlec ekkrlce ekkrelc ekkrecl ekkrcel ekkrcle ekrclke ekrclek ekrckle
ekrckel ekrcekl ekrcelk ekrlcke ekrlcek ekrlkce ekrlkec ekrlekc ekrleck ekrklce ekrklec
ekrkcle ekrkcel ekrkecl ekrkelc ekrelkc ekrelck ekreklc ekrekcl ekreckl ekreclk ekecklr
ekeckrl ekeclkr ekeclrk ekecrlk ekecrkl ekekclr ekekcrl ekeklcr ekeklrc ekekrlc ekekrcl
ekelkcr ekelkrc ekelckr ekelcrk ekelrck ekelrkc ekerklc ekerkcl ekerlkc ekerlck ekerclk
ekerckl ekceklr ekcekrl ekcelkr ekcelrk ekcerlk ekcerkl ekckelr ekckerl ekckler ekcklre
ekckrle ekckrel ekclker ekclkre ekclekr ekclerk ekclrek ekclrke ekcrkle ekcrkel ekcrlke
ekcrlek ekcrelk ekcrekl ekkcelr ekkcerl ekkcler ekkclre ekkcrle ekkcrel ekkeclr ekkecrl
ekkelcr ekkelrc ekkerlc ekkercl ekklecr ekklerc ekklcer ekklcre ekklrce ekklrec ekkrelc
ekkrecl ekkrlec ekkrlce ekkrcle ekkrcel eklcker eklckre eklcekr eklcerk eklcrek eklcrke
eklkcer eklkcre eklkecr eklkerc eklkrec eklkrce eklekcr eklekrc ekleckr eklecrk eklerck
eklerkc eklrkec eklrkce eklrekc eklreck eklrcek eklrcke ekrckle ekrckel ekrclke ekrclek
ekrcelk ekrcekl ekrkcle ekrkcel ekrklce ekrklec ekrkelc ekrkecl ekrlkce ekrlkec ekrlcke
ekrlcek ekrleck ekrlekc ekreklc ekrekcl ekrelkc ekrelck ekreclk ekreckl ereckkl erecklk
ereckkl erecklk ereclkk ereclkk erekckl erekclk erekkcl erekklc ereklkc ereklck erekkcl
erekklc erekckl erekclk ereklck ereklkc erelkkc erelkck erelkkc erelkck erelckk erelckk
ercekkl erceklk ercekkl erceklk ercelkk ercelkk erckekl erckelk erckkel erckkle ercklke
ercklek erckkel erckkle erckekl erckelk ercklek ercklke erclkke erclkek erclkke erclkek
erclekk erclekk erkcekl erkcelk erkckel erkckle erkclke erkclek erkeckl erkeclk erkekcl
erkeklc erkelkc erkelck erkkecl erkkelc erkkcel erkkcle erkklce erkklec erklekc erkleck
erklkec erklkce erklcke erklcek erkckel erkckle erkcekl erkcelk erkclek erkclke erkkcel
erkkcle erkkecl erkkelc erkklec erkklce erkekcl erkeklc erkeckl erkeclk erkelck erkelkc
erklkec erklkce erklekc erkleck erklcek erklcke erlckke erlckek erlckke erlckek erlcekk
erlcekk erlkcke erlkcek erlkkce erlkkec erlkekc erlkeck erlkkce erlkkec erlkcke erlkcek
erlkeck erlkekc erlekkc erlekck erlekkc erlekck erleckk erleckk rleckek rleckke rlecekk
rlecekk rleckek rleckke rlekcek rlekcke rlekeck rlekekc rlekkec rlekkce rleekck rleekkc
rleeckk rleeckk rleekck rleekkc rlekkec rlekkce rlekekc rlekeck rlekcek rlekcke rlcekek
rlcekke rlceekk rlceekk rlcekek rlcekke rlckeek rlckeke rlckeek rlckeke rlckkee rlckkee
rlcekek rlcekke rlceekk rlceekk rlcekek rlcekke rlckkee rlckkee rlckeke rlckeek rlckeek
rlckeke rlkceek rlkceke rlkceek rlkceke rlkckee rlkckee rlkecek rlkecke rlkeeck rlkeekc
