easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

debussy

objectation

chemiotaxic

ludwiga

maravilla

dsunderland

outfeels

fissipeds

lobellated

spermaries

futhorc

glasswork

preliminarily

sovietizing

longcloth

uncalled

unsubordinate

subsidat


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: kassam
cipher variations:
lbttbn mcuuco ndvvdp oewweq pfxxfr
qgyygs rhzzht siaaiu tjbbjv ukcckw
vlddlx wmeemy xnffnz yoggoa zphhpb
aqiiqc brjjrd cskkse dtlltf eummug
fvnnvh gwoowi hxppxj iyqqyk jzrrzl

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: kassam
Cipher: pzhhzn

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: kassam
Cipher: ABAAB AAAAA BAAAB BAAAB AAAAA ABABB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: kassam
cipher variations:
lbttbnfbddblzbnnbjtbxxbhnbhhbfhbrrbdvbllbzpbvvbx
jbffbvdbppbtxbzzbrrbjjbpmcuucogceecmacoockucyyci
ociicgicsscewcmmcaqcwwcykcggcwecqqcuycaacssckkcq
ndvvdphdffdnbdppdlvdzzdjpdjjdhjdttdfxdnndbrdxxdz
ldhhdxfdrrdvzdbbdttdlldroewweqieggeoceqqemweaaek
qekkeikeuuegyeooecseyyeameiieygessewaecceuuemmes
pfxxfrjfhhfpdfrrfnxfbbflrfllfjlfvvfhzfppfdtfzzfb
nfjjfzhfttfxbfddfvvfnnftqgyygskgiigqegssgoygccgm
sgmmgkmgwwgiagqqgeugaagcogkkgaiguugycgeegwwgoogu
rhzzhtlhjjhrfhtthpzhddhnthnnhlnhxxhjbhrrhfvhbbhd
phllhbjhvvhzdhffhxxhpphvsiaaiumikkisgiuuiqaieeio
uiooimoiyyikcissigwiccieqimmickiwwiaeiggiyyiqqiw
tjbbjvnjlljthjvvjrbjffjpvjppjnpjzzjldjttjhxjddjf
rjnnjdljxxjbfjhhjzzjrrjxukcckwokmmkuikwwksckggkq
wkqqkoqkaakmekuukiykeekgskookemkyykcgkiikaakssky
vlddlxplnnlvjlxxltdlhhlrxlrrlprlbblnflvvljzlfflh
tlpplfnlzzldhljjlbblttlzwmeemyqmoomwkmyymuemiims
ymssmqsmccmogmwwmkamggmiumqqmgomaameimkkmccmuuma
xnffnzrnppnxlnzznvfnjjntznttnrtnddnphnxxnlbnhhnj
vnrrnhpnbbnfjnllnddnvvnbyoggoasoqqoymoaaowgokkou
aouuosuoeeoqioyyomcoiiokwossoiqoccogkommoeeowwoc
zphhpbtprrpznpbbpxhpllpvbpvvptvpffprjpzzpndpjjpl
xpttpjrpddphlpnnpffpxxpdaqiiqcuqssqaoqccqyiqmmqw
cqwwquwqggqskqaaqoeqkkqmyquuqksqeeqimqooqggqyyqe
brjjrdvrttrbprddrzjrnnrxdrxxrvxrhhrtlrbbrpfrllrn
zrvvrltrffrjnrpprhhrzzrfcskksewsuuscqseesaksoosy
esyyswysiisumsccsqgsmmsoaswwsmusggskosqqsiisaasg
dtlltfxtvvtdrtfftbltpptzftzztxztjjtvntddtrhtnntp
btxxtnvthhtlptrrtjjtbbtheummugyuwwuesuggucmuqqua
guaauyaukkuwoueeusiuoouqcuyyuowuiiumqussukkuccui
fvnnvhzvxxvftvhhvdnvrrvbhvbbvzbvllvxpvffvtjvppvr
dvzzvpxvjjvnrvttvllvddvjgwoowiawyywguwiiweowsswc
iwccwacwmmwyqwggwukwqqwsewaawqywkkwoswuuwmmweewk
hxppxjbxzzxhvxjjxfpxttxdjxddxbdxnnxzrxhhxvlxrrxt
fxbbxrzxllxptxvvxnnxffxliyqqykcyaayiwykkygqyuuye
kyeeyceyooyasyiiywmyssyugyccysaymmyquywwyooyggym
jzrrzldzbbzjxzllzhrzvvzflzffzdfzppzbtzjjzxnzttzv
hzddztbznnzrvzxxzppzhhznkassameaccakyammaisawwag
maggaegaqqacuakkayoauuawiaeeaucaooaswayyaqqaiiao

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: kassam
Cipher: xnffnz

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: kassam
Cipher: 521134341123

Extended Methods:
Method #1

Plaintext: kassam
method variations:
pfxxfrulcclwzqhhqbevnnvg

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
k a s s a m 
5 1 3 3 1 2 
2 1 4 4 1 3 
They are then read out in rows:
513312214413
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: kassam
Cipher: enfbtl

Read more ...
Method #3

Plaintext: kassam
method variations:
blodfx lodfxb odfxbl
dfxblo fxblod xblodf

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: kassam

all 720 cipher variations:
kassam kassma kasasm kasams kasmas kasmsa kassam kassma kasasm kasams kasmas
kasmsa kaassm kaasms kaassm kaasms kaamss kaamss kamsas kamssa kamass kamass
kamsas kamssa ksasam ksasma ksaasm ksaams ksamas ksamsa kssaam kssama kssaam
kssama kssmaa kssmaa ksasam ksasma ksaasm ksaams ksamas ksamsa ksmsaa ksmsaa
ksmasa ksmaas ksmaas ksmasa kssaam kssama kssaam kssama kssmaa kssmaa ksasam
ksasma ksaasm ksaams ksamas ksamsa ksaasm ksaams ksasam ksasma ksamsa ksamas
ksmaas ksmasa ksmaas ksmasa ksmsaa ksmsaa kassam kassma kasasm kasams kasmas
kasmsa kassam kassma kasasm kasams kasmas kasmsa kaassm kaasms kaassm kaasms
kaamss kaamss kamsas kamssa kamass kamass kamsas kamssa kmssaa kmssaa kmsasa
kmsaas kmsaas kmsasa kmssaa kmssaa kmsasa kmsaas kmsaas kmsasa kmassa kmasas
kmassa kmasas kmaass kmaass kmasas kmassa kmaass kmaass kmasas kmassa akssam
akssma aksasm aksams aksmas aksmsa akssam akssma aksasm aksams aksmas aksmsa
akassm akasms akassm akasms akamss akamss akmsas akmssa akmass akmass akmsas
akmssa asksam asksma askasm askams askmas askmsa asskam asskma assakm assamk
assmak assmka asaskm asasmk asaksm asakms asamks asamsk asmsak asmska asmask
asmaks asmkas asmksa asskam asskma assakm assamk assmak assmka asksam asksma
askasm askams askmas askmsa asaksm asakms asaskm asasmk asamsk asamks asmkas
asmksa asmaks asmask asmsak asmska aasskm aassmk aasksm aaskms aasmks aasmsk
aasskm aassmk aasksm aaskms aasmks aasmsk aakssm aaksms aakssm aaksms aakmss
aakmss aamsks aamssk aamkss aamkss aamsks aamssk amssak amsska amsask amsaks
amskas amsksa amssak amsska amsask amsaks amskas amsksa amassk amasks amassk
amasks amakss amakss amksas amkssa amkass amkass amksas amkssa saksam saksma
sakasm sakams sakmas sakmsa saskam saskma sasakm sasamk sasmak sasmka saaskm
saasmk saaksm saakms saamks saamsk samsak samska samask samaks samkas samksa
skasam skasma skaasm skaams skamas skamsa sksaam sksama sksaam sksama sksmaa
sksmaa skasam skasma skaasm skaams skamas skamsa skmsaa skmsaa skmasa skmaas
skmaas skmasa sskaam sskama sskaam sskama sskmaa sskmaa ssakam ssakma ssaakm
ssaamk ssamak ssamka ssaakm ssaamk ssakam ssakma ssamka ssamak ssmaak ssmaka
ssmaak ssmaka ssmkaa ssmkaa saksam saksma sakasm sakams sakmas sakmsa saskam
saskma sasakm sasamk sasmak sasmka saaskm saasmk saaksm saakms saamks saamsk
samsak samska samask samaks samkas samksa smksaa smksaa smkasa smkaas smkaas
smkasa smskaa smskaa smsaka smsaak smsaak smsaka smaska smasak smaksa smakas
smaaks smaask smasak smaska smaask smaaks smakas smaksa saskam saskma sasakm
sasamk sasmak sasmka saksam saksma sakasm sakams sakmas sakmsa saaksm saakms
saaskm saasmk saamsk saamks samkas samksa samaks samask samsak samska ssakam
ssakma ssaakm ssaamk ssamak ssamka sskaam sskama sskaam sskama sskmaa sskmaa
ssakam ssakma ssaakm ssaamk ssamak ssamka ssmkaa ssmkaa ssmaka ssmaak ssmaak
ssmaka sksaam sksama sksaam sksama sksmaa sksmaa skasam skasma skaasm skaams
skamas skamsa skaasm skaams skasam skasma skamsa skamas skmaas skmasa skmaas
skmasa skmsaa skmsaa saskam saskma sasakm sasamk sasmak sasmka saksam saksma
sakasm sakams sakmas sakmsa saaksm saakms saaskm saasmk saamsk saamks samkas
samksa samaks samask samsak samska smskaa smskaa smsaka smsaak smsaak smsaka
smksaa smksaa smkasa smkaas smkaas smkasa smaksa smakas smaska smasak smaask
smaaks smakas smaksa smaaks smaask smasak smaska aasskm aassmk aasksm aaskms
aasmks aasmsk aasskm aassmk aasksm aaskms aasmks aasmsk aakssm aaksms aakssm
aaksms aakmss aakmss aamsks aamssk aamkss aamkss aamsks aamssk asaskm asasmk
asaksm asakms asamks asamsk assakm assamk asskam asskma assmka assmak asksam
asksma askasm askams askmas askmsa asmska asmsak asmksa asmkas asmaks asmask
assakm assamk asskam asskma assmka assmak asaskm asasmk asaksm asakms asamks
asamsk askasm askams asksam asksma askmsa askmas asmaks asmask asmkas asmksa
asmska asmsak akssam akssma aksasm aksams aksmas aksmsa akssam akssma aksasm
aksams aksmas aksmsa akassm akasms akassm akasms akamss akamss akmsas akmssa
akmass akmass akmsas akmssa amsska amssak amsksa amskas amsaks amsask amsska
amssak amsksa amskas amsaks amsask amkssa amksas amkssa amksas amkass amkass
amasks amassk amakss amakss amasks amassk massak masska masask masaks maskas
masksa massak masska masask masaks maskas masksa maassk maasks maassk maasks
maakss maakss maksas makssa makass makass maksas makssa msasak msaska msaask
msaaks msakas msaksa mssaak mssaka mssaak mssaka msskaa msskaa msasak msaska
msaask msaaks msakas msaksa msksaa msksaa mskasa mskaas mskaas mskasa mssaak
mssaka mssaak mssaka msskaa msskaa msasak msaska msaask msaaks msakas msaksa
msaask msaaks msasak msaska msaksa msakas mskaas mskasa mskaas mskasa msksaa
msksaa massak masska masask masaks maskas masksa massak masska masask masaks
maskas masksa maassk maasks maassk maasks maakss maakss maksas makssa makass
makass maksas makssa mkssaa mkssaa mksasa mksaas mksaas mksasa mkssaa mkssaa
mksasa mksaas mksaas mksasa mkassa mkasas mkassa mkasas mkaass mkaass mkasas
mkassa mkaass mkaass mkasas mkassa

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us