easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

miranturque

gherkin

genetay

lifeway

bourgeoisie

dosdemo

hustings

unattestedness

odelsting

infeoffing

subtartarean

ancones

lulli

colling

ambiebatis

juntura

alviso

siskind


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: jnanas
cipher variations:
kobobt lpcpcu mqdqdv nrerew osfsfx
ptgtgy quhuhz rvivia swjwjb txkxkc
uylyld vzmzme wananf xbobog ycpcph
zdqdqi aererj bfsfsk cgtgtl dhuhum
eivivn fjwjwo gkxkxp hlylyq imzmzr

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: jnanas
Cipher: qmzmzh

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: jnanas
Cipher: BBBAA ABBAA AAAAA ABBAA AAAAA BAAAB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: jnanas
cipher variations:
kobobtcobobduobobnmobobxeobobhwobobrgoboblyobobv
qobobfiobobpaobobzsobobjlpcpcudpcpcevpcpconpcpcy
fpcpcixpcpcshpcpcmzpcpcwrpcpcgjpcpcqbpcpcatpcpck
mqdqdveqdqdfwqdqdpoqdqdzgqdqdjyqdqdtiqdqdnaqdqdx
sqdqdhkqdqdrcqdqdbuqdqdlnrerewfreregxrereqprerea
hrerekzrereujrereobrereytrereilreresdrerecvrerem
osfsfxgsfsfhysfsfrqsfsfbisfsflasfsfvksfsfpcsfsfz
usfsfjmsfsftesfsfdwsfsfnptgtgyhtgtgiztgtgsrtgtgc
jtgtgmbtgtgwltgtgqdtgtgavtgtgkntgtguftgtgextgtgo
quhuhziuhuhjauhuhtsuhuhdkuhuhncuhuhxmuhuhreuhuhb
wuhuhlouhuhvguhuhfyuhuhprviviajvivikbviviutvivie
lviviodviviynvivisfvivicxvivimpviviwhvivigzviviq
swjwjbkwjwjlcwjwjvuwjwjfmwjwjpewjwjzowjwjtgwjwjd
ywjwjnqwjwjxiwjwjhawjwjrtxkxkclxkxkmdxkxkwvxkxkg
nxkxkqfxkxkapxkxkuhxkxkezxkxkorxkxkyjxkxkibxkxks
uylyldmylylneylylxwylylhoylylrgylylbqylylviylylf
aylylpsylylzkylyljcylyltvzmzmenzmzmofzmzmyxzmzmi
pzmzmshzmzmcrzmzmwjzmzmgbzmzmqtzmzmalzmzmkdzmzmu
wananfoananpgananzyananjqanantianandsananxkananh
cananruananbmananleananvxbobogpboboqhboboazbobok
rboboujboboetboboylboboidbobosvbobocnbobomfbobow
ycpcphqcpcpricpcpbacpcplscpcpvkcpcpfucpcpzmcpcpj
ecpcptwcpcpdocpcpngcpcpxzdqdqirdqdqsjdqdqcbdqdqm
tdqdqwldqdqgvdqdqandqdqkfdqdquxdqdqepdqdqohdqdqy
aererjserertkererdcerernuererxmererhwererboererl
gerervyererfqererpiererzbfsfsktfsfsulfsfsedfsfso
vfsfsynfsfsixfsfscpfsfsmhfsfswzfsfsgrfsfsqjfsfsa
cgtgtlugtgtvmgtgtfegtgtpwgtgtzogtgtjygtgtdqgtgtn
igtgtxagtgthsgtgtrkgtgtbdhuhumvhuhuwnhuhugfhuhuq
xhuhuaphuhukzhuhuerhuhuojhuhuybhuhuithuhuslhuhuc
eivivnwivivxoivivhgivivryivivbqivivlaivivfsivivp
kivivzcivivjuivivtmivivdfjwjwoxjwjwypjwjwihjwjws
zjwjwcrjwjwmbjwjwgtjwjwqljwjwadjwjwkvjwjwunjwjwe
gkxkxpykxkxzqkxkxjikxkxtakxkxdskxkxnckxkxhukxkxr
mkxkxbekxkxlwkxkxvokxkxfhlylyqzlylyarlylykjlylyu
blylyetlylyodlylyivlylysnlylycflylymxlylywplylyg
imzmzramzmzbsmzmzlkmzmzvcmzmzfumzmzpemzmzjwmzmzt
omzmzdgmzmznymzmzxqmzmzhjnanasbnanactnanamlnanaw
dnanagvnanaqfnanakxnanaupnanaehnanaoznanayrnanai

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: jnanas
Cipher: wananf

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: jnanas
Cipher: 423311331134

Extended Methods:
Method #1

Plaintext: jnanas
method variations:
osfsfxtxlxlcycqcqhdhvhvn

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
j n a n a s 
4 3 1 3 1 3 
2 3 1 3 1 4 
They are then read out in rows:
431313231314
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: jnanas
Cipher: ollmlq

Read more ...
Method #3

Plaintext: jnanas
method variations:
mclclt clcltm lcltmc
cltmcl ltmclc tmclcl

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: jnanas

all 720 cipher variations:
jnanas jnansa jnaans jnaasn jnasan jnasna jnnaas jnnasa jnnaas jnnasa jnnsaa
jnnsaa jnanas jnansa jnaans jnaasn jnasan jnasna jnsnaa jnsnaa jnsana jnsaan
jnsaan jnsana jannas jannsa janans janasn jansan jansna jannas jannsa janans
janasn jansan jansna jaanns jaansn jaanns jaansn jaasnn jaasnn jasnan jasnna
jasann jasann jasnan jasnna jnanas jnansa jnaans jnaasn jnasan jnasna jnnaas
jnnasa jnnaas jnnasa jnnsaa jnnsaa jnanas jnansa jnaans jnaasn jnasan jnasna
jnsnaa jnsnaa jnsana jnsaan jnsaan jnsana jaanns jaansn jaanns jaansn jaasnn
jaasnn janans janasn jannas jannsa jansna jansan jannas jannsa janans janasn
jansan jansna jasnna jasnan jasnna jasnan jasann jasann jsanan jsanna jsaann
jsaann jsanan jsanna jsnaan jsnana jsnaan jsnana jsnnaa jsnnaa jsanan jsanna
jsaann jsaann jsanan jsanna jsnnaa jsnnaa jsnana jsnaan jsnaan jsnana njanas
njansa njaans njaasn njasan njasna njnaas njnasa njnaas njnasa njnsaa njnsaa
njanas njansa njaans njaasn njasan njasna njsnaa njsnaa njsana njsaan njsaan
njsana najnas najnsa najans najasn najsan najsna nanjas nanjsa nanajs nanasj
nansaj nansja naanjs naansj naajns naajsn naasjn naasnj nasnaj nasnja nasanj
nasajn nasjan nasjna nnajas nnajsa nnaajs nnaasj nnasaj nnasja nnjaas nnjasa
nnjaas nnjasa nnjsaa nnjsaa nnajas nnajsa nnaajs nnaasj nnasaj nnasja nnsjaa
nnsjaa nnsaja nnsaaj nnsaaj nnsaja naanjs naansj naajns naajsn naasjn naasnj
nanajs nanasj nanjas nanjsa nansja nansaj najnas najnsa najans najasn najsan
najsna nasnja nasnaj nasjna nasjan nasajn nasanj nsanaj nsanja nsaanj nsaajn
nsajan nsajna nsnaaj nsnaja nsnaaj nsnaja nsnjaa nsnjaa nsanaj nsanja nsaanj
nsaajn nsajan nsajna nsjnaa nsjnaa nsjana nsjaan nsjaan nsjana anjnas anjnsa
anjans anjasn anjsan anjsna annjas annjsa annajs annasj annsaj annsja ananjs
anansj anajns anajsn anasjn anasnj ansnaj ansnja ansanj ansajn ansjan ansjna
ajnnas ajnnsa ajnans ajnasn ajnsan ajnsna ajnnas ajnnsa ajnans ajnasn ajnsan
ajnsna ajanns ajansn ajanns ajansn ajasnn ajasnn ajsnan ajsnna ajsann ajsann
ajsnan ajsnna anjnas anjnsa anjans anjasn anjsan anjsna annjas annjsa annajs
annasj annsaj annsja ananjs anansj anajns anajsn anasjn anasnj ansnaj ansnja
ansanj ansajn ansjan ansjna aajnns aajnsn aajnns aajnsn aajsnn aajsnn aanjns
aanjsn aannjs aannsj aansnj aansjn aannjs aannsj aanjns aanjsn aansjn aansnj
aasnnj aasnjn aasnnj aasnjn aasjnn aasjnn asjnan asjnna asjann asjann asjnan
asjnna asnjan asnjna asnajn asnanj asnnaj asnnja asanjn asannj asajnn asajnn
asanjn asannj asnnaj asnnja asnanj asnajn asnjan asnjna nnajas nnajsa nnaajs
nnaasj nnasaj nnasja nnjaas nnjasa nnjaas nnjasa nnjsaa nnjsaa nnajas nnajsa
nnaajs nnaasj nnasaj nnasja nnsjaa nnsjaa nnsaja nnsaaj nnsaaj nnsaja nanjas
nanjsa nanajs nanasj nansaj nansja najnas najnsa najans najasn najsan najsna
naajns naajsn naanjs naansj naasnj naasjn nasjan nasjna nasajn nasanj nasnaj
nasnja njanas njansa njaans njaasn njasan njasna njnaas njnasa njnaas njnasa
njnsaa njnsaa njanas njansa njaans njaasn njasan njasna njsnaa njsnaa njsana
njsaan njsaan njsana naajns naajsn naanjs naansj naasnj naasjn najans najasn
najnas najnsa najsna najsan nanjas nanjsa nanajs nanasj nansaj nansja nasjna
nasjan nasnja nasnaj nasanj nasajn nsajan nsajna nsaajn nsaanj nsanaj nsanja
nsjaan nsjana nsjaan nsjana nsjnaa nsjnaa nsajan nsajna nsaajn nsaanj nsanaj
nsanja nsnjaa nsnjaa nsnaja nsnaaj nsnaaj nsnaja ananjs anansj anajns anajsn
anasjn anasnj annajs annasj annjas annjsa annsja annsaj anjnas anjnsa anjans
anjasn anjsan anjsna ansnja ansnaj ansjna ansjan ansajn ansanj aannjs aannsj
aanjns aanjsn aansjn aansnj aannjs aannsj aanjns aanjsn aansjn aansnj aajnns
aajnsn aajnns aajnsn aajsnn aajsnn aasnjn aasnnj aasjnn aasjnn aasnjn aasnnj
ananjs anansj anajns anajsn anasjn anasnj annajs annasj annjas annjsa annsja
annsaj anjnas anjnsa anjans anjasn anjsan anjsna ansnja ansnaj ansjna ansjan
ansajn ansanj ajanns ajansn ajanns ajansn ajasnn ajasnn ajnans ajnasn ajnnas
ajnnsa ajnsna ajnsan ajnnas ajnnsa ajnans ajnasn ajnsan ajnsna ajsnna ajsnan
ajsnna ajsnan ajsann ajsann asanjn asannj asajnn asajnn asanjn asannj asnajn
asnanj asnjan asnjna asnnja asnnaj asjnan asjnna asjann asjann asjnan asjnna
asnnja asnnaj asnjna asnjan asnajn asnanj snanaj snanja snaanj snaajn snajan
snajna snnaaj snnaja snnaaj snnaja snnjaa snnjaa snanaj snanja snaanj snaajn
snajan snajna snjnaa snjnaa snjana snjaan snjaan snjana sannaj sannja sananj
sanajn sanjan sanjna sannaj sannja sananj sanajn sanjan sanjna saannj saanjn
saannj saanjn saajnn saajnn sajnan sajnna sajann sajann sajnan sajnna snanaj
snanja snaanj snaajn snajan snajna snnaaj snnaja snnaaj snnaja snnjaa snnjaa
snanaj snanja snaanj snaajn snajan snajna snjnaa snjnaa snjana snjaan snjaan
snjana saannj saanjn saannj saanjn saajnn saajnn sananj sanajn sannaj sannja
sanjna sanjan sannaj sannja sananj sanajn sanjan sanjna sajnna sajnan sajnna
sajnan sajann sajann sjanan sjanna sjaann sjaann sjanan sjanna sjnaan sjnana
sjnaan sjnana sjnnaa sjnnaa sjanan sjanna sjaann sjaann sjanan sjanna sjnnaa
sjnnaa sjnana sjnaan sjnaan sjnana

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us