rlkekec rlkekce rlkeeck rlkeekc rlkecek rlkecke rlkekce rlkekec rlkkeec rlkkece rlkkeec
rlkkece rlkkcee rlkkcee rleckek rleckke rlecekk rlecekk rleckek rleckke rlekcek rlekcke
rlekeck rlekekc rlekkec rlekkce rleekck rleekkc rleeckk rleeckk rleekck rleekkc rlekkec
rlekkce rlekekc rlekeck rlekcek rlekcke rlkckee rlkckee rlkceke rlkceek rlkceek rlkceke
rlkkcee rlkkcee rlkkece rlkkeec rlkkeec rlkkece rlkekce rlkekec rlkecke rlkecek rlkeeck
rlkeekc rlkekec rlkekce rlkeekc rlkeeck rlkecek rlkecke relckek relckke relcekk relcekk
relckek relckke relkcek relkcke relkeck relkekc relkkec relkkce relekck relekkc releckk
releckk relekck relekkc relkkec relkkce relkekc relkeck relkcek relkcke reclkek reclkke
reclekk reclekk reclkek reclkke recklek recklke reckelk reckekl reckkel reckkle receklk
recekkl recelkk recelkk receklk recekkl reckkel reckkle reckekl reckelk recklek recklke
rekclek rekclke rekcelk rekcekl rekckel rekckle reklcek reklcke rekleck reklekc reklkec
reklkce rekelck rekelkc rekeclk rekeckl rekekcl rekeklc rekklec rekklce rekkelc rekkecl
rekkcel rekkcle reecklk reeckkl reeclkk reeclkk reecklk reeckkl reekclk reekckl reeklck
reeklkc reekklc reekkcl reelkck reelkkc reelckk reelckk reelkck reelkkc reekklc reekkcl
reeklkc reeklck reekclk reekckl rekckel rekckle rekcekl rekcelk rekclek rekclke rekkcel
rekkcle rekkecl rekkelc rekklec rekklce rekekcl rekeklc rekeckl rekeclk rekelck rekelkc
reklkec reklkce reklekc rekleck reklcek reklcke rcelkek rcelkke rcelekk rcelekk rcelkek
rcelkke rceklek rceklke rcekelk rcekekl rcekkel rcekkle rceeklk rceekkl rceelkk rceelkk
rceeklk rceekkl rcekkel rcekkle rcekekl rcekelk rceklek rceklke rclekek rclekke rcleekk
rcleekk rclekek rclekke rclkeek rclkeke rclkeek rclkeke rclkkee rclkkee rclekek rclekke
rcleekk rcleekk rclekek rclekke rclkkee rclkkee rclkeke rclkeek rclkeek rclkeke rckleek
rckleke rckleek rckleke rcklkee rcklkee rckelek rckelke rckeelk rckeekl rckekel rckekle
rckeelk rckeekl rckelek rckelke rckekle rckekel rckkeel rckkele rckkeel rckkele rckklee
rckklee rcelkek rcelkke rcelekk rcelekk rcelkek rcelkke rceklek rceklke rcekelk rcekekl
rcekkel rcekkle rceeklk rceekkl rceelkk rceelkk rceeklk rceekkl rcekkel rcekkle rcekekl
rcekelk rceklek rceklke rcklkee rcklkee rckleke rckleek rckleek rckleke rckklee rckklee
rckkele rckkeel rckkeel rckkele rckekle rckekel rckelke rckelek rckeelk rckeekl rckekel
rckekle rckeekl rckeelk rckelek rckelke rkeclek rkeclke rkecelk rkecekl rkeckel rkeckle
rkelcek rkelcke rkeleck rkelekc rkelkec rkelkce rkeelck rkeelkc rkeeclk rkeeckl rkeekcl
rkeeklc rkeklec rkeklce rkekelc rkekecl rkekcel rkekcle rkcelek rkcelke rkceelk rkceekl
rkcekel rkcekle rkcleek rkcleke rkcleek rkcleke rkclkee rkclkee rkcelek rkcelke rkceelk
