easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

obligatus

nonconsent

braly

vraspir

diuturnitateque

lenehan

undullness

touraine

gimballed

zaborowski

transivitque

pgmac

metopomancy

rejuvenates

somethings

hollender

headroom

celsamque


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: irrisory
cipher variations:
jssjtpsz kttkuqta luulvrub mvvmwsvc nwwnxtwd
oxxoyuxe pyypzvyf qzzqawzg raarbxah sbbscybi
tcctdzcj uddueadk veevfbel wffwgcfm xggxhdgn
yhhyieho ziizjfip ajjakgjq bkkblhkr cllcmils
dmmdnjmt enneoknu foofplov gppgqmpw hqqhrnqx

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: irrisory
Cipher: riirhlib

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: irrisory
Cipher: ABAAA BAAAA BAAAA ABAAA BAAAB ABBAB BAAAA BABBA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: irrisory
cipher variations:
jssjtpszzaazdravpiipntirfqqfxvqnvyyvhxyjlgglrzgfrwwrldwxheehvfet
xmmxfhmpnuunpjuldccdzlchtkktjnkdkttkuqtaabbaesbwqjjqoujsgrrgywro
wzzwiyzkmhhmsahgsxxsmexyiffiwgfuynnyginqovvoqkvmeddeamdiullukole
luulvrubbccbftcxrkkrpvkthsshzxspxaaxjzalniintbihtyytnfyzjggjxhgv
zoozhjorpwwprlwnfeefbnejvmmvlpmfmvvmwsvccddcgudysllsqwluittiaytq
ybbykabmojjoucjiuzzuogzakhhkyihwappaikpsqxxqsmxogffgcofkwnnwmqng
nwwnxtwddeedhveztmmtrxmvjuujbzurzcczlbcnpkkpvdkjvaavphabliilzjix
bqqbjlqtryyrtnyphgghdpglxooxnrohoxxoyuxeeffeiwfaunnusynwkvvkcavs
addamcdoqllqwelkwbbwqibcmjjmakjycrrckmruszzsuozqihhieqhmyppyospi
pyypzvyffggfjxgbvoovtzoxlwwldbwtbeebndeprmmrxfmlxccxrjcdnkknblkz
dssdlnsvtaatvparjiijfrinzqqzptqjqzzqawzgghhgkyhcwppwuapymxxmecxu
cffcoefqsnnsygnmyddyskdeollocmlaettemotwubbuwqbskjjkgsjoarraqurk
raarbxahhiihlzidxqqxvbqznyynfdyvdggdpfgrtootzhonzeeztlefpmmpdnmb
fuufnpuxvccvxrctlkklhtkpbssbrvslsbbscybiijjimajeyrrywcraozzogezw
ehheqghsuppuaipoaffaumfgqnnqeoncgvvgoqvywddwysdumllmiulqcttcswtm
tcctdzcjjkkjnbkfzsszxdsbpaaphfaxfiifrhitvqqvbjqpbggbvnghroorfpod
hwwhprwzxeexztevnmmnjvmrduudtxunuddueadkkllkoclgattayetcqbbqigby
gjjgsijuwrrwckrqchhcwohisppsgqpeixxiqsxayffyaufwonnokwnsevveuyvo
veevfbellmmlpdmhbuubzfudrccrjhczhkkhtjkvxssxdlsrdiidxpijtqqthrqf
jyyjrtybzggzbvgxpooplxotfwwfvzwpwffwgcfmmnnmqenicvvcagvesddskida
illiuklwyttyemtsejjeyqjkurruisrgkzzksuzcahhacwhyqppqmypugxxgwaxq
xggxhdgnnoonrfojdwwdbhwfteetljebjmmjvlmxzuuzfnutfkkfzrklvssvjtsh
laaltvadbiibdxizrqqrnzqvhyyhxbyryhhyiehoopposgpkexxecixguffumkfc
knnkwmnyavvagovugllgaslmwttwkutimbbmuwbecjjceyjasrrsoarwizziyczs
ziizjfippqqpthqlfyyfdjyhvggvnlgdloolxnozbwwbhpwvhmmhbtmnxuuxlvuj
nccnvxcfdkkdfzkbtsstpbsxjaajzdatajjakgjqqrrquirmgzzgekziwhhwomhe
mppmyopacxxciqxwinnicunoyvvymwvkoddowydgellegalcuttuqctykbbkaebu
bkkblhkrrssrvjsnhaahflajxiixpnifnqqnzpqbdyydjryxjoojdvopzwwznxwl
peepxzehfmmfhbmdvuuvrduzlcclbfcvcllcmilssttswktoibbigmbkyjjyqojg
orroaqrcezzekszykppkewpqaxxaoyxmqffqyafignngicnewvvwsevamddmcgdw
dmmdnjmttuutxlupjccjhnclzkkzrpkhpsspbrsdfaafltazlqqlfxqrbyybpzyn
rggrzbgjhoohjdofxwwxtfwbneendhexenneoknuuvvuymvqkddkiodmallasqli
qttqcstegbbgmubamrrmgyrsczzcqazoshhsachkippikepgyxxyugxcoffoeify
foofplovvwwvznwrleeljpenbmmbtrmjruurdtufhcchnvcbnssnhzstdaadrbap
tiitbdiljqqjlfqhzyyzvhydpggpfjgzgppgqmpwwxxwaoxsmffmkqfocnncusnk
svvseuvgiddiowdcottoiatuebbescbqujjucejmkrrkmgriazzawizeqhhqgkha
hqqhrnqxxyyxbpytnggnlrgpdoodvtoltwwtfvwhjeejpxedpuupjbuvfccftdcr
vkkvdfknlsslnhsjbaabxjafriirhlibirrisoryyzzycqzuohhomshqeppewupm
uxxugwxikffkqyfeqvvqkcvwgddguedswllweglomttmoitkcbbcykbgsjjsimjc

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: irrisory
Cipher: veevfbel

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: irrisory
Cipher: 4224244234432445

Extended Methods:
Method #1

Plaintext: irrisory
method variations:
owwoxtwdtbbtcybiyggyhdgodmmdnimt

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
i r r i s o r y 
4 2 2 4 3 4 2 4 
2 4 4 2 4 3 4 5 
They are then read out in rows:
4224342424424345
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: irrisory
Cipher: irsrrioy

Read more ...
Method #3

Plaintext: irrisory
method variations:
gitmthtu itmthtug tmthtugi
mthtugit thtugitm htugitmt
tugitmth ugitmtht

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: irrisory

first 5040 cipher variations(40320 total)
irrisory irrisoyr irrisroy irrisryo irrisyro irrisyor irriosry irriosyr irriorsy irriorys irrioyrs
irrioysr irrirosy irriroys irrirsoy irrirsyo irriryso irriryos irriyors irriyosr irriyros irriyrso
irriysro irriysor irrsiory irrsioyr irrsiroy irrsiryo irrsiyro irrsiyor irrsoiry irrsoiyr irrsoriy
irrsoryi irrsoyri irrsoyir irrsroiy irrsroyi irrsrioy irrsriyo irrsryio irrsryoi irrsyori irrsyoir
irrsyroi irrsyrio irrsyiro irrsyior irrosiry irrosiyr irrosriy irrosryi irrosyri irrosyir irroisry
irroisyr irroirsy irroirys irroiyrs irroiysr irrorisy irroriys irrorsiy irrorsyi irrorysi irroryis
irroyirs irroyisr irroyris irroyrsi irroysri irroysir irrrsoiy irrrsoyi irrrsioy irrrsiyo irrrsyio
irrrsyoi irrrosiy irrrosyi irrroisy irrroiys irrroyis irrroysi irrriosy irrrioys irrrisoy irrrisyo
irrriyso irrriyos irrryois irrryosi irrryios irrryiso irrrysio irrrysoi irrysori irrysoir irrysroi
irrysrio irrysiro irrysior irryosri irryosir irryorsi irryoris irryoirs irryoisr irryrosi irryrois
irryrsoi irryrsio irryriso irryrios irryiors irryiosr irryiros irryirso irryisro irryisor irirsory
irirsoyr irirsroy irirsryo irirsyro irirsyor irirosry irirosyr irirorsy irirorys iriroyrs iriroysr
irirrosy irirroys irirrsoy irirrsyo irirryso irirryos iriryors iriryosr iriryros iriryrso irirysro
irirysor irisrory irisroyr irisrroy irisrryo irisryro irisryor irisorry irisoryr irisorry irisoryr
irisoyrr irisoyrr irisrory irisroyr irisrroy irisrryo irisryro irisryor irisyorr irisyorr irisyror
irisyrro irisyrro irisyror iriosrry iriosryr iriosrry iriosryr iriosyrr iriosyrr iriorsry iriorsyr
iriorrsy iriorrys irioryrs iriorysr iriorrsy iriorrys iriorsry iriorsyr iriorysr irioryrs irioyrrs
irioyrsr irioyrrs irioyrsr irioysrr irioysrr irirsory irirsoyr irirsroy irirsryo irirsyro irirsyor
irirosry irirosyr irirorsy irirorys iriroyrs iriroysr irirrosy irirroys irirrsoy irirrsyo irirryso
irirryos iriryors iriryosr iriryros iriryrso irirysro irirysor iriysorr iriysorr iriysror iriysrro
iriysrro iriysror iriyosrr iriyosrr iriyorsr iriyorrs iriyorrs iriyorsr iriyrosr iriyrors iriyrsor
iriyrsro iriyrrso iriyrros iriyrors iriyrosr iriyrros iriyrrso iriyrsro iriyrsor irsirory irsiroyr
irsirroy irsirryo irsiryro irsiryor irsiorry irsioryr irsiorry irsioryr irsioyrr irsioyrr irsirory
irsiroyr irsirroy irsirryo irsiryro irsiryor irsiyorr irsiyorr irsiyror irsiyrro irsiyrro irsiyror
irsriory irsrioyr irsriroy irsriryo irsriyro irsriyor irsroiry irsroiyr irsroriy irsroryi irsroyri
irsroyir irsrroiy irsrroyi irsrrioy irsrriyo irsrryio irsrryoi irsryori irsryoir irsryroi irsryrio
irsryiro irsryior irsoriry irsoriyr irsorriy irsorryi irsoryri irsoryir irsoirry irsoiryr irsoirry
irsoiryr irsoiyrr irsoiyrr irsoriry irsoriyr irsorriy irsorryi irsoryri irsoryir irsoyirr irsoyirr
irsoyrir irsoyrri irsoyrri irsoyrir irsrroiy irsrroyi irsrrioy irsrriyo irsrryio irsrryoi irsroriy
irsroryi irsroiry irsroiyr irsroyir irsroyri irsriory irsrioyr irsriroy irsriryo irsriyro irsriyor
irsryoir irsryori irsryior irsryiro irsryrio irsryroi irsyrori irsyroir irsyrroi irsyrrio irsyriro
irsyrior irsyorri irsyorir irsyorri irsyorir irsyoirr irsyoirr irsyrori irsyroir irsyrroi irsyrrio
irsyriro irsyrior irsyiorr irsyiorr irsyiror irsyirro irsyirro irsyiror iroisrry iroisryr iroisrry
iroisryr iroisyrr iroisyrr iroirsry iroirsyr iroirrsy iroirrys iroiryrs iroirysr iroirrsy iroirrys
iroirsry iroirsyr iroirysr iroiryrs iroiyrrs iroiyrsr iroiyrrs iroiyrsr iroiysrr iroiysrr irosirry
irosiryr irosirry irosiryr irosiyrr irosiyrr irosriry irosriyr irosrriy irosrryi irosryri irosryir
irosrriy irosrryi irosriry irosriyr irosryir irosryri irosyrri irosyrir irosyrri irosyrir irosyirr
irosyirr irorsiry irorsiyr irorsriy irorsryi irorsyri irorsyir irorisry irorisyr irorirsy irorirys
iroriyrs iroriysr irorrisy irorriys irorrsiy irorrsyi irorrysi irorryis iroryirs iroryisr iroryris
iroryrsi irorysri irorysir irorsriy irorsryi irorsiry irorsiyr irorsyir irorsyri irorrsiy irorrsyi
irorrisy irorriys irorryis irorrysi irorirsy irorirys irorisry irorisyr iroriysr iroriyrs iroryris
iroryrsi iroryirs iroryisr irorysir irorysri iroysrri iroysrir iroysrri iroysrir iroysirr iroysirr
iroyrsri iroyrsir iroyrrsi iroyrris iroyrirs iroyrisr iroyrrsi iroyrris iroyrsri iroyrsir iroyrisr
iroyrirs iroyirrs iroyirsr iroyirrs iroyirsr iroyisrr iroyisrr irrisory irrisoyr irrisroy irrisryo
irrisyro irrisyor irriosry irriosyr irriorsy irriorys irrioyrs irrioysr irrirosy irriroys irrirsoy
irrirsyo irriryso irriryos irriyors irriyosr irriyros irriyrso irriysro irriysor irrsiory irrsioyr
irrsiroy irrsiryo irrsiyro irrsiyor irrsoiry irrsoiyr irrsoriy irrsoryi irrsoyri irrsoyir irrsroiy
irrsroyi irrsrioy irrsriyo irrsryio irrsryoi irrsyori irrsyoir irrsyroi irrsyrio irrsyiro irrsyior
irrosiry irrosiyr irrosriy irrosryi irrosyri irrosyir irroisry irroisyr irroirsy irroirys irroiyrs
irroiysr irrorisy irroriys irrorsiy irrorsyi irrorysi irroryis irroyirs irroyisr irroyris irroyrsi
irroysri irroysir irrrsoiy irrrsoyi irrrsioy irrrsiyo irrrsyio irrrsyoi irrrosiy irrrosyi irrroisy
irrroiys irrroyis irrroysi irrriosy irrrioys irrrisoy irrrisyo irrriyso irrriyos irrryois irrryosi
irrryios irrryiso irrrysio irrrysoi irrysori irrysoir irrysroi irrysrio irrysiro irrysior irryosri
irryosir irryorsi irryoris irryoirs irryoisr irryrosi irryrois irryrsoi irryrsio irryriso irryrios
irryiors irryiosr irryiros irryirso irryisro irryisor iryisorr iryisorr iryisror iryisrro iryisrro
iryisror iryiosrr iryiosrr iryiorsr iryiorrs iryiorrs iryiorsr iryirosr iryirors iryirsor iryirsro
iryirrso iryirros iryirors iryirosr iryirros iryirrso iryirsro iryirsor irysiorr irysiorr irysiror
irysirro irysirro irysiror irysoirr irysoirr irysorir irysorri irysorri irysorir irysroir irysrori
irysrior irysriro irysrrio irysrroi irysrori irysroir irysrroi irysrrio irysriro irysrior iryosirr
iryosirr iryosrir iryosrri iryosrri iryosrir iryoisrr iryoisrr iryoirsr iryoirrs iryoirrs iryoirsr
iryorisr iryorirs iryorsir iryorsri iryorrsi iryorris iryorirs iryorisr iryorris iryorrsi iryorsri
iryorsir iryrsoir iryrsori iryrsior iryrsiro iryrsrio iryrsroi iryrosir iryrosri iryroisr iryroirs
iryroris iryrorsi iryriosr iryriors iryrisor iryrisro iryrirso iryriros iryrrois iryrrosi iryrrios
iryrriso iryrrsio iryrrsoi iryrsori iryrsoir iryrsroi iryrsrio iryrsiro iryrsior iryrosri iryrosir
iryrorsi iryroris iryroirs iryroisr iryrrosi iryrrois iryrrsoi iryrrsio iryrriso iryrrios iryriors
iryriosr iryriros iryrirso iryrisro iryrisor irrisory irrisoyr irrisroy irrisryo irrisyro irrisyor
irriosry irriosyr irriorsy irriorys irrioyrs irrioysr irrirosy irriroys irrirsoy irrirsyo irriryso
irriryos irriyors irriyosr irriyros irriyrso irriysro irriysor irrsiory irrsioyr irrsiroy irrsiryo
irrsiyro irrsiyor irrsoiry irrsoiyr irrsoriy irrsoryi irrsoyri irrsoyir irrsroiy irrsroyi irrsrioy
irrsriyo irrsryio irrsryoi irrsyori irrsyoir irrsyroi irrsyrio irrsyiro irrsyior irrosiry irrosiyr
irrosriy irrosryi irrosyri irrosyir irroisry irroisyr irroirsy irroirys irroiyrs irroiysr irrorisy
irroriys irrorsiy irrorsyi irrorysi irroryis irroyirs irroyisr irroyris irroyrsi irroysri irroysir
irrrsoiy irrrsoyi irrrsioy irrrsiyo irrrsyio irrrsyoi irrrosiy irrrosyi irrroisy irrroiys irrroyis
irrroysi irrriosy irrrioys irrrisoy irrrisyo irrriyso irrriyos irrryois irrryosi irrryios irrryiso
irrrysio irrrysoi irrysori irrysoir irrysroi irrysrio irrysiro irrysior irryosri irryosir irryorsi
irryoris irryoirs irryoisr irryrosi irryrois irryrsoi irryrsio irryriso irryrios irryiors irryiosr
irryiros irryirso irryisro irryisor irirsory irirsoyr irirsroy irirsryo irirsyro irirsyor irirosry
irirosyr irirorsy irirorys iriroyrs iriroysr irirrosy irirroys irirrsoy irirrsyo irirryso irirryos
iriryors iriryosr iriryros iriryrso irirysro irirysor irisrory irisroyr irisrroy irisrryo irisryro
irisryor irisorry irisoryr irisorry irisoryr irisoyrr irisoyrr irisrory irisroyr irisrroy irisrryo
irisryro irisryor irisyorr irisyorr irisyror irisyrro irisyrro irisyror iriosrry iriosryr iriosrry
iriosryr iriosyrr iriosyrr iriorsry iriorsyr iriorrsy iriorrys irioryrs iriorysr iriorrsy iriorrys
iriorsry iriorsyr iriorysr irioryrs irioyrrs irioyrsr irioyrrs irioyrsr irioysrr irioysrr irirsory
irirsoyr irirsroy irirsryo irirsyro irirsyor irirosry irirosyr irirorsy irirorys iriroyrs iriroysr
irirrosy irirroys irirrsoy irirrsyo irirryso irirryos iriryors iriryosr iriryros iriryrso irirysro
irirysor iriysorr iriysorr iriysror iriysrro iriysrro iriysror iriyosrr iriyosrr iriyorsr iriyorrs
iriyorrs iriyorsr iriyrosr iriyrors iriyrsor iriyrsro iriyrrso iriyrros iriyrors iriyrosr iriyrros
iriyrrso iriyrsro iriyrsor irsirory irsiroyr irsirroy irsirryo irsiryro irsiryor irsiorry irsioryr
irsiorry irsioryr irsioyrr irsioyrr irsirory irsiroyr irsirroy irsirryo irsiryro irsiryor irsiyorr
irsiyorr irsiyror irsiyrro irsiyrro irsiyror irsriory irsrioyr irsriroy irsriryo irsriyro irsriyor
irsroiry irsroiyr irsroriy irsroryi irsroyri irsroyir irsrroiy irsrroyi irsrrioy irsrriyo irsrryio
irsrryoi irsryori irsryoir irsryroi irsryrio irsryiro irsryior irsoriry irsoriyr irsorriy irsorryi
irsoryri irsoryir irsoirry irsoiryr irsoirry irsoiryr irsoiyrr irsoiyrr irsoriry irsoriyr irsorriy
irsorryi irsoryri irsoryir irsoyirr irsoyirr irsoyrir irsoyrri irsoyrri irsoyrir irsrroiy irsrroyi
irsrrioy irsrriyo irsrryio irsrryoi irsroriy irsroryi irsroiry irsroiyr irsroyir irsroyri irsriory
irsrioyr irsriroy irsriryo irsriyro irsriyor irsryoir irsryori irsryior irsryiro irsryrio irsryroi
irsyrori irsyroir irsyrroi irsyrrio irsyriro irsyrior irsyorri irsyorir irsyorri irsyorir irsyoirr
irsyoirr irsyrori irsyroir irsyrroi irsyrrio irsyriro irsyrior irsyiorr irsyiorr irsyiror irsyirro
irsyirro irsyiror iroisrry iroisryr iroisrry iroisryr iroisyrr iroisyrr iroirsry iroirsyr iroirrsy
iroirrys iroiryrs iroirysr iroirrsy iroirrys iroirsry iroirsyr iroirysr iroiryrs iroiyrrs iroiyrsr
iroiyrrs iroiyrsr iroiysrr iroiysrr irosirry irosiryr irosirry irosiryr irosiyrr irosiyrr irosriry
irosriyr irosrriy irosrryi irosryri irosryir irosrriy irosrryi irosriry irosriyr irosryir irosryri
irosyrri irosyrir irosyrri irosyrir irosyirr irosyirr irorsiry irorsiyr irorsriy irorsryi irorsyri
irorsyir irorisry irorisyr irorirsy irorirys iroriyrs iroriysr irorrisy irorriys irorrsiy irorrsyi
irorrysi irorryis iroryirs iroryisr iroryris iroryrsi irorysri irorysir irorsriy irorsryi irorsiry
irorsiyr irorsyir irorsyri irorrsiy irorrsyi irorrisy irorriys irorryis irorrysi irorirsy irorirys
irorisry irorisyr iroriysr iroriyrs iroryris iroryrsi iroryirs iroryisr irorysir irorysri iroysrri
iroysrir iroysrri iroysrir iroysirr iroysirr iroyrsri iroyrsir iroyrrsi iroyrris iroyrirs iroyrisr
iroyrrsi iroyrris iroyrsri iroyrsir iroyrisr iroyrirs iroyirrs iroyirsr iroyirrs iroyirsr iroyisrr
iroyisrr irrisory irrisoyr irrisroy irrisryo irrisyro irrisyor irriosry irriosyr irriorsy irriorys
irrioyrs irrioysr irrirosy irriroys irrirsoy irrirsyo irriryso irriryos irriyors irriyosr irriyros
irriyrso irriysro irriysor irrsiory irrsioyr irrsiroy irrsiryo irrsiyro irrsiyor irrsoiry irrsoiyr
irrsoriy irrsoryi irrsoyri irrsoyir irrsroiy irrsroyi irrsrioy irrsriyo irrsryio irrsryoi irrsyori
irrsyoir irrsyroi irrsyrio irrsyiro irrsyior irrosiry irrosiyr irrosriy irrosryi irrosyri irrosyir
irroisry irroisyr irroirsy irroirys irroiyrs irroiysr irrorisy irroriys irrorsiy irrorsyi irrorysi
irroryis irroyirs irroyisr irroyris irroyrsi irroysri irroysir irrrsoiy irrrsoyi irrrsioy irrrsiyo
irrrsyio irrrsyoi irrrosiy irrrosyi irrroisy irrroiys irrroyis irrroysi irrriosy irrrioys irrrisoy
irrrisyo irrriyso irrriyos irrryois irrryosi irrryios irrryiso irrrysio irrrysoi irrysori irrysoir
irrysroi irrysrio irrysiro irrysior irryosri irryosir irryorsi irryoris irryoirs irryoisr irryrosi
irryrois irryrsoi irryrsio irryriso irryrios irryiors irryiosr irryiros irryirso irryisro irryisor
iryisorr iryisorr iryisror iryisrro iryisrro iryisror iryiosrr iryiosrr iryiorsr iryiorrs iryiorrs
iryiorsr iryirosr iryirors iryirsor iryirsro iryirrso iryirros iryirors iryirosr iryirros iryirrso
iryirsro iryirsor irysiorr irysiorr irysiror irysirro irysirro irysiror irysoirr irysoirr irysorir
irysorri irysorri irysorir irysroir irysrori irysrior irysriro irysrrio irysrroi irysrori irysroir
irysrroi irysrrio irysriro irysrior iryosirr iryosirr iryosrir iryosrri iryosrri iryosrir iryoisrr
iryoisrr iryoirsr iryoirrs iryoirrs iryoirsr iryorisr iryorirs iryorsir iryorsri iryorrsi iryorris
iryorirs iryorisr iryorris iryorrsi iryorsri iryorsir iryrsoir iryrsori iryrsior iryrsiro iryrsrio
iryrsroi iryrosir iryrosri iryroisr iryroirs iryroris iryrorsi iryriosr iryriors iryrisor iryrisro
iryrirso iryriros iryrrois iryrrosi iryrrios iryrriso iryrrsio iryrrsoi iryrsori iryrsoir iryrsroi
iryrsrio iryrsiro iryrsior iryrosri iryrosir iryrorsi iryroris iryroirs iryroisr iryrrosi iryrrois
iryrrsoi iryrrsio iryrriso iryrrios iryriors iryriosr iryriros iryrirso iryrisro iryrisor iirrsory
iirrsoyr iirrsroy iirrsryo iirrsyro iirrsyor iirrosry iirrosyr iirrorsy iirrorys iirroyrs iirroysr
iirrrosy iirrroys iirrrsoy iirrrsyo iirrryso iirrryos iirryors iirryosr iirryros iirryrso iirrysro
iirrysor iirsrory iirsroyr iirsrroy iirsrryo iirsryro iirsryor iirsorry iirsoryr iirsorry iirsoryr
iirsoyrr iirsoyrr iirsrory iirsroyr iirsrroy iirsrryo iirsryro iirsryor iirsyorr iirsyorr iirsyror
iirsyrro iirsyrro iirsyror iirosrry iirosryr iirosrry iirosryr iirosyrr iirosyrr iirorsry iirorsyr
iirorrsy iirorrys iiroryrs iirorysr iirorrsy iirorrys iirorsry iirorsyr iirorysr iiroryrs iiroyrrs
iiroyrsr iiroyrrs iiroyrsr iiroysrr iiroysrr iirrsory iirrsoyr iirrsroy iirrsryo iirrsyro iirrsyor
iirrosry iirrosyr iirrorsy iirrorys iirroyrs iirroysr iirrrosy iirrroys iirrrsoy iirrrsyo iirrryso
iirrryos iirryors iirryosr iirryros iirryrso iirrysro iirrysor iirysorr iirysorr iirysror iirysrro
iirysrro iirysror iiryosrr iiryosrr iiryorsr iiryorrs iiryorrs iiryorsr iiryrosr iiryrors iiryrsor
iiryrsro iiryrrso iiryrros iiryrors iiryrosr iiryrros iiryrrso iiryrsro iiryrsor iirrsory iirrsoyr
iirrsroy iirrsryo iirrsyro iirrsyor iirrosry iirrosyr iirrorsy iirrorys iirroyrs iirroysr iirrrosy
iirrroys iirrrsoy iirrrsyo iirrryso iirrryos iirryors iirryosr iirryros iirryrso iirrysro iirrysor
iirsrory iirsroyr iirsrroy iirsrryo iirsryro iirsryor iirsorry iirsoryr iirsorry iirsoryr iirsoyrr
iirsoyrr iirsrory iirsroyr iirsrroy iirsrryo iirsryro iirsryor iirsyorr iirsyorr iirsyror iirsyrro
iirsyrro iirsyror iirosrry iirosryr iirosrry iirosryr iirosyrr iirosyrr iirorsry iirorsyr iirorrsy
iirorrys iiroryrs iirorysr iirorrsy iirorrys iirorsry iirorsyr iirorysr iiroryrs iiroyrrs iiroyrsr
iiroyrrs iiroyrsr iiroysrr iiroysrr iirrsory iirrsoyr iirrsroy iirrsryo iirrsyro iirrsyor iirrosry
iirrosyr iirrorsy iirrorys iirroyrs iirroysr iirrrosy iirrroys iirrrsoy iirrrsyo iirrryso iirrryos
iirryors iirryosr iirryros iirryrso iirrysro iirrysor iirysorr iirysorr iirysror iirysrro iirysrro
iirysror iiryosrr iiryosrr iiryorsr iiryorrs iiryorrs iiryorsr iiryrosr iiryrors iiryrsor iiryrsro
iiryrrso iiryrros iiryrors iiryrosr iiryrros iiryrrso iiryrsro iiryrsor iisrrory iisrroyr iisrrroy
iisrrryo iisrryro iisrryor iisrorry iisroryr iisrorry iisroryr iisroyrr iisroyrr iisrrory iisrroyr
iisrrroy iisrrryo iisrryro iisrryor iisryorr iisryorr iisryror iisryrro iisryrro iisryror iisrrory
iisrroyr iisrrroy iisrrryo iisrryro iisrryor iisrorry iisroryr iisrorry iisroryr iisroyrr iisroyrr
iisrrory iisrroyr iisrrroy iisrrryo iisrryro iisrryor iisryorr iisryorr iisryror iisryrro iisryrro
iisryror iisorrry iisorryr iisorrry iisorryr iisoryrr iisoryrr iisorrry iisorryr iisorrry iisorryr
iisoryrr iisoryrr iisorrry iisorryr iisorrry iisorryr iisoryrr iisoryrr iisoyrrr iisoyrrr iisoyrrr
iisoyrrr iisoyrrr iisoyrrr iisrrory iisrroyr iisrrroy iisrrryo iisrryro iisrryor iisrorry iisroryr
iisrorry iisroryr iisroyrr iisroyrr iisrrory iisrroyr iisrrroy iisrrryo iisrryro iisrryor iisryorr
iisryorr iisryror iisryrro iisryrro iisryror iisyrorr iisyrorr iisyrror iisyrrro iisyrrro iisyrror
iisyorrr iisyorrr iisyorrr iisyorrr iisyorrr iisyorrr iisyrorr iisyrorr iisyrror iisyrrro iisyrrro
iisyrror iisyrorr iisyrorr iisyrror iisyrrro iisyrrro iisyrror iiorsrry iiorsryr iiorsrry iiorsryr
iiorsyrr iiorsyrr iiorrsry iiorrsyr iiorrrsy iiorrrys iiorryrs iiorrysr iiorrrsy iiorrrys iiorrsry
iiorrsyr iiorrysr iiorryrs iioryrrs iioryrsr iioryrrs iioryrsr iiorysrr iiorysrr iiosrrry iiosrryr
iiosrrry iiosrryr iiosryrr iiosryrr iiosrrry iiosrryr iiosrrry iiosrryr iiosryrr iiosryrr iiosrrry
iiosrryr iiosrrry iiosrryr iiosryrr iiosryrr iiosyrrr iiosyrrr iiosyrrr iiosyrrr iiosyrrr iiosyrrr
iiorsrry iiorsryr iiorsrry iiorsryr iiorsyrr iiorsyrr iiorrsry iiorrsyr iiorrrsy iiorrrys iiorryrs
iiorrysr iiorrrsy iiorrrys iiorrsry iiorrsyr iiorrysr iiorryrs iioryrrs iioryrsr iioryrrs iioryrsr
iiorysrr iiorysrr iiorsrry iiorsryr iiorsrry iiorsryr iiorsyrr iiorsyrr iiorrsry iiorrsyr iiorrrsy
iiorrrys iiorryrs iiorrysr iiorrrsy iiorrrys iiorrsry iiorrsyr iiorrysr iiorryrs iioryrrs iioryrsr
iioryrrs iioryrsr iiorysrr iiorysrr iioysrrr iioysrrr iioysrrr iioysrrr iioysrrr iioysrrr iioyrsrr
iioyrsrr iioyrrsr iioyrrrs iioyrrrs iioyrrsr iioyrrsr iioyrrrs iioyrsrr iioyrsrr iioyrrsr iioyrrrs
iioyrrrs iioyrrsr iioyrrrs iioyrrsr iioyrsrr iioyrsrr iirrsory iirrsoyr iirrsroy iirrsryo iirrsyro
iirrsyor iirrosry iirrosyr iirrorsy iirrorys iirroyrs iirroysr iirrrosy iirrroys iirrrsoy iirrrsyo
iirrryso iirrryos iirryors iirryosr iirryros iirryrso iirrysro iirrysor iirsrory iirsroyr iirsrroy
iirsrryo iirsryro iirsryor iirsorry iirsoryr iirsorry iirsoryr iirsoyrr iirsoyrr iirsrory iirsroyr
iirsrroy iirsrryo iirsryro iirsryor iirsyorr iirsyorr iirsyror iirsyrro iirsyrro iirsyror iirosrry
iirosryr iirosrry iirosryr iirosyrr iirosyrr iirorsry iirorsyr iirorrsy iirorrys iiroryrs iirorysr
iirorrsy iirorrys iirorsry iirorsyr iirorysr iiroryrs iiroyrrs iiroyrsr iiroyrrs iiroyrsr iiroysrr
iiroysrr iirrsory iirrsoyr iirrsroy iirrsryo iirrsyro iirrsyor iirrosry iirrosyr iirrorsy iirrorys
iirroyrs iirroysr iirrrosy iirrroys iirrrsoy iirrrsyo iirrryso iirrryos iirryors iirryosr iirryros
iirryrso iirrysro iirrysor iirysorr iirysorr iirysror iirysrro iirysrro iirysror iiryosrr iiryosrr
iiryorsr iiryorrs iiryorrs iiryorsr iiryrosr iiryrors iiryrsor iiryrsro iiryrrso iiryrros iiryrors
iiryrosr iiryrros iiryrrso iiryrsro iiryrsor iiyrsorr iiyrsorr iiyrsror iiyrsrro iiyrsrro iiyrsror
iiyrosrr iiyrosrr iiyrorsr iiyrorrs iiyrorrs iiyrorsr iiyrrosr iiyrrors iiyrrsor iiyrrsro iiyrrrso
iiyrrros iiyrrors iiyrrosr iiyrrros iiyrrrso iiyrrsro iiyrrsor iiysrorr iiysrorr iiysrror iiysrrro
iiysrrro iiysrror iiysorrr iiysorrr iiysorrr iiysorrr iiysorrr iiysorrr iiysrorr iiysrorr iiysrror
iiysrrro iiysrrro iiysrror iiysrorr iiysrorr iiysrror iiysrrro iiysrrro iiysrror iiyosrrr iiyosrrr
iiyosrrr iiyosrrr iiyosrrr iiyosrrr iiyorsrr iiyorsrr iiyorrsr iiyorrrs iiyorrrs iiyorrsr iiyorrsr
iiyorrrs iiyorsrr iiyorsrr iiyorrsr iiyorrrs iiyorrrs iiyorrsr iiyorrrs iiyorrsr iiyorsrr iiyorsrr
iiyrsorr iiyrsorr iiyrsror iiyrsrro iiyrsrro iiyrsror iiyrosrr iiyrosrr iiyrorsr iiyrorrs iiyrorrs
iiyrorsr iiyrrosr iiyrrors iiyrrsor iiyrrsro iiyrrrso iiyrrros iiyrrors iiyrrosr iiyrrros iiyrrrso
iiyrrsro iiyrrsor iiyrsorr iiyrsorr iiyrsror iiyrsrro iiyrsrro iiyrsror iiyrosrr iiyrosrr iiyrorsr
iiyrorrs iiyrorrs iiyrorsr iiyrrosr iiyrrors iiyrrsor iiyrrsro iiyrrrso iiyrrros iiyrrors iiyrrosr
iiyrrros iiyrrrso iiyrrsro iiyrrsor isrirory isriroyr isrirroy isrirryo isriryro isriryor isriorry
isrioryr isriorry isrioryr isrioyrr isrioyrr isrirory isriroyr isrirroy isrirryo isriryro isriryor
isriyorr isriyorr isriyror isriyrro isriyrro isriyror isrriory isrrioyr isrriroy isrriryo isrriyro
isrriyor isrroiry isrroiyr isrroriy isrroryi isrroyri isrroyir isrrroiy isrrroyi isrrrioy isrrriyo
isrrryio isrrryoi isrryori isrryoir isrryroi isrryrio isrryiro isrryior isroriry isroriyr isrorriy
isrorryi isroryri isroryir isroirry isroiryr isroirry isroiryr isroiyrr isroiyrr isroriry isroriyr
isrorriy isrorryi isroryri isroryir isroyirr isroyirr isroyrir isroyrri isroyrri isroyrir isrrroiy
isrrroyi isrrrioy isrrriyo isrrryio isrrryoi isrroriy isrroryi isrroiry isrroiyr isrroyir isrroyri
isrriory isrrioyr isrriroy isrriryo isrriyro isrriyor isrryoir isrryori isrryior isrryiro isrryrio
isrryroi isryrori isryroir isryrroi isryrrio isryriro isryrior isryorri isryorir isryorri isryorir
isryoirr isryoirr isryrori isryroir isryrroi isryrrio isryriro isryrior isryiorr isryiorr isryiror
isryirro isryirro isryiror isirrory isirroyr isirrroy isirrryo isirryro isirryor isirorry isiroryr
isirorry isiroryr isiroyrr isiroyrr isirrory isirroyr isirrroy isirrryo isirryro isirryor isiryorr
isiryorr isiryror isiryrro isiryrro isiryror isirrory isirroyr isirrroy isirrryo isirryro isirryor
isirorry isiroryr isirorry isiroryr isiroyrr isiroyrr isirrory isirroyr isirrroy isirrryo isirryro
isirryor isiryorr isiryorr isiryror isiryrro isiryrro isiryror isiorrry isiorryr isiorrry isiorryr
isioryrr isioryrr isiorrry isiorryr isiorrry isiorryr isioryrr isioryrr isiorrry isiorryr isiorrry
isiorryr isioryrr isioryrr isioyrrr isioyrrr isioyrrr isioyrrr isioyrrr isioyrrr isirrory isirroyr
isirrroy isirrryo isirryro isirryor isirorry isiroryr isirorry isiroryr isiroyrr isiroyrr isirrory
isirroyr isirrroy isirrryo isirryro isirryor isiryorr isiryorr isiryror isiryrro isiryrro isiryror
isiyrorr isiyrorr isiyrror isiyrrro isiyrrro isiyrror isiyorrr isiyorrr isiyorrr isiyorrr isiyorrr
isiyorrr isiyrorr isiyrorr isiyrror isiyrrro isiyrrro isiyrror isiyrorr isiyrorr isiyrror isiyrrro
isiyrrro isiyrror isrirory isriroyr isrirroy isrirryo isriryro isriryor isriorry isrioryr isriorry
isrioryr isrioyrr isrioyrr isrirory isriroyr isrirroy isrirryo isriryro isriryor isriyorr isriyorr
isriyror isriyrro isriyrro isriyror isrriory isrrioyr isrriroy isrriryo isrriyro isrriyor isrroiry
isrroiyr isrroriy isrroryi isrroyri isrroyir isrrroiy isrrroyi isrrrioy isrrriyo isrrryio isrrryoi
isrryori isrryoir isrryroi isrryrio isrryiro isrryior isroriry isroriyr isrorriy isrorryi isroryri
isroryir isroirry isroiryr isroirry isroiryr isroiyrr isroiyrr isroriry isroriyr isrorriy isrorryi
isroryri isroryir isroyirr isroyirr isroyrir isroyrri isroyrri isroyrir isrrroiy isrrroyi isrrrioy
isrrriyo isrrryio isrrryoi isrroriy isrroryi isrroiry isrroiyr isrroyir isrroyri isrriory isrrioyr
isrriroy isrriryo isrriyro isrriyor isrryoir isrryori isrryior isrryiro isrryrio isrryroi isryrori
isryroir isryrroi isryrrio isryriro isryrior isryorri isryorir isryorri isryorir isryoirr isryoirr
isryrori isryroir isryrroi isryrrio isryriro isryrior isryiorr isryiorr isryiror isryirro isryirro
isryiror isoirrry isoirryr isoirrry isoirryr isoiryrr isoiryrr isoirrry isoirryr isoirrry isoirryr
isoiryrr isoiryrr isoirrry isoirryr isoirrry isoirryr isoiryrr isoiryrr isoiyrrr isoiyrrr isoiyrrr
isoiyrrr isoiyrrr isoiyrrr isorirry isoriryr isorirry isoriryr isoriyrr isoriyrr isorriry isorriyr
isorrriy isorrryi isorryri isorryir isorrriy isorrryi isorriry isorriyr isorryir isorryri isoryrri
isoryrir isoryrri isoryrir isoryirr isoryirr isorriry isorriyr isorrriy isorrryi isorryri isorryir
isorirry isoriryr isorirry isoriryr isoriyrr isoriyrr isorriry isorriyr isorrriy isorrryi isorryri
isorryir isoryirr isoryirr isoryrir isoryrri isoryrri isoryrir isorrriy isorrryi isorriry isorriyr
isorryir isorryri isorrriy isorrryi isorriry isorriyr isorryir isorryri isorirry isoriryr isorirry
isoriryr isoriyrr isoriyrr isoryrir isoryrri isoryirr isoryirr isoryrir isoryrri isoyrrri isoyrrir
isoyrrri isoyrrir isoyrirr isoyrirr isoyrrri isoyrrir isoyrrri isoyrrir isoyrirr isoyrirr isoyrrri
isoyrrir isoyrrri isoyrrir isoyrirr isoyrirr isoyirrr isoyirrr isoyirrr isoyirrr isoyirrr isoyirrr
isrirory isriroyr isrirroy isrirryo isriryro isriryor isriorry isrioryr isriorry isrioryr isrioyrr
isrioyrr isrirory isriroyr isrirroy isrirryo isriryro isriryor isriyorr isriyorr isriyror isriyrro
isriyrro isriyror isrriory isrrioyr isrriroy isrriryo isrriyro isrriyor isrroiry isrroiyr isrroriy
isrroryi isrroyri isrroyir isrrroiy isrrroyi isrrrioy isrrriyo isrrryio isrrryoi isrryori isrryoir
isrryroi isrryrio isrryiro isrryior isroriry isroriyr isrorriy isrorryi isroryri isroryir isroirry
isroiryr isroirry isroiryr isroiyrr isroiyrr isroriry isroriyr isrorriy isrorryi isroryri isroryir
isroyirr isroyirr isroyrir isroyrri isroyrri isroyrir isrrroiy isrrroyi isrrrioy isrrriyo isrrryio
isrrryoi isrroriy isrroryi isrroiry isrroiyr isrroyir isrroyri isrriory isrrioyr isrriroy isrriryo
isrriyro isrriyor isrryoir isrryori isrryior isrryiro isrryrio isrryroi isryrori isryroir isryrroi
isryrrio isryriro isryrior isryorri isryorir isryorri isryorir isryoirr isryoirr isryrori isryroir
isryrroi isryrrio isryriro isryrior isryiorr isryiorr isryiror isryirro isryirro isryiror isyirorr
isyirorr isyirror isyirrro isyirrro isyirror isyiorrr isyiorrr isyiorrr isyiorrr isyiorrr isyiorrr
isyirorr isyirorr isyirror isyirrro isyirrro isyirror isyirorr isyirorr isyirror isyirrro isyirrro
isyirror isyriorr isyriorr isyriror isyrirro isyrirro isyriror isyroirr isyroirr isyrorir isyrorri
isyrorri isyrorir isyrroir isyrrori isyrrior isyrriro isyrrrio isyrrroi isyrrori isyrroir isyrrroi
isyrrrio isyrriro isyrrior isyorirr isyorirr isyorrir isyorrri isyorrri isyorrir isyoirrr isyoirrr
isyoirrr isyoirrr isyoirrr isyoirrr isyorirr isyorirr isyorrir isyorrri isyorrri isyorrir isyorirr
isyorirr isyorrir isyorrri isyorrri isyorrir isyrroir isyrrori isyrrior isyrriro isyrrrio isyrrroi
isyrorir isyrorri isyroirr isyroirr isyrorir isyrorri isyriorr isyriorr isyriror isyrirro isyrirro
isyriror isyrroir isyrrori isyrrior isyrriro isyrrrio isyrrroi isyrrori isyrroir isyrrroi isyrrrio
isyrriro isyrrior isyrorri isyrorir isyrorri isyrorir isyroirr isyroirr isyrrori isyrroir isyrrroi
isyrrrio isyrriro isyrrior isyriorr isyriorr isyriror isyrirro isyrirro isyriror iorisrry iorisryr
iorisrry iorisryr iorisyrr iorisyrr iorirsry iorirsyr iorirrsy iorirrys ioriryrs iorirysr iorirrsy
iorirrys iorirsry iorirsyr iorirysr ioriryrs ioriyrrs ioriyrsr ioriyrrs ioriyrsr ioriysrr ioriysrr
iorsirry iorsiryr iorsirry iorsiryr iorsiyrr iorsiyrr iorsriry iorsriyr iorsrriy iorsrryi iorsryri
iorsryir iorsrriy iorsrryi iorsriry iorsriyr iorsryir iorsryri iorsyrri iorsyrir iorsyrri iorsyrir
iorsyirr iorsyirr iorrsiry iorrsiyr iorrsriy iorrsryi iorrsyri iorrsyir iorrisry iorrisyr iorrirsy
iorrirys iorriyrs iorriysr iorrrisy iorrriys iorrrsiy iorrrsyi iorrrysi iorrryis iorryirs iorryisr
iorryris iorryrsi iorrysri iorrysir iorrsriy iorrsryi iorrsiry iorrsiyr iorrsyir iorrsyri iorrrsiy
iorrrsyi iorrrisy iorrriys iorrryis iorrrysi iorrirsy iorrirys iorrisry iorrisyr iorriysr iorriyrs
iorryris iorryrsi iorryirs iorryisr iorrysir iorrysri iorysrri iorysrir iorysrri iorysrir iorysirr
iorysirr ioryrsri ioryrsir ioryrrsi ioryrris ioryrirs ioryrisr ioryrrsi ioryrris ioryrsri ioryrsir
ioryrisr ioryrirs ioryirrs ioryirsr ioryirrs ioryirsr ioryisrr ioryisrr ioirsrry ioirsryr ioirsrry
ioirsryr ioirsyrr ioirsyrr ioirrsry ioirrsyr ioirrrsy ioirrrys ioirryrs ioirrysr ioirrrsy ioirrrys
ioirrsry ioirrsyr ioirrysr ioirryrs ioiryrrs ioiryrsr ioiryrrs ioiryrsr ioirysrr ioirysrr ioisrrry
ioisrryr ioisrrry ioisrryr ioisryrr ioisryrr ioisrrry ioisrryr ioisrrry ioisrryr ioisryrr ioisryrr
ioisrrry ioisrryr ioisrrry ioisrryr ioisryrr ioisryrr ioisyrrr ioisyrrr ioisyrrr ioisyrrr ioisyrrr
ioisyrrr ioirsrry ioirsryr ioirsrry ioirsryr ioirsyrr ioirsyrr ioirrsry ioirrsyr ioirrrsy ioirrrys
ioirryrs ioirrysr ioirrrsy ioirrrys ioirrsry ioirrsyr ioirrysr ioirryrs ioiryrrs ioiryrsr ioiryrrs
ioiryrsr ioirysrr ioirysrr ioirsrry ioirsryr ioirsrry ioirsryr ioirsyrr ioirsyrr ioirrsry ioirrsyr
ioirrrsy ioirrrys ioirryrs ioirrysr ioirrrsy ioirrrys ioirrsry ioirrsyr ioirrysr ioirryrs ioiryrrs
ioiryrsr ioiryrrs ioiryrsr ioirysrr ioirysrr ioiysrrr ioiysrrr ioiysrrr ioiysrrr ioiysrrr ioiysrrr
ioiyrsrr ioiyrsrr ioiyrrsr ioiyrrrs ioiyrrrs ioiyrrsr ioiyrrsr ioiyrrrs ioiyrsrr ioiyrsrr ioiyrrsr
ioiyrrrs ioiyrrrs ioiyrrsr ioiyrrrs ioiyrrsr ioiyrsrr ioiyrsrr iosirrry iosirryr iosirrry iosirryr
iosiryrr iosiryrr iosirrry iosirryr iosirrry iosirryr iosiryrr iosiryrr iosirrry iosirryr iosirrry
iosirryr iosiryrr iosiryrr iosiyrrr iosiyrrr iosiyrrr iosiyrrr iosiyrrr iosiyrrr iosrirry iosriryr
iosrirry iosriryr iosriyrr iosriyrr iosrriry iosrriyr iosrrriy iosrrryi iosrryri iosrryir iosrrriy
iosrrryi iosrriry iosrriyr iosrryir iosrryri iosryrri iosryrir iosryrri iosryrir iosryirr iosryirr
iosrriry iosrriyr iosrrriy iosrrryi iosrryri iosrryir iosrirry iosriryr iosrirry iosriryr iosriyrr
iosriyrr iosrriry iosrriyr iosrrriy iosrrryi iosrryri iosrryir iosryirr iosryirr iosryrir iosryrri
iosryrri iosryrir iosrrriy iosrrryi iosrriry iosrriyr iosrryir iosrryri iosrrriy iosrrryi iosrriry
iosrriyr iosrryir iosrryri iosrirry iosriryr iosrirry iosriryr iosriyrr iosriyrr iosryrir iosryrri
iosryirr iosryirr iosryrir iosryrri iosyrrri iosyrrir iosyrrri iosyrrir iosyrirr iosyrirr iosyrrri
iosyrrir iosyrrri iosyrrir iosyrirr iosyrirr iosyrrri iosyrrir iosyrrri iosyrrir iosyrirr iosyrirr
iosyirrr iosyirrr iosyirrr iosyirrr iosyirrr iosyirrr iorisrry iorisryr iorisrry iorisryr iorisyrr
iorisyrr iorirsry iorirsyr iorirrsy iorirrys ioriryrs iorirysr iorirrsy iorirrys iorirsry iorirsyr
iorirysr ioriryrs ioriyrrs ioriyrsr ioriyrrs ioriyrsr ioriysrr ioriysrr iorsirry iorsiryr iorsirry
iorsiryr iorsiyrr iorsiyrr iorsriry iorsriyr iorsrriy iorsrryi iorsryri iorsryir iorsrriy iorsrryi
iorsriry iorsriyr iorsryir iorsryri iorsyrri iorsyrir iorsyrri iorsyrir iorsyirr iorsyirr iorrsiry
iorrsiyr iorrsriy iorrsryi iorrsyri iorrsyir iorrisry iorrisyr iorrirsy iorrirys iorriyrs iorriysr
iorrrisy iorrriys iorrrsiy iorrrsyi iorrrysi iorrryis iorryirs iorryisr iorryris iorryrsi iorrysri
iorrysir iorrsriy iorrsryi iorrsiry iorrsiyr iorrsyir iorrsyri iorrrsiy iorrrsyi iorrrisy iorrriys
iorrryis iorrrysi iorrirsy iorrirys iorrisry iorrisyr iorriysr iorriyrs iorryris iorryrsi iorryirs
iorryisr iorrysir iorrysri iorysrri iorysrir iorysrri iorysrir iorysirr iorysirr ioryrsri ioryrsir
ioryrrsi ioryrris ioryrirs ioryrisr ioryrrsi ioryrris ioryrsri ioryrsir ioryrisr ioryrirs ioryirrs
ioryirsr ioryirrs ioryirsr ioryisrr ioryisrr iorisrry iorisryr iorisrry iorisryr iorisyrr iorisyrr
iorirsry iorirsyr iorirrsy iorirrys ioriryrs iorirysr iorirrsy iorirrys iorirsry iorirsyr iorirysr
ioriryrs ioriyrrs ioriyrsr ioriyrrs ioriyrsr ioriysrr ioriysrr iorsirry iorsiryr iorsirry iorsiryr
iorsiyrr iorsiyrr iorsriry iorsriyr iorsrriy iorsrryi iorsryri iorsryir iorsrriy iorsrryi iorsriry
iorsriyr iorsryir iorsryri iorsyrri iorsyrir iorsyrri iorsyrir iorsyirr iorsyirr iorrsiry iorrsiyr
iorrsriy iorrsryi iorrsyri iorrsyir iorrisry iorrisyr iorrirsy iorrirys iorriyrs iorriysr iorrrisy
iorrriys iorrrsiy iorrrsyi iorrrysi iorrryis iorryirs iorryisr iorryris iorryrsi iorrysri iorrysir
iorrsriy iorrsryi iorrsiry iorrsiyr iorrsyir iorrsyri iorrrsiy iorrrsyi iorrrisy iorrriys iorrryis
iorrrysi iorrirsy iorrirys iorrisry iorrisyr iorriysr iorriyrs iorryris iorryrsi iorryirs iorryisr
iorrysir iorrysri iorysrri iorysrir iorysrri iorysrir iorysirr iorysirr ioryrsri ioryrsir ioryrrsi
ioryrris ioryrirs ioryrisr ioryrrsi ioryrris ioryrsri ioryrsir ioryrisr ioryrirs ioryirrs ioryirsr
ioryirrs ioryirsr ioryisrr ioryisrr ioyisrrr ioyisrrr ioyisrrr ioyisrrr ioyisrrr ioyisrrr ioyirsrr
ioyirsrr ioyirrsr ioyirrrs ioyirrrs ioyirrsr ioyirrsr ioyirrrs ioyirsrr ioyirsrr ioyirrsr ioyirrrs
ioyirrrs ioyirrsr ioyirrrs ioyirrsr ioyirsrr ioyirsrr ioysirrr ioysirrr ioysirrr ioysirrr ioysirrr
ioysirrr ioysrirr ioysrirr ioysrrir ioysrrri ioysrrri ioysrrir ioysrrir ioysrrri ioysrirr ioysrirr
ioysrrir ioysrrri ioysrrri ioysrrir ioysrrri ioysrrir ioysrirr ioysrirr ioyrsirr ioyrsirr ioyrsrir
ioyrsrri ioyrsrri ioyrsrir ioyrisrr ioyrisrr ioyrirsr ioyrirrs ioyrirrs ioyrirsr ioyrrisr ioyrrirs
ioyrrsir ioyrrsri ioyrrrsi ioyrrris ioyrrirs ioyrrisr ioyrrris ioyrrrsi ioyrrsri ioyrrsir ioyrsrir
ioyrsrri ioyrsirr ioyrsirr ioyrsrir ioyrsrri ioyrrsir ioyrrsri ioyrrisr ioyrrirs ioyrrris ioyrrrsi
ioyrirsr ioyrirrs ioyrisrr ioyrisrr ioyrirsr ioyrirrs ioyrrris ioyrrrsi ioyrrirs ioyrrisr ioyrrsir
ioyrrsri ioyrsrri ioyrsrir ioyrsrri ioyrsrir ioyrsirr ioyrsirr ioyrrsri ioyrrsir ioyrrrsi ioyrrris
ioyrrirs ioyrrisr ioyrrrsi ioyrrris ioyrrsri ioyrrsir ioyrrisr ioyrrirs ioyrirrs ioyrirsr ioyrirrs
ioyrirsr ioyrisrr ioyrisrr irrisory irrisoyr irrisroy irrisryo irrisyro irrisyor irriosry irriosyr
irriorsy irriorys irrioyrs irrioysr irrirosy irriroys irrirsoy irrirsyo irriryso irriryos irriyors
irriyosr irriyros irriyrso irriysro irriysor irrsiory irrsioyr irrsiroy irrsiryo irrsiyro irrsiyor
irrsoiry irrsoiyr irrsoriy irrsoryi irrsoyri irrsoyir irrsroiy irrsroyi irrsrioy irrsriyo irrsryio
irrsryoi irrsyori irrsyoir irrsyroi irrsyrio irrsyiro irrsyior irrosiry irrosiyr irrosriy irrosryi
irrosyri irrosyir irroisry irroisyr irroirsy irroirys irroiyrs irroiysr irrorisy irroriys irrorsiy
irrorsyi irrorysi irroryis irroyirs irroyisr irroyris irroyrsi irroysri irroysir irrrsoiy irrrsoyi
irrrsioy irrrsiyo irrrsyio irrrsyoi irrrosiy irrrosyi irrroisy irrroiys irrroyis irrroysi irrriosy
irrrioys irrrisoy irrrisyo irrriyso irrriyos irrryois irrryosi irrryios irrryiso irrrysio irrrysoi
irrysori irrysoir irrysroi irrysrio irrysiro irrysior irryosri irryosir irryorsi irryoris irryoirs
irryoisr irryrosi irryrois irryrsoi irryrsio irryriso irryrios irryiors irryiosr irryiros irryirso
irryisro irryisor irirsory irirsoyr irirsroy irirsryo irirsyro irirsyor irirosry irirosyr irirorsy
irirorys iriroyrs iriroysr irirrosy irirroys irirrsoy irirrsyo irirryso irirryos iriryors iriryosr
iriryros iriryrso irirysro irirysor irisrory irisroyr irisrroy irisrryo irisryro irisryor irisorry
irisoryr irisorry irisoryr irisoyrr irisoyrr irisrory irisroyr irisrroy irisrryo irisryro irisryor
irisyorr irisyorr irisyror irisyrro irisyrro irisyror iriosrry iriosryr iriosrry iriosryr iriosyrr
iriosyrr iriorsry iriorsyr iriorrsy iriorrys irioryrs iriorysr iriorrsy iriorrys iriorsry iriorsyr
iriorysr irioryrs irioyrrs irioyrsr irioyrrs irioyrsr irioysrr irioysrr irirsory irirsoyr irirsroy
irirsryo irirsyro irirsyor irirosry irirosyr irirorsy irirorys iriroyrs iriroysr irirrosy irirroys
irirrsoy irirrsyo irirryso irirryos iriryors iriryosr iriryros iriryrso irirysro irirysor iriysorr
iriysorr iriysror iriysrro iriysrro iriysror iriyosrr iriyosrr iriyorsr iriyorrs iriyorrs iriyorsr
iriyrosr iriyrors iriyrsor iriyrsro iriyrrso iriyrros iriyrors iriyrosr iriyrros iriyrrso iriyrsro
iriyrsor irsirory irsiroyr irsirroy irsirryo irsiryro irsiryor irsiorry irsioryr irsiorry irsioryr
irsioyrr irsioyrr irsirory irsiroyr irsirroy irsirryo irsiryro irsiryor irsiyorr irsiyorr irsiyror
irsiyrro irsiyrro irsiyror irsriory irsrioyr irsriroy irsriryo irsriyro irsriyor irsroiry irsroiyr
irsroriy irsroryi irsroyri irsroyir irsrroiy irsrroyi irsrrioy irsrriyo irsrryio irsrryoi irsryori
irsryoir irsryroi irsryrio irsryiro irsryior irsoriry irsoriyr irsorriy irsorryi irsoryri irsoryir
irsoirry irsoiryr irsoirry irsoiryr irsoiyrr irsoiyrr irsoriry irsoriyr irsorriy irsorryi irsoryri
irsoryir irsoyirr irsoyirr irsoyrir irsoyrri irsoyrri irsoyrir irsrroiy irsrroyi irsrrioy irsrriyo
irsrryio irsrryoi irsroriy irsroryi irsroiry irsroiyr irsroyir irsroyri irsriory irsrioyr irsriroy
irsriryo irsriyro irsriyor irsryoir irsryori irsryior irsryiro irsryrio irsryroi irsyrori irsyroir
irsyrroi irsyrrio irsyriro irsyrior irsyorri irsyorir irsyorri irsyorir irsyoirr irsyoirr irsyrori
irsyroir irsyrroi irsyrrio irsyriro irsyrior irsyiorr irsyiorr irsyiror irsyirro irsyirro irsyiror
iroisrry iroisryr iroisrry iroisryr iroisyrr iroisyrr iroirsry iroirsyr iroirrsy iroirrys iroiryrs
iroirysr iroirrsy iroirrys iroirsry iroirsyr iroirysr iroiryrs iroiyrrs iroiyrsr iroiyrrs iroiyrsr
iroiysrr iroiysrr irosirry irosiryr irosirry irosiryr irosiyrr irosiyrr irosriry irosriyr irosrriy
irosrryi irosryri irosryir irosrriy irosrryi irosriry irosriyr irosryir irosryri irosyrri irosyrir
irosyrri irosyrir irosyirr irosyirr irorsiry irorsiyr irorsriy irorsryi irorsyri irorsyir irorisry
irorisyr irorirsy irorirys iroriyrs iroriysr irorrisy irorriys irorrsiy irorrsyi irorrysi irorryis
iroryirs iroryisr iroryris iroryrsi irorysri irorysir irorsriy irorsryi irorsiry irorsiyr irorsyir
irorsyri irorrsiy irorrsyi irorrisy irorriys irorryis irorrysi irorirsy irorirys irorisry irorisyr
iroriysr iroriyrs iroryris iroryrsi iroryirs iroryisr irorysir irorysri iroysrri iroysrir iroysrri
iroysrir iroysirr iroysirr iroyrsri iroyrsir iroyrrsi iroyrris iroyrirs iroyrisr iroyrrsi iroyrris
iroyrsri iroyrsir iroyrisr iroyrirs iroyirrs iroyirsr iroyirrs iroyirsr iroyisrr iroyisrr irrisory
irrisoyr irrisroy irrisryo irrisyro irrisyor irriosry irriosyr irriorsy irriorys irrioyrs irrioysr
irrirosy irriroys irrirsoy irrirsyo irriryso irriryos irriyors irriyosr irriyros irriyrso irriysro
irriysor irrsiory irrsioyr irrsiroy irrsiryo irrsiyro irrsiyor irrsoiry irrsoiyr irrsoriy irrsoryi
irrsoyri irrsoyir irrsroiy irrsroyi irrsrioy irrsriyo irrsryio irrsryoi irrsyori irrsyoir irrsyroi
irrsyrio irrsyiro irrsyior irrosiry irrosiyr irrosriy irrosryi irrosyri irrosyir irroisry irroisyr
irroirsy irroirys irroiyrs irroiysr irrorisy irroriys irrorsiy irrorsyi irrorysi irroryis irroyirs
irroyisr irroyris irroyrsi irroysri irroysir irrrsoiy irrrsoyi irrrsioy irrrsiyo irrrsyio irrrsyoi
irrrosiy irrrosyi irrroisy irrroiys irrroyis irrroysi irrriosy irrrioys irrrisoy irrrisyo irrriyso
irrriyos irrryois irrryosi irrryios irrryiso irrrysio irrrysoi irrysori irrysoir irrysroi irrysrio
irrysiro irrysior irryosri irryosir irryorsi irryoris irryoirs irryoisr irryrosi irryrois irryrsoi
irryrsio irryriso irryrios irryiors irryiosr irryiros irryirso irryisro irryisor iryisorr iryisorr
iryisror iryisrro iryisrro iryisror iryiosrr iryiosrr iryiorsr iryiorrs iryiorrs iryiorsr iryirosr
iryirors iryirsor iryirsro iryirrso iryirros iryirors iryirosr iryirros iryirrso iryirsro iryirsor
irysiorr irysiorr irysiror irysirro irysirro irysiror irysoirr irysoirr irysorir irysorri irysorri
irysorir irysroir irysrori irysrior irysriro irysrrio irysrroi irysrori irysroir irysrroi irysrrio
irysriro irysrior iryosirr iryosirr iryosrir iryosrri iryosrri iryosrir iryoisrr iryoisrr iryoirsr
iryoirrs iryoirrs iryoirsr iryorisr iryorirs iryorsir iryorsri iryorrsi iryorris iryorirs iryorisr
iryorris iryorrsi iryorsri iryorsir iryrsoir iryrsori iryrsior iryrsiro iryrsrio iryrsroi iryrosir
iryrosri iryroisr iryroirs iryroris iryrorsi iryriosr iryriors iryrisor iryrisro iryrirso iryriros
iryrrois iryrrosi iryrrios iryrriso iryrrsio iryrrsoi iryrsori iryrsoir iryrsroi iryrsrio iryrsiro
iryrsior iryrosri iryrosir iryrorsi iryroris iryroirs iryroisr iryrrosi iryrrois iryrrsoi iryrrsio
iryrriso iryrrios iryriors iryriosr iryriros iryrirso iryrisro iryrisor iyrisorr iyrisorr iyrisror
iyrisrro iyrisrro iyrisror iyriosrr iyriosrr iyriorsr iyriorrs iyriorrs iyriorsr iyrirosr iyrirors
iyrirsor iyrirsro iyrirrso iyrirros iyrirors iyrirosr iyrirros iyrirrso iyrirsro iyrirsor iyrsiorr
iyrsiorr iyrsiror iyrsirro iyrsirro iyrsiror iyrsoirr iyrsoirr iyrsorir iyrsorri iyrsorri iyrsorir
iyrsroir iyrsrori iyrsrior iyrsriro iyrsrrio iyrsrroi iyrsrori iyrsroir iyrsrroi iyrsrrio iyrsriro
iyrsrior iyrosirr iyrosirr iyrosrir iyrosrri iyrosrri iyrosrir iyroisrr iyroisrr iyroirsr iyroirrs
iyroirrs iyroirsr iyrorisr iyrorirs iyrorsir iyrorsri iyrorrsi iyrorris iyrorirs iyrorisr iyrorris
iyrorrsi iyrorsri iyrorsir iyrrsoir iyrrsori iyrrsior iyrrsiro iyrrsrio iyrrsroi iyrrosir iyrrosri
iyrroisr iyrroirs iyrroris iyrrorsi iyrriosr iyrriors iyrrisor iyrrisro iyrrirso iyrriros iyrrrois
iyrrrosi iyrrrios iyrrriso iyrrrsio iyrrrsoi iyrrsori iyrrsoir iyrrsroi iyrrsrio iyrrsiro iyrrsior
iyrrosri iyrrosir iyrrorsi iyrroris iyrroirs iyrroisr iyrrrosi iyrrrois iyrrrsoi iyrrrsio iyrrriso
iyrrrios iyrriors iyrriosr iyrriros iyrrirso iyrrisro iyrrisor iyirsorr iyirsorr iyirsror iyirsrro
iyirsrro iyirsror iyirosrr iyirosrr iyirorsr iyirorrs iyirorrs iyirorsr iyirrosr iyirrors iyirrsor
iyirrsro iyirrrso iyirrros iyirrors iyirrosr iyirrros iyirrrso iyirrsro iyirrsor iyisrorr iyisrorr
iyisrror iyisrrro iyisrrro iyisrror iyisorrr iyisorrr iyisorrr iyisorrr iyisorrr iyisorrr iyisrorr
iyisrorr iyisrror iyisrrro iyisrrro iyisrror iyisrorr iyisrorr iyisrror iyisrrro iyisrrro iyisrror
iyiosrrr iyiosrrr iyiosrrr iyiosrrr iyiosrrr iyiosrrr iyiorsrr iyiorsrr iyiorrsr iyiorrrs iyiorrrs
iyiorrsr iyiorrsr iyiorrrs iyiorsrr iyiorsrr iyiorrsr iyiorrrs iyiorrrs iyiorrsr iyiorrrs iyiorrsr
iyiorsrr iyiorsrr iyirsorr iyirsorr iyirsror iyirsrro iyirsrro iyirsror iyirosrr iyirosrr iyirorsr
iyirorrs iyirorrs iyirorsr iyirrosr iyirrors iyirrsor iyirrsro iyirrrso iyirrros iyirrors iyirrosr
iyirrros iyirrrso iyirrsro iyirrsor iyirsorr iyirsorr iyirsror iyirsrro iyirsrro iyirsror iyirosrr
iyirosrr iyirorsr iyirorrs iyirorrs iyirorsr iyirrosr iyirrors iyirrsor iyirrsro iyirrrso iyirrros
iyirrors iyirrosr iyirrros iyirrrso iyirrsro iyirrsor iysirorr iysirorr iysirror iysirrro iysirrro
iysirror iysiorrr iysiorrr iysiorrr iysiorrr iysiorrr iysiorrr iysirorr iysirorr iysirror iysirrro
iysirrro iysirror iysirorr iysirorr iysirror iysirrro iysirrro iysirror iysriorr iysriorr iysriror
iysrirro iysrirro iysriror iysroirr iysroirr iysrorir iysrorri iysrorri iysrorir iysrroir iysrrori
iysrrior iysrriro iysrrrio iysrrroi iysrrori iysrroir iysrrroi iysrrrio iysrriro iysrrior iysorirr
iysorirr iysorrir iysorrri iysorrri iysorrir iysoirrr iysoirrr iysoirrr iysoirrr iysoirrr iysoirrr
iysorirr iysorirr iysorrir iysorrri iysorrri iysorrir iysorirr iysorirr iysorrir iysorrri iysorrri
iysorrir iysrroir iysrrori iysrrior iysrriro iysrrrio iysrrroi iysrorir iysrorri iysroirr iysroirr
iysrorir iysrorri iysriorr iysriorr iysriror iysrirro iysrirro iysriror iysrroir iysrrori iysrrior
iysrriro iysrrrio iysrrroi iysrrori iysrroir iysrrroi iysrrrio iysrriro iysrrior iysrorri iysrorir
iysrorri iysrorir iysroirr iysroirr iysrrori iysrroir iysrrroi iysrrrio iysrriro iysrrior iysriorr
iysriorr iysriror iysrirro iysrirro iysriror iyoisrrr iyoisrrr iyoisrrr iyoisrrr iyoisrrr iyoisrrr
iyoirsrr iyoirsrr iyoirrsr iyoirrrs iyoirrrs iyoirrsr iyoirrsr iyoirrrs iyoirsrr iyoirsrr iyoirrsr
iyoirrrs iyoirrrs iyoirrsr iyoirrrs iyoirrsr iyoirsrr iyoirsrr iyosirrr iyosirrr iyosirrr iyosirrr
iyosirrr iyosirrr iyosrirr iyosrirr iyosrrir iyosrrri iyosrrri iyosrrir iyosrrir iyosrrri iyosrirr
iyosrirr iyosrrir iyosrrri iyosrrri iyosrrir iyosrrri iyosrrir iyosrirr iyosrirr iyorsirr iyorsirr
iyorsrir iyorsrri iyorsrri iyorsrir iyorisrr iyorisrr iyorirsr iyorirrs iyorirrs iyorirsr iyorrisr
iyorrirs iyorrsir iyorrsri iyorrrsi iyorrris iyorrirs iyorrisr iyorrris iyorrrsi iyorrsri iyorrsir
iyorsrir iyorsrri iyorsirr iyorsirr iyorsrir iyorsrri iyorrsir iyorrsri iyorrisr iyorrirs iyorrris
iyorrrsi iyorirsr iyorirrs iyorisrr iyorisrr iyorirsr iyorirrs iyorrris iyorrrsi iyorrirs iyorrisr
iyorrsir iyorrsri iyorsrri iyorsrir iyorsrri iyorsrir iyorsirr iyorsirr iyorrsri iyorrsir iyorrrsi
iyorrris iyorrirs iyorrisr iyorrrsi iyorrris iyorrsri iyorrsir iyorrisr iyorrirs iyorirrs iyorirsr
iyorirrs iyorirsr iyorisrr iyorisrr iyrisorr iyrisorr iyrisror iyrisrro iyrisrro iyrisror iyriosrr
iyriosrr iyriorsr iyriorrs iyriorrs iyriorsr iyrirosr iyrirors iyrirsor iyrirsro iyrirrso iyrirros
iyrirors iyrirosr iyrirros iyrirrso iyrirsro iyrirsor iyrsiorr iyrsiorr iyrsiror iyrsirro iyrsirro
iyrsiror iyrsoirr iyrsoirr iyrsorir iyrsorri iyrsorri iyrsorir iyrsroir iyrsrori iyrsrior iyrsriro
iyrsrrio iyrsrroi iyrsrori iyrsroir iyrsrroi iyrsrrio iyrsriro iyrsrior iyrosirr iyrosirr iyrosrir
iyrosrri iyrosrri iyrosrir iyroisrr iyroisrr iyroirsr iyroirrs iyroirrs iyroirsr iyrorisr iyrorirs
iyrorsir iyrorsri iyrorrsi iyrorris iyrorirs iyrorisr iyrorris iyrorrsi iyrorsri iyrorsir iyrrsoir
iyrrsori iyrrsior iyrrsiro iyrrsrio iyrrsroi iyrrosir iyrrosri iyrroisr iyrroirs iyrroris iyrrorsi
iyrriosr iyrriors iyrrisor iyrrisro iyrrirso iyrriros iyrrrois iyrrrosi iyrrrios iyrrriso iyrrrsio
iyrrrsoi iyrrsori iyrrsoir iyrrsroi iyrrsrio iyrrsiro iyrrsior iyrrosri iyrrosir iyrrorsi iyrroris
iyrroirs iyrroisr iyrrrosi iyrrrois iyrrrsoi iyrrrsio iyrrriso iyrrrios iyrriors iyrriosr iyrriros
iyrrirso iyrrisro iyrrisor iyrisorr iyrisorr iyrisror iyrisrro iyrisrro iyrisror iyriosrr iyriosrr
iyriorsr iyriorrs iyriorrs iyriorsr iyrirosr iyrirors iyrirsor iyrirsro iyrirrso iyrirros iyrirors
iyrirosr iyrirros iyrirrso iyrirsro iyrirsor iyrsiorr iyrsiorr iyrsiror iyrsirro iyrsirro iyrsiror
iyrsoirr iyrsoirr iyrsorir iyrsorri iyrsorri iyrsorir iyrsroir iyrsrori iyrsrior iyrsriro iyrsrrio
iyrsrroi iyrsrori iyrsroir iyrsrroi iyrsrrio iyrsriro iyrsrior iyrosirr iyrosirr iyrosrir iyrosrri
iyrosrri iyrosrir iyroisrr iyroisrr iyroirsr iyroirrs iyroirrs iyroirsr iyrorisr iyrorirs iyrorsir
iyrorsri iyrorrsi iyrorris iyrorirs iyrorisr iyrorris iyrorrsi iyrorsri iyrorsir iyrrsoir iyrrsori
iyrrsior iyrrsiro iyrrsrio iyrrsroi iyrrosir iyrrosri iyrroisr iyrroirs iyrroris iyrrorsi iyrriosr
iyrriors iyrrisor iyrrisro iyrrirso iyrriros iyrrrois iyrrrosi iyrrrios iyrrriso iyrrrsio iyrrrsoi
iyrrsori iyrrsoir iyrrsroi iyrrsrio iyrrsiro iyrrsior iyrrosri iyrrosir iyrrorsi iyrroris iyrroirs
iyrroisr iyrrrosi iyrrrois iyrrrsoi iyrrrsio iyrrriso iyrrrios iyrriors iyrriosr iyrriros iyrrirso
iyrrisro iyrrisor

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us