easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

caddish

petualang

unmedalled

obelising

floccillation

aspirations

glaucophanization

piscium

unschool

unnutritious

allanpc

whetting

irrevocably

ticketmonger

mumaw

unilluminating

vergences

gerald


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: kaynak
cipher variations:
lbzobl mcapcm ndbqdn oecreo pfdsfp
qgetgq rhfuhr sigvis tjhwjt ukixku
vljylv wmkzmw xnlanx yomboy zpncpz
aqodqa brperb csqfsc dtrgtd eushue
fvtivf gwujwg hxvkxh iywlyi jzxmzj

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: kaynak
Cipher: pzbmzp

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: kaynak
Cipher: ABAAB AAAAA BABBA ABBAA AAAAA ABAAB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: kaynak
cipher variations:
lbzoblfbvobfzbrobztbnobtnbjobnhbfobhvbxobvpbtobp
jbpobjdblobdxbhobxrbdobrmcapcmgcwpcgacspcaucopcu
ockpcoicgpciwcypcwqcupcqkcqpckecmpceycipcyscepcs
ndbqdnhdxqdhbdtqdbvdpqdvpdlqdpjdhqdjxdzqdxrdvqdr
ldrqdlfdnqdfzdjqdztdfqdtoecreoieyreiceurecweqrew
qemreqkeirekyeareysewresmesremgeoregaekreauegreu
pfdsfpjfzsfjdfvsfdxfrsfxrfnsfrlfjsflzfbsfztfxsft
nftsfnhfpsfhbflsfbvfhsfvqgetgqkgatgkegwtgeygstgy
sgotgsmgktgmagctgaugytguogutgoigqtgicgmtgcwgitgw
rhfuhrlhbuhlfhxuhfzhtuhzthpuhtnhluhnbhduhbvhzuhv
phvuhpjhruhjdhnuhdxhjuhxsigvismicvimgiyvigaiuvia
uiqviuoimviocievicwiaviwqiwviqkisvikeiovieyikviy
tjhwjtnjdwjnhjzwjhbjvwjbvjrwjvpjnwjpdjfwjdxjbwjx
rjxwjrljtwjlfjpwjfzjlwjzukixkuokexkoikaxkickwxkc
wksxkwqkoxkqekgxkeykcxkyskyxksmkuxkmgkqxkgakmxka
vljylvplfylpjlbyljdlxyldxltylxrlpylrflhylfzldylz
tlzyltnlvylnhlrylhblnylbwmkzmwqmgzmqkmczmkemyzme
ymuzmysmqzmsgmizmgamezmaumazmuomwzmoimszmicmozmc
xnlanxrnhanrlndanlfnzanfznvanztnranthnjanhbnfanb
vnbanvpnxanpjntanjdnpandyomboysoibosmoebomgoabog
aowboauosbouiokboicogbocwocbowqoyboqkoubokeoqboe
zpncpztpjcptnpfcpnhpbcphbpxcpbvptcpvjplcpjdphcpd
xpdcpxrpzcprlpvcplfprcpfaqodqauqkdquoqgdqoiqcdqi
cqydqcwqudqwkqmdqkeqidqeyqedqysqadqsmqwdqmgqsdqg
brperbvrlervprherpjrderjdrzerdxrverxlrnerlfrjerf
zrferztrbertnrxernhrterhcsqfscwsmfswqsifsqksefsk
esafseyswfsymsofsmgskfsgasgfsauscfsuosyfsoisufsi
dtrgtdxtngtxrtjgtrltfgtlftbgtfztxgtzntpgtnhtlgth
bthgtbvtdgtvptzgtpjtvgtjeushueyuohuysukhusmughum
guchugauyhuaouqhuoiumhuicuihucwuehuwquahuqkuwhuk
fvtivfzvpivztvlivtnvhivnhvdivhbvzivbpvrivpjvnivj
dvjivdxvfivxrvbivrlvxivlgwujwgawqjwauwmjwuowijwo
iwejwicwajwcqwsjwqkwojwkewkjweywgjwyswcjwsmwyjwm
hxvkxhbxrkxbvxnkxvpxjkxpjxfkxjdxbkxdrxtkxrlxpkxl
fxlkxfzxhkxztxdkxtnxzkxniywlyicyslycwyolywqyklyq
kyglykeyclyesyulysmyqlymgymlygayilyauyelyuoyalyo
jzxmzjdztmzdxzpmzxrzlmzrlzhmzlfzdmzftzvmztnzrmzn
hznmzhbzjmzbvzfmzvpzbmzpkaynakeaunaeyaqnaysamnas
mainamgaenaguawnauoasnaoiaonaicaknacwagnawqacnaq

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: kaynak
Cipher: xnlanx

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: kaynak
Cipher: 521145331152

Extended Methods:
Method #1

Plaintext: kaynak
method variations:
pfdsfpulixluzqocqzevthve

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
k a y n a k 
5 1 4 3 1 5 
2 1 5 3 1 2 
They are then read out in rows:
514315215312
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: kaynak
Cipher: eovbpf

Read more ...
Method #3

Plaintext: kaynak
method variations:
bqpcvw qpcvwb pcvwbq
cvwbqp vwbqpc wbqpcv

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: kaynak

all 720 cipher variations:
kaynak kaynka kayank kayakn kaykan kaykna kanyak kanyka kanayk kanaky kankay
kankya kaanyk kaanky kaaynk kaaykn kaakyn kaakny kaknay kaknya kakany kakayn
kakyan kakyna kyanak kyanka kyaank kyaakn kyakan kyakna kynaak kynaka kynaak
kynaka kynkaa kynkaa kyanak kyanka kyaank kyaakn kyakan kyakna kyknaa kyknaa
kykana kykaan kykaan kykana knyaak knyaka knyaak knyaka knykaa knykaa knayak
knayka knaayk knaaky knakay knakya knaayk knaaky knayak knayka knakya knakay
knkaay knkaya knkaay knkaya knkyaa knkyaa kaynak kaynka kayank kayakn kaykan
kaykna kanyak kanyka kanayk kanaky kankay kankya kaanyk kaanky kaaynk kaaykn
kaakyn kaakny kaknay kaknya kakany kakayn kakyan kakyna kkynaa kkynaa kkyana
kkyaan kkyaan kkyana kknyaa kknyaa kknaya kknaay kknaay kknaya kkanya kkanay
kkayna kkayan kkaayn kkaany kkanay kkanya kkaany kkaayn kkayan kkayna akynak
akynka akyank akyakn akykan akykna aknyak aknyka aknayk aknaky aknkay aknkya
akanyk akanky akaynk akaykn akakyn akakny akknay akknya akkany akkayn akkyan
akkyna ayknak ayknka aykank aykakn aykkan aykkna aynkak aynkka aynakk aynakk
aynkak aynkka ayankk ayankk ayaknk ayakkn ayakkn ayaknk ayknak ayknka aykank
aykakn aykkan aykkna anykak anykka anyakk anyakk anykak anykka ankyak ankyka
ankayk ankaky ankkay ankkya anakyk anakky anaykk anaykk anakyk anakky ankkay
ankkya ankaky ankayk ankyak ankyka aaynkk aaynkk aayknk aaykkn aaykkn aayknk
aanykk aanykk aankyk aankky aankky aankyk aaknyk aaknky aakynk aakykn aakkyn
aakkny aaknky aaknyk aakkny aakkyn aakykn aakynk akynak akynka akyank akyakn
akykan akykna aknyak aknyka aknayk aknaky aknkay aknkya akanyk akanky akaynk
akaykn akakyn akakny akknay akknya akkany akkayn akkyan akkyna yaknak yaknka
yakank yakakn yakkan yakkna yankak yankka yanakk yanakk yankak yankka yaankk
yaankk yaaknk yaakkn yaakkn yaaknk yaknak yaknka yakank yakakn yakkan yakkna
ykanak ykanka ykaank ykaakn ykakan ykakna yknaak yknaka yknaak yknaka yknkaa
yknkaa ykanak ykanka ykaank ykaakn ykakan ykakna ykknaa ykknaa ykkana ykkaan
ykkaan ykkana ynkaak ynkaka ynkaak ynkaka ynkkaa ynkkaa ynakak ynakka ynaakk
ynaakk ynakak ynakka ynaakk ynaakk ynakak ynakka ynakka ynakak ynkaak ynkaka
ynkaak ynkaka ynkkaa ynkkaa yaknak yaknka yakank yakakn yakkan yakkna yankak
yankka yanakk yanakk yankak yankka yaankk yaankk yaaknk yaakkn yaakkn yaaknk
yaknak yaknka yakank yakakn yakkan yakkna ykknaa ykknaa ykkana ykkaan ykkaan
ykkana yknkaa yknkaa yknaka yknaak yknaak yknaka ykanka ykanak ykakna ykakan
ykaakn ykaank ykanak ykanka ykaank ykaakn ykakan ykakna naykak naykka nayakk
nayakk naykak naykka nakyak nakyka nakayk nakaky nakkay nakkya naakyk naakky
naaykk naaykk naakyk naakky nakkay nakkya nakaky nakayk nakyak nakyka nyakak
nyakka nyaakk nyaakk nyakak nyakka nykaak nykaka nykaak nykaka nykkaa nykkaa
nyakak nyakka nyaakk nyaakk nyakak nyakka nykkaa nykkaa nykaka nykaak nykaak
nykaka nkyaak nkyaka nkyaak nkyaka nkykaa nkykaa nkayak nkayka nkaayk nkaaky
nkakay nkakya nkaayk nkaaky nkayak nkayka nkakya nkakay nkkaay nkkaya nkkaay
nkkaya nkkyaa nkkyaa naykak naykka nayakk nayakk naykak naykka nakyak nakyka
nakayk nakaky nakkay nakkya naakyk naakky naaykk naaykk naakyk naakky nakkay
nakkya nakaky nakayk nakyak nakyka nkykaa nkykaa nkyaka nkyaak nkyaak nkyaka
nkkyaa nkkyaa nkkaya nkkaay nkkaay nkkaya nkakya nkakay nkayka nkayak nkaayk
nkaaky nkakay nkakya nkaaky nkaayk nkayak nkayka aaynkk aaynkk aayknk aaykkn
aaykkn aayknk aanykk aanykk aankyk aankky aankky aankyk aaknyk aaknky aakynk
aakykn aakkyn aakkny aaknky aaknyk aakkny aakkyn aakykn aakynk ayankk ayankk
ayaknk ayakkn ayakkn ayaknk aynakk aynakk aynkak aynkka aynkka aynkak ayknak
ayknka aykank aykakn aykkan aykkna ayknka ayknak aykkna aykkan aykakn aykank
anyakk anyakk anykak anykka anykka anykak anaykk anaykk anakyk anakky anakky
anakyk ankayk ankaky ankyak ankyka ankkya ankkay ankaky ankayk ankkay ankkya
ankyka ankyak akynak akynka akyank akyakn akykan akykna aknyak aknyka aknayk
aknaky aknkay aknkya akanyk akanky akaynk akaykn akakyn akakny akknay akknya
akkany akkayn akkyan akkyna akynka akynak akykna akykan akyakn akyank aknyka
aknyak aknkya aknkay aknaky aknayk akknya akknay akkyna akkyan akkayn akkany
akanky akanyk akakny akakyn akaykn akaynk kaynak kaynka kayank kayakn kaykan
kaykna kanyak kanyka kanayk kanaky kankay kankya kaanyk kaanky kaaynk kaaykn
kaakyn kaakny kaknay kaknya kakany kakayn kakyan kakyna kyanak kyanka kyaank
kyaakn kyakan kyakna kynaak kynaka kynaak kynaka kynkaa kynkaa kyanak kyanka
kyaank kyaakn kyakan kyakna kyknaa kyknaa kykana kykaan kykaan kykana knyaak
knyaka knyaak knyaka knykaa knykaa knayak knayka knaayk knaaky knakay knakya
knaayk knaaky knayak knayka knakya knakay knkaay knkaya knkaay knkaya knkyaa
knkyaa kaynak kaynka kayank kayakn kaykan kaykna kanyak kanyka kanayk kanaky
kankay kankya kaanyk kaanky kaaynk kaaykn kaakyn kaakny kaknay kaknya kakany
kakayn kakyan kakyna kkynaa kkynaa kkyana kkyaan kkyaan kkyana kknyaa kknyaa
kknaya kknaay kknaay kknaya kkanya kkanay kkayna kkayan kkaayn kkaany kkanay
kkanya kkaany kkaayn kkayan kkayna

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us