rkceekl rkcekel rkcekle rkcklee rkcklee rkckele rkckeel rkckeel rkckele rklceek rklceke
rklceek rklceke rklckee rklckee rklecek rklecke rkleeck rkleekc rklekec rklekce rkleeck
rkleekc rklecek rklecke rklekce rklekec rklkeec rklkece rklkeec rklkece rklkcee rklkcee
rkeclek rkeclke rkecelk rkecekl rkeckel rkeckle rkelcek rkelcke rkeleck rkelekc rkelkec
rkelkce rkeelck rkeelkc rkeeclk rkeeckl rkeekcl rkeeklc rkeklec rkeklce rkekelc rkekecl
rkekcel rkekcle rkkclee rkkclee rkkcele rkkceel rkkceel rkkcele rkklcee rkklcee rkklece
rkkleec rkkleec rkklece rkkelce rkkelec rkkecle rkkecel rkkeecl rkkeelc rkkelec rkkelce
rkkeelc rkkeecl rkkecel rkkecle reecklk reeckkl reeclkk reeclkk reecklk reeckkl reekclk
reekckl reeklck reeklkc reekklc reekkcl reelkck reelkkc reelckk reelckk reelkck reelkkc
reekklc reekkcl reeklkc reeklck reekclk reekckl receklk recekkl recelkk recelkk receklk
recekkl reckelk reckekl recklek recklke reckkle reckkel reclkek reclkke reclekk reclekk
reclkek reclkke reckkle reckkel recklke recklek reckelk reckekl rekcelk rekcekl rekclek
rekclke rekckle rekckel rekeclk rekeckl rekelck rekelkc rekeklc rekekcl rekleck reklekc
reklcek reklcke reklkce reklkec rekkelc rekkecl rekklec rekklce rekkcle rekkcel relckek
relckke relcekk relcekk relckek relckke relkcek relkcke relkeck relkekc relkkec relkkce
relekck relekkc releckk releckk relekck relekkc relkkec relkkce relkekc relkeck relkcek
relkcke rekckle rekckel rekclke rekclek rekcelk rekcekl rekkcle rekkcel rekklce rekklec
rekkelc rekkecl reklkce reklkec reklcke reklcek rekleck reklekc rekeklc rekekcl rekelkc
rekelck rekeclk rekeckl rkeckel rkeckle rkecekl rkecelk rkeclek rkeclke rkekcel rkekcle
rkekecl rkekelc rkeklec rkeklce rkeekcl rkeeklc rkeeckl rkeeclk rkeelck rkeelkc rkelkec
rkelkce rkelekc rkeleck rkelcek rkelcke rkcekel rkcekle rkceekl rkceelk rkcelek rkcelke
rkckeel rkckele rkckeel rkckele rkcklee rkcklee rkcekel rkcekle rkceekl rkceelk rkcelek
rkcelke rkclkee rkclkee rkcleke rkcleek rkcleek rkcleke rkkceel rkkcele rkkceel rkkcele
rkkclee rkkclee rkkecel rkkecle rkkeecl rkkeelc rkkelec rkkelce rkkeecl rkkeelc rkkecel
rkkecle rkkelce rkkelec rkkleec rkklece rkkleec rkklece rkklcee rkklcee rkeckel rkeckle
rkecekl rkecelk rkeclek rkeclke rkekcel rkekcle rkekecl rkekelc rkeklec rkeklce rkeekcl
rkeeklc rkeeckl rkeeclk rkeelck rkeelkc rkelkec rkelkce rkelekc rkeleck rkelcek rkelcke
rklckee rklckee rklceke rklceek rklceek rklceke rklkcee rklkcee rklkece rklkeec rklkeec
rklkece rklekce rklekec rklecke rklecek rkleeck rkleekc rklekec rklekce rkleekc rkleeck
rklecek rklecke

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us