easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

increpitans

pikakes

saururae

philocathartic

alluviation

corrugatum

sanclemente

mutavique

abiissemusque

protractible

septicopyemia

laodiceanism

weaverling

sebastianite

kulakism

subpartitioned

steak

mentiras


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: irreducibleness
cipher variations:
jssfevdjcmfoftt kttgfwekdngpguu luuhgxfleohqhvv mvvihygmfpiriww nwwjizhngqjsjxx
oxxkjaiohrktkyy pyylkbjpislulzz qzzmlckqjtmvmaa raanmdlrkunwnbb sbbonemslvoxocc
tccpofntmwpypdd uddqpgounxqzqee veerqhpvoyrarff wffsriqwpzsbsgg xggtsjrxqatcthh
yhhutksyrbuduii ziivultzscvevjj ajjwvmuatdwfwkk bkkxwnvbuexgxll cllyxowcvfyhymm
dmmzypxdwgziznn ennazqyexhajaoo foobarzfyibkbpp gppcbsagzjclcqq hqqdctbhakdmdrr

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: irreducibleness
Cipher: riivwfxryovmvhh

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: irreducibleness
Cipher: ABAAA BAAAA BAAAA AABAA AAABB BAABB AAABA ABAAA AAAAB ABABA AABAA ABBAA AABAA BAAAB BAAAB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: irreducibleness
cipher variations:
jssfevdjcmfofttzaankjhzeinonddpiivqxlpgevovnnfqqdwlpfiadodxxvyylcztvkwlolhhlggtinxlmstotrrrwwjupfrqkjojllheeradjhsgrorvv
xmmzgrnxuczozffnuuhmfrnwyhohppdccpstvdyupopzztkkxyhztaqxoxjjkttgfwekdngpguuabbolkiafjopoeeqjjwrymqhfwpwoogrrexmqgjbepeyy
wzzmdauwlxmpmiimhhujoymntupusssxxkvqgsrlkpkmmiffsbekithspswwynnahsoyvdapaggovvingsoxzipiqqeddqtuwezvqpqaaullyziaubrypykk
luuhgxfleohqhvvbccpmljbgkpqpffrkkxsznrigxqxpphssfynrhkcfqfzzxaanebvxmynqnjjniivkpznouvqvtttyylwrhtsmlqlnnjggtcfljuitqtxx
zoobitpzwebqbhhpwwjohtpyajqjrrfeeruvxfawrqrbbvmmzajbvcszqzllmvvihygmfpiriwwcddqnmkchlqrqggsllytaosjhyryqqittgzosildgrgaa
ybbofcwynzorokkojjwlqaopvwrwuuuzzmxsiutnmrmookhhudgmkvjuruyyappcjuqaxfcrciiqxxkpiuqzbkrkssgffsvwygbxsrsccwnnabkcwdtaramm
nwwjizhngqjsjxxdeeronldimrsrhhtmmzubptkizszrrjuuhaptjmehshbbzccpgdxzoapspllpkkxmrbpqwxsxvvvaanytjvuonsnppliivehnlwkvsvzz
bqqdkvrbygdsdjjryylqjvraclsltthggtwxzhcytstddxoobcldxeubsbnnoxxkjaiohrktkyyeffspomejnstsiiunnavcquljatasskvvibquknfiticc
addqheyapbqtqmmqllynscqrxytywwwbbozukwvpotoqqmjjwfiomxlwtwaacrrelwsczhetekkszzmrkwsbdmtmuuihhuxyaidzutueeyppcdmeyfvctcoo
pyylkbjpislulzzfggtqpnfkotutjjvoobwdrvmkbubttlwwjcrvlogjujddbeerifzbqcrurnnrmmzotdrsyzuzxxxccpavlxwqpuprrnkkxgjpnymxuxbb
dssfmxtdaifuflltaanslxtcenunvvjiivyzbjeavuvffzqqdenfzgwdudppqzzmlckqjtmvmaaghhurqoglpuvukkwppcxeswnlcvcuumxxkdswmphkvkee
cffsjgacrdsvsoosnnapuestzavayyyddqbwmyxrqvqssollyhkqoznyvyccettgnyuebjgvgmmubbotmyudfovowwkjjwzackfbwvwggarrefogahxeveqq
raanmdlrkunwnbbhiivsrphmqvwvllxqqdyftxomdwdvvnyyletxnqilwlffdggtkhbdsetwtpptoobqvftuabwbzzzeercxnzysrwrttpmmzilrpaozwzdd
fuuhozvfckhwhnnvccpunzvegpwpxxlkkxabdlgcxwxhhbssfgphbiyfwfrrsbbonemslvoxoccijjwtsqinrwxwmmyrrezguypnexewwozzmfuyorjmxmgg
ehhulicetfuxuqquppcrwguvbcxcaaaffsdyoaztsxsuuqnnajmsqbpaxaeegvvipawgdlixioowddqvoawfhqxqyymllybcemhdyxyiicttghqicjzgxgss
tccpofntmwpypddjkkxutrjosxyxnnzssfahvzqofyfxxpaangvzpsknynhhfiivmjdfugvyvrrvqqdsxhvwcdydbbbggtezpbautytvvroobkntrcqbybff
hwwjqbxhemjyjppxeerwpbxgiryrzznmmzcdfniezyzjjduuhirjdkahyhttuddqpgounxqzqeekllyvuskptyzyooattgbiwarpgzgyyqbbohwaqtlozoii
gjjwnkegvhwzwsswrretyiwxdezeccchhufaqcbvuzuwwsppclousdrczcggixxkrcyifnkzkqqyffsxqcyhjszsaaonnadegojfazakkevvijskelbiziuu
veerqhpvoyrarfflmmzwvtlquzazppbuuhcjxbsqhahzzrccpixbrumpapjjhkkxolfhwixaxttxssfuzjxyefafdddiivgbrdcwvavxxtqqdmpvtesdadhh
jyylsdzjgolalrrzggtyrdziktatbbpoobefhpkgbabllfwwjktlfmcjajvvwffsriqwpzsbsggmnnaxwumrvabaqqcvvidkyctribiaasddqjycsvnqbqkk
illypmgixjybyuuyttgvakyzfgbgeeejjwhcsedxwbwyyurrenqwuftebeiikzzmteakhpmbmssahhuzseajlubuccqppcfgiqlhcbcmmgxxklumgndkbkww
xggtsjrxqatcthhnoobyxvnswbcbrrdwwjelzdusjcjbbteerkzdtworcrlljmmzqnhjykzczvvzuuhwblzaghchfffkkxidtfeyxcxzzvssforxvgufcfjj
laanufbliqncnttbiivatfbkmvcvddrqqdghjrmidcdnnhyylmvnhoelclxxyhhutksyrbuduiioppczywotxcdcssexxkfmaevtkdkccuffslaeuxpsdsmm
knnaroikzladawwavvixcmabhidigggllyjeugfzydyaawttgpsywhvgdgkkmbbovgcmjrodouucjjwbugclnwdweesrrehiksnjedeooizzmnwoipfmdmyy
ziivultzscvevjjpqqdazxpuydedttfyylgnbfwulelddvggtmbfvyqtetnnloobspjlambebxxbwwjydnbcijejhhhmmzkfvhgazezbbxuuhqtzxiwhehll
nccpwhdnkspepvvdkkxcvhdmoxexfftssfijltokfefppjaanoxpjqgnenzzajjwvmuatdwfwkkqrrebayqvzefeuugzzmhocgxvmfmeewhhuncgwzrufuoo
mppctqkmbncfcyycxxkzeocdjkfkiiinnalgwihbafaccyvviruayjxifimmoddqxieoltqfqwwellydwienpyfygguttgjkmuplgfgqqkbbopyqkrhofoaa
bkkxwnvbuexgxllrssfcbzrwafgfvvhaanipdhywngnffxiivodhxasvgvppnqqdurlncodgdzzdyylafpdeklgljjjoobmhxjicbgbddzwwjsvbzkyjgjnn
peeryjfpmurgrxxfmmzexjfoqzgzhhvuuhklnvqmhghrrlccpqzrlsipgpbbcllyxowcvfyhymmsttgdcasxbghgwwibbojqeizxohoggyjjwpeiybtwhwqq
orrevsmodpeheaaezzmbgqeflmhmkkkppcniykjdchceeaxxktwcalzkhkooqffszkgqnvshsyygnnafykgprahaiiwvvilmowrnihissmddqrasmtjqhqcc
dmmzypxdwgziznntuuhedbtychihxxjccpkrfjaypiphhzkkxqfjzcuxixrrpssfwtnpeqfifbbfaanchrfgmninlllqqdojzlkedidffbyyluxdbmalilpp
rggtalhrowtitzzhoobgzlhqsbibjjxwwjmnpxsojijttneersbtnukrirddennazqyexhajaoouvvifecuzdijiyykddqlsgkbzqjqiiallyrgkadvyjyss
qttgxuoqfrgjgccgbbodisghnojommmrrepkamlfejeggczzmvyecnbmjmqqshhubmispxujuaaippchamirtcjckkyxxknoqytpkjkuuoffstcuovlsjsee
foobarzfyibkbppvwwjgfdvaejkjzzleermthlcarkrjjbmmzshlbewzkzttruuhyvprgshkhddhccpejthiopkpnnnssfqlbnmgfkfhhdaanwzfdocnknrr
tiivcnjtqyvkvbbjqqdibnjsudkdllzyyloprzuqlklvvpggtudvpwmtktffgppcbsagzjclcqqwxxkhgewbfklkaamffsnuimdbslskkcnnatimcfxalauu
svvizwqshtilieeiddqfkuijpqlqooottgrmconhglgiiebboxagepdolossujjwdokurzwlwcckrrejcoktvelemmazzmpqsavrmlmwwqhhuvewqxnulugg
hqqdctbhakdmdrrxyylihfxcglmlbbnggtovjnectmtlldoobujndgybmbvvtwwjaxrtiujmjffjeerglvjkqrmrpppuuhsndpoihmhjjfccpybhfqepmptt
vkkxeplvsaxmxddlssfkdpluwfmfnnbaanqrtbwsnmnxxriivwfxryovmvhhirreduciblenessyzzmjigydhmnmccohhupwkofdunummeppcvkoehzcncww
uxxkbysujvknkggkffshmwklrsnsqqqvvitoeqpjinikkgddqzcigrfqnquuwllyfqmwtbynyeemttgleqmvxgngoocbborsucxtonoyysjjwxgyszpwnwii

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: irreducibleness
Cipher: veerqhpvoyrarff

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: irreducibleness
Cipher: 422424514154314221135133513434

Extended Methods:
Method #1

Plaintext: irreducibleness
method variations:
owwkizhogqkskxxtbbpoentmvpxpccyggutksyraucuhhdmmzypxdwfzhznn

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
i r r e d u c i b l e n e s s 
4 2 2 5 4 5 3 4 2 1 5 3 5 3 3 
2 4 4 1 1 4 1 2 1 3 1 3 1 4 4 
They are then read out in rows:
422545342153533244114121313144
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: irreducibleness
Cipher: iwysbpphtadbcct

Read more ...
Method #3

Plaintext: irreducibleness
method variations:
giyqvoqgaxlxlot iyqvoqgaxlxlotg yqvoqgaxlxlotgi
qvoqgaxlxlotgiy voqgaxlxlotgiyq oqgaxlxlotgiyqv
qgaxlxlotgiyqvo gaxlxlotgiyqvoq axlxlotgiyqvoqg
xlxlotgiyqvoqga lxlotgiyqvoqgax xlotgiyqvoqgaxl
lotgiyqvoqgaxlx otgiyqvoqgaxlxl tgiyqvoqgaxlxlo

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: irreducibleness

first 5040 cipher variations(1300430725494 total)
irreducibleness irreducibleness irreduciblenses irreduciblensse irreduciblensse irreduciblenses irreducibleenss
irreducibleenss irreducibleesns irreducibleessn irreducibleessn irreducibleesns irreduciblesens irreduciblesesn
irreduciblesnes irreduciblesnse irreduciblessne irreduciblessen irreduciblesesn irreduciblesens irreduciblessen
irreduciblessne irreduciblesnse irreduciblesnes irreduciblneess irreduciblneess irreduciblneses irreduciblnesse
irreduciblnesse irreduciblneses irreduciblneess irreduciblneess irreduciblneses irreduciblnesse irreduciblnesse
irreduciblneses irreduciblnsees irreduciblnsese irreduciblnsees irreduciblnsese irreduciblnssee irreduciblnssee
irreduciblnsese irreduciblnsees irreduciblnssee irreduciblnssee irreduciblnsese irreduciblnsees irreducibleness
irreducibleness irreduciblenses irreduciblensse irreduciblensse irreduciblenses irreducibleenss irreducibleenss
irreducibleesns irreducibleessn irreducibleessn irreducibleesns irreduciblesens irreduciblesesn irreduciblesnes
irreduciblesnse irreduciblessne irreduciblessen irreduciblesesn irreduciblesens irreduciblessen irreduciblessne
irreduciblesnse irreduciblesnes irreduciblsnees irreduciblsnese irreduciblsnees irreduciblsnese irreduciblsnsee
irreduciblsnsee irreduciblsenes irreduciblsense irreduciblseens irreduciblseesn irreduciblsesen irreduciblsesne
irreduciblseens irreduciblseesn irreduciblsenes irreduciblsense irreduciblsesne irreduciblsesen irreduciblsseen
irreduciblssene irreduciblsseen irreduciblssene irreduciblssnee irreduciblssnee irreduciblsnese irreduciblsnees
irreduciblsnsee irreduciblsnsee irreduciblsnese irreduciblsnees irreduciblsense irreduciblsenes irreduciblsesne
irreduciblsesen irreduciblseesn irreduciblseens irreduciblssene irreduciblsseen irreduciblssnee irreduciblssnee
irreduciblssene irreduciblsseen irreduciblseesn irreduciblseens irreduciblsesen irreduciblsesne irreduciblsense
irreduciblsenes irreducibelness irreducibelness irreducibelnses irreducibelnsse irreducibelnsse irreducibelnses
irreducibelenss irreducibelenss irreducibelesns irreducibelessn irreducibelessn irreducibelesns irreducibelsens
irreducibelsesn irreducibelsnes irreducibelsnse irreducibelssne irreducibelssen irreducibelsesn irreducibelsens
irreducibelssen irreducibelssne irreducibelsnse irreducibelsnes irreducibenless irreducibenless irreducibenlses
irreducibenlsse irreducibenlsse irreducibenlses irreducibenelss irreducibenelss irreducibenesls irreducibenessl
irreducibenessl irreducibenesls irreducibensels irreducibensesl irreducibensles irreducibenslse irreducibenssle
irreducibenssel irreducibensesl irreducibensels irreducibenssel irreducibenssle irreducibenslse irreducibensles
irreducibeenlss irreducibeenlss irreducibeensls irreducibeenssl irreducibeenssl irreducibeensls irreducibeelnss
irreducibeelnss irreducibeelsns irreducibeelssn irreducibeelssn irreducibeelsns irreducibeeslns irreducibeeslsn
irreducibeesnls irreducibeesnsl irreducibeessnl irreducibeessln irreducibeeslsn irreducibeeslns irreducibeessln
irreducibeessnl irreducibeesnsl irreducibeesnls irreducibesnels irreducibesnesl irreducibesnles irreducibesnlse
irreducibesnsle irreducibesnsel irreducibesenls irreducibesensl irreducibeselns irreducibeselsn irreducibesesln
irreducibesesnl irreducibeslens irreducibeslesn irreducibeslnes irreducibeslnse irreducibeslsne irreducibeslsen
irreducibesseln irreducibessenl irreducibesslen irreducibesslne irreducibessnle irreducibessnel irreducibesnesl
irreducibesnels irreducibesnsel irreducibesnsle irreducibesnlse irreducibesnles irreducibesensl irreducibesenls
irreducibesesnl irreducibesesln irreducibeselsn irreducibeselns irreducibessenl irreducibesseln irreducibessnel
irreducibessnle irreducibesslne irreducibesslen irreducibeslesn irreducibeslens irreducibeslsen irreducibeslsne
irreducibeslnse irreducibeslnes irreducibneless irreducibneless irreducibnelses irreducibnelsse irreducibnelsse
irreducibnelses irreducibneelss irreducibneelss irreducibneesls irreducibneessl irreducibneessl irreducibneesls
irreducibnesels irreducibnesesl irreducibnesles irreducibneslse irreducibnessle irreducibnessel irreducibnesesl
irreducibnesels irreducibnessel irreducibnessle irreducibneslse irreducibnesles irreducibnleess irreducibnleess
irreducibnleses irreducibnlesse irreducibnlesse irreducibnleses irreducibnleess irreducibnleess irreducibnleses
irreducibnlesse irreducibnlesse irreducibnleses irreducibnlsees irreducibnlsese irreducibnlsees irreducibnlsese
irreducibnlssee irreducibnlssee irreducibnlsese irreducibnlsees irreducibnlssee irreducibnlssee irreducibnlsese
irreducibnlsees irreducibneless irreducibneless irreducibnelses irreducibnelsse irreducibnelsse irreducibnelses
irreducibneelss irreducibneelss irreducibneesls irreducibneessl irreducibneessl irreducibneesls irreducibnesels
irreducibnesesl irreducibnesles irreducibneslse irreducibnessle irreducibnessel irreducibnesesl irreducibnesels
irreducibnessel irreducibnessle irreducibneslse irreducibnesles irreducibnslees irreducibnslese irreducibnslees
irreducibnslese irreducibnslsee irreducibnslsee irreducibnseles irreducibnselse irreducibnseels irreducibnseesl
irreducibnsesel irreducibnsesle irreducibnseels irreducibnseesl irreducibnseles irreducibnselse irreducibnsesle
irreducibnsesel irreducibnsseel irreducibnssele irreducibnsseel irreducibnssele irreducibnsslee irreducibnsslee
irreducibnslese irreducibnslees irreducibnslsee irreducibnslsee irreducibnslese irreducibnslees irreducibnselse
irreducibnseles irreducibnsesle irreducibnsesel irreducibnseesl irreducibnseels irreducibnssele irreducibnsseel
irreducibnsslee irreducibnsslee irreducibnssele irreducibnsseel irreducibnseesl irreducibnseels irreducibnsesel
irreducibnsesle irreducibnselse irreducibnseles irreducibeenlss irreducibeenlss irreducibeensls irreducibeenssl
irreducibeenssl irreducibeensls irreducibeelnss irreducibeelnss irreducibeelsns irreducibeelssn irreducibeelssn
irreducibeelsns irreducibeeslns irreducibeeslsn irreducibeesnls irreducibeesnsl irreducibeessnl irreducibeessln
irreducibeeslsn irreducibeeslns irreducibeessln irreducibeessnl irreducibeesnsl irreducibeesnls irreducibenelss
irreducibenelss irreducibenesls irreducibenessl irreducibenessl irreducibenesls irreducibenless irreducibenless
irreducibenlses irreducibenlsse irreducibenlsse irreducibenlses irreducibensles irreducibenslse irreducibensels
irreducibensesl irreducibenssel irreducibenssle irreducibenslse irreducibensles irreducibenssle irreducibenssel
irreducibensesl irreducibensels irreducibelness irreducibelness irreducibelnses irreducibelnsse irreducibelnsse
irreducibelnses irreducibelenss irreducibelenss irreducibelesns irreducibelessn irreducibelessn irreducibelesns
irreducibelsens irreducibelsesn irreducibelsnes irreducibelsnse irreducibelssne irreducibelssen irreducibelsesn
irreducibelsens irreducibelssen irreducibelssne irreducibelsnse irreducibelsnes irreducibesnles irreducibesnlse
irreducibesnels irreducibesnesl irreducibesnsel irreducibesnsle irreducibeslnes irreducibeslnse irreducibeslens
irreducibeslesn irreducibeslsen irreducibeslsne irreducibeselns irreducibeselsn irreducibesenls irreducibesensl
irreducibesesnl irreducibesesln irreducibesslen irreducibesslne irreducibesseln irreducibessenl irreducibessnel
irreducibessnle irreducibesnlse irreducibesnles irreducibesnsle irreducibesnsel irreducibesnesl irreducibesnels
irreducibeslnse irreducibeslnes irreducibeslsne irreducibeslsen irreducibeslesn irreducibeslens irreducibesslne
irreducibesslen irreducibessnle irreducibessnel irreducibessenl irreducibesseln irreducibeselsn irreducibeselns
irreducibesesln irreducibesesnl irreducibesensl irreducibesenls irreducibsenels irreducibsenesl irreducibsenles
irreducibsenlse irreducibsensle irreducibsensel irreducibseenls irreducibseensl irreducibseelns irreducibseelsn
irreducibseesln irreducibseesnl irreducibselens irreducibselesn irreducibselnes irreducibselnse irreducibselsne
irreducibselsen irreducibseseln irreducibsesenl irreducibseslen irreducibseslne irreducibsesnle irreducibsesnel
irreducibsneels irreducibsneesl irreducibsneles irreducibsnelse irreducibsnesle irreducibsnesel irreducibsneels
irreducibsneesl irreducibsneles irreducibsnelse irreducibsnesle irreducibsnesel irreducibsnlees irreducibsnlese
irreducibsnlees irreducibsnlese irreducibsnlsee irreducibsnlsee irreducibsnsele irreducibsnseel irreducibsnslee
irreducibsnslee irreducibsnsele irreducibsnseel irreducibsenels irreducibsenesl irreducibsenles irreducibsenlse
irreducibsensle irreducibsensel irreducibseenls irreducibseensl irreducibseelns irreducibseelsn irreducibseesln
irreducibseesnl irreducibselens irreducibselesn irreducibselnes irreducibselnse irreducibselsne irreducibselsen
irreducibseseln irreducibsesenl irreducibseslen irreducibseslne irreducibsesnle irreducibsesnel irreducibslnees
irreducibslnese irreducibslnees irreducibslnese irreducibslnsee irreducibslnsee irreducibslenes irreducibslense
irreducibsleens irreducibsleesn irreducibslesen irreducibslesne irreducibsleens irreducibsleesn irreducibslenes
irreducibslense irreducibslesne irreducibslesen irreducibslseen irreducibslsene irreducibslseen irreducibslsene
irreducibslsnee irreducibslsnee irreducibssnele irreducibssneel irreducibssnlee irreducibssnlee irreducibssnele
irreducibssneel irreducibssenle irreducibssenel irreducibsselne irreducibsselen irreducibsseeln irreducibsseenl
irreducibsslene irreducibssleen irreducibsslnee irreducibsslnee irreducibsslene irreducibssleen irreducibsseeln
irreducibsseenl irreducibsselen irreducibsselne irreducibssenle irreducibssenel irreducibsenesl irreducibsenels
irreducibsensel irreducibsensle irreducibsenlse irreducibsenles irreducibseensl irreducibseenls irreducibseesnl
irreducibseesln irreducibseelsn irreducibseelns irreducibsesenl irreducibseseln irreducibsesnel irreducibsesnle
irreducibseslne irreducibseslen irreducibselesn irreducibselens irreducibselsen irreducibselsne irreducibselnse
irreducibselnes irreducibsneesl irreducibsneels irreducibsnesel irreducibsnesle irreducibsnelse irreducibsneles
irreducibsneesl irreducibsneels irreducibsnesel irreducibsnesle irreducibsnelse irreducibsneles irreducibsnseel
irreducibsnsele irreducibsnseel irreducibsnsele irreducibsnslee irreducibsnslee irreducibsnlese irreducibsnlees
irreducibsnlsee irreducibsnlsee irreducibsnlese irreducibsnlees irreducibsenesl irreducibsenels irreducibsensel
irreducibsensle irreducibsenlse irreducibsenles irreducibseensl irreducibseenls irreducibseesnl irreducibseesln
irreducibseelsn irreducibseelns irreducibsesenl irreducibseseln irreducibsesnel irreducibsesnle irreducibseslne
irreducibseslen irreducibselesn irreducibselens irreducibselsen irreducibselsne irreducibselnse irreducibselnes
irreducibssneel irreducibssnele irreducibssneel irreducibssnele irreducibssnlee irreducibssnlee irreducibssenel
irreducibssenle irreducibsseenl irreducibsseeln irreducibsselen irreducibsselne irreducibsseenl irreducibsseeln
irreducibssenel irreducibssenle irreducibsselne irreducibsselen irreducibssleen irreducibsslene irreducibssleen
irreducibsslene irreducibsslnee irreducibsslnee irreducibslnese irreducibslnees irreducibslnsee irreducibslnsee
irreducibslnese irreducibslnees irreducibslense irreducibslenes irreducibslesne irreducibslesen irreducibsleesn
irreducibsleens irreducibslsene irreducibslseen irreducibslsnee irreducibslsnee irreducibslsene irreducibslseen
irreducibsleesn irreducibsleens irreducibslesen irreducibslesne irreducibslense irreducibslenes irreducilbeness
irreducilbeness irreducilbenses irreducilbensse irreducilbensse irreducilbenses irreducilbeenss irreducilbeenss
irreducilbeesns irreducilbeessn irreducilbeessn irreducilbeesns irreducilbesens irreducilbesesn irreducilbesnes
irreducilbesnse irreducilbessne irreducilbessen irreducilbesesn irreducilbesens irreducilbessen irreducilbessne
irreducilbesnse irreducilbesnes irreducilbneess irreducilbneess irreducilbneses irreducilbnesse irreducilbnesse
irreducilbneses irreducilbneess irreducilbneess irreducilbneses irreducilbnesse irreducilbnesse irreducilbneses
irreducilbnsees irreducilbnsese irreducilbnsees irreducilbnsese irreducilbnssee irreducilbnssee irreducilbnsese
irreducilbnsees irreducilbnssee irreducilbnssee irreducilbnsese irreducilbnsees irreducilbeness irreducilbeness
irreducilbenses irreducilbensse irreducilbensse irreducilbenses irreducilbeenss irreducilbeenss irreducilbeesns
irreducilbeessn irreducilbeessn irreducilbeesns irreducilbesens irreducilbesesn irreducilbesnes irreducilbesnse
irreducilbessne irreducilbessen irreducilbesesn irreducilbesens irreducilbessen irreducilbessne irreducilbesnse
irreducilbesnes irreducilbsnees irreducilbsnese irreducilbsnees irreducilbsnese irreducilbsnsee irreducilbsnsee
irreducilbsenes irreducilbsense irreducilbseens irreducilbseesn irreducilbsesen irreducilbsesne irreducilbseens
irreducilbseesn irreducilbsenes irreducilbsense irreducilbsesne irreducilbsesen irreducilbsseen irreducilbssene
irreducilbsseen irreducilbssene irreducilbssnee irreducilbssnee irreducilbsnese irreducilbsnees irreducilbsnsee
irreducilbsnsee irreducilbsnese irreducilbsnees irreducilbsense irreducilbsenes irreducilbsesne irreducilbsesen
irreducilbseesn irreducilbseens irreducilbssene irreducilbsseen irreducilbssnee irreducilbssnee irreducilbssene
irreducilbsseen irreducilbseesn irreducilbseens irreducilbsesen irreducilbsesne irreducilbsense irreducilbsenes
irreducilebness irreducilebness irreducilebnses irreducilebnsse irreducilebnsse irreducilebnses irreducilebenss
irreducilebenss irreducilebesns irreducilebessn irreducilebessn irreducilebesns irreducilebsens irreducilebsesn
irreducilebsnes irreducilebsnse irreducilebssne irreducilebssen irreducilebsesn irreducilebsens irreducilebssen
irreducilebssne irreducilebsnse irreducilebsnes irreducilenbess irreducilenbess irreducilenbses irreducilenbsse
irreducilenbsse irreducilenbses irreducilenebss irreducilenebss irreducilenesbs irreducilenessb irreducilenessb
irreducilenesbs irreducilensebs irreducilensesb irreducilensbes irreducilensbse irreducilenssbe irreducilensseb
irreducilensesb irreducilensebs irreducilensseb irreducilenssbe irreducilensbse irreducilensbes irreducileenbss
irreducileenbss irreducileensbs irreducileenssb irreducileenssb irreducileensbs irreducileebnss irreducileebnss
irreducileebsns irreducileebssn irreducileebssn irreducileebsns irreducileesbns irreducileesbsn irreducileesnbs
irreducileesnsb irreducileessnb irreducileessbn irreducileesbsn irreducileesbns irreducileessbn irreducileessnb
irreducileesnsb irreducileesnbs irreducilesnebs irreducilesnesb irreducilesnbes irreducilesnbse irreducilesnsbe
irreducilesnseb irreducilesenbs irreducilesensb irreducilesebns irreducilesebsn irreducilesesbn irreducilesesnb
irreducilesbens irreducilesbesn irreducilesbnes irreducilesbnse irreducilesbsne irreducilesbsen irreducilessebn
irreducilessenb irreducilessben irreducilessbne irreducilessnbe irreducilessneb irreducilesnesb irreducilesnebs
irreducilesnseb irreducilesnsbe irreducilesnbse irreducilesnbes irreducilesensb irreducilesenbs irreducilesesnb
irreducilesesbn irreducilesebsn irreducilesebns irreducilessenb irreducilessebn irreducilessneb irreducilessnbe
irreducilessbne irreducilessben irreducilesbesn irreducilesbens irreducilesbsen irreducilesbsne irreducilesbnse
irreducilesbnes irreducilnebess irreducilnebess irreducilnebses irreducilnebsse irreducilnebsse irreducilnebses
irreducilneebss irreducilneebss irreducilneesbs irreducilneessb irreducilneessb irreducilneesbs irreducilnesebs
irreducilnesesb irreducilnesbes irreducilnesbse irreducilnessbe irreducilnesseb irreducilnesesb irreducilnesebs
irreducilnesseb irreducilnessbe irreducilnesbse irreducilnesbes irreducilnbeess irreducilnbeess irreducilnbeses
irreducilnbesse irreducilnbesse irreducilnbeses irreducilnbeess irreducilnbeess irreducilnbeses irreducilnbesse
irreducilnbesse irreducilnbeses irreducilnbsees irreducilnbsese irreducilnbsees irreducilnbsese irreducilnbssee
irreducilnbssee irreducilnbsese irreducilnbsees irreducilnbssee irreducilnbssee irreducilnbsese irreducilnbsees
irreducilnebess irreducilnebess irreducilnebses irreducilnebsse irreducilnebsse irreducilnebses irreducilneebss
irreducilneebss irreducilneesbs irreducilneessb irreducilneessb irreducilneesbs irreducilnesebs irreducilnesesb
irreducilnesbes irreducilnesbse irreducilnessbe irreducilnesseb irreducilnesesb irreducilnesebs irreducilnesseb
irreducilnessbe irreducilnesbse irreducilnesbes irreducilnsbees irreducilnsbese irreducilnsbees irreducilnsbese
irreducilnsbsee irreducilnsbsee irreducilnsebes irreducilnsebse irreducilnseebs irreducilnseesb irreducilnseseb
irreducilnsesbe irreducilnseebs irreducilnseesb irreducilnsebes irreducilnsebse irreducilnsesbe irreducilnseseb
irreducilnsseeb irreducilnssebe irreducilnsseeb irreducilnssebe irreducilnssbee irreducilnssbee irreducilnsbese
irreducilnsbees irreducilnsbsee irreducilnsbsee irreducilnsbese irreducilnsbees irreducilnsebse irreducilnsebes
irreducilnsesbe irreducilnseseb irreducilnseesb irreducilnseebs irreducilnssebe irreducilnsseeb irreducilnssbee
irreducilnssbee irreducilnssebe irreducilnsseeb irreducilnseesb irreducilnseebs irreducilnseseb irreducilnsesbe
irreducilnsebse irreducilnsebes irreducileenbss irreducileenbss irreducileensbs irreducileenssb irreducileenssb
irreducileensbs irreducileebnss irreducileebnss irreducileebsns irreducileebssn irreducileebssn irreducileebsns
irreducileesbns irreducileesbsn irreducileesnbs irreducileesnsb irreducileessnb irreducileessbn irreducileesbsn
irreducileesbns irreducileessbn irreducileessnb irreducileesnsb irreducileesnbs irreducilenebss irreducilenebss
irreducilenesbs irreducilenessb irreducilenessb irreducilenesbs irreducilenbess irreducilenbess irreducilenbses
irreducilenbsse irreducilenbsse irreducilenbses irreducilensbes irreducilensbse irreducilensebs irreducilensesb
irreducilensseb irreducilenssbe irreducilensbse irreducilensbes irreducilenssbe irreducilensseb irreducilensesb
irreducilensebs irreducilebness irreducilebness irreducilebnses irreducilebnsse irreducilebnsse irreducilebnses
irreducilebenss irreducilebenss irreducilebesns irreducilebessn irreducilebessn irreducilebesns irreducilebsens
irreducilebsesn irreducilebsnes irreducilebsnse irreducilebssne irreducilebssen irreducilebsesn irreducilebsens
irreducilebssen irreducilebssne irreducilebsnse irreducilebsnes irreducilesnbes irreducilesnbse irreducilesnebs
irreducilesnesb irreducilesnseb irreducilesnsbe irreducilesbnes irreducilesbnse irreducilesbens irreducilesbesn
irreducilesbsen irreducilesbsne irreducilesebns irreducilesebsn irreducilesenbs irreducilesensb irreducilesesnb
irreducilesesbn irreducilessben irreducilessbne irreducilessebn irreducilessenb irreducilessneb irreducilessnbe
irreducilesnbse irreducilesnbes irreducilesnsbe irreducilesnseb irreducilesnesb irreducilesnebs irreducilesbnse
irreducilesbnes irreducilesbsne irreducilesbsen irreducilesbesn irreducilesbens irreducilessbne irreducilessben
irreducilessnbe irreducilessneb irreducilessenb irreducilessebn irreducilesebsn irreducilesebns irreducilesesbn
irreducilesesnb irreducilesensb irreducilesenbs irreducilsenebs irreducilsenesb irreducilsenbes irreducilsenbse
irreducilsensbe irreducilsenseb irreducilseenbs irreducilseensb irreducilseebns irreducilseebsn irreducilseesbn
irreducilseesnb irreducilsebens irreducilsebesn irreducilsebnes irreducilsebnse irreducilsebsne irreducilsebsen
irreducilsesebn irreducilsesenb irreducilsesben irreducilsesbne irreducilsesnbe irreducilsesneb irreducilsneebs
irreducilsneesb irreducilsnebes irreducilsnebse irreducilsnesbe irreducilsneseb irreducilsneebs irreducilsneesb
irreducilsnebes irreducilsnebse irreducilsnesbe irreducilsneseb irreducilsnbees irreducilsnbese irreducilsnbees
irreducilsnbese irreducilsnbsee irreducilsnbsee irreducilsnsebe irreducilsnseeb irreducilsnsbee irreducilsnsbee
irreducilsnsebe irreducilsnseeb irreducilsenebs irreducilsenesb irreducilsenbes irreducilsenbse irreducilsensbe
irreducilsenseb irreducilseenbs irreducilseensb irreducilseebns irreducilseebsn irreducilseesbn irreducilseesnb
irreducilsebens irreducilsebesn irreducilsebnes irreducilsebnse irreducilsebsne irreducilsebsen irreducilsesebn
irreducilsesenb irreducilsesben irreducilsesbne irreducilsesnbe irreducilsesneb irreducilsbnees irreducilsbnese
irreducilsbnees irreducilsbnese irreducilsbnsee irreducilsbnsee irreducilsbenes irreducilsbense irreducilsbeens
irreducilsbeesn irreducilsbesen irreducilsbesne irreducilsbeens irreducilsbeesn irreducilsbenes irreducilsbense
irreducilsbesne irreducilsbesen irreducilsbseen irreducilsbsene irreducilsbseen irreducilsbsene irreducilsbsnee
irreducilsbsnee irreducilssnebe irreducilssneeb irreducilssnbee irreducilssnbee irreducilssnebe irreducilssneeb
irreducilssenbe irreducilsseneb irreducilssebne irreducilsseben irreducilsseebn irreducilsseenb irreducilssbene
irreducilssbeen irreducilssbnee irreducilssbnee irreducilssbene irreducilssbeen irreducilsseebn irreducilsseenb
irreducilsseben irreducilssebne irreducilssenbe irreducilsseneb irreducilsenesb irreducilsenebs irreducilsenseb
irreducilsensbe irreducilsenbse irreducilsenbes irreducilseensb irreducilseenbs irreducilseesnb irreducilseesbn
irreducilseebsn irreducilseebns irreducilsesenb irreducilsesebn irreducilsesneb irreducilsesnbe irreducilsesbne
irreducilsesben irreducilsebesn irreducilsebens irreducilsebsen irreducilsebsne irreducilsebnse irreducilsebnes
irreducilsneesb irreducilsneebs irreducilsneseb irreducilsnesbe irreducilsnebse irreducilsnebes irreducilsneesb
irreducilsneebs irreducilsneseb irreducilsnesbe irreducilsnebse irreducilsnebes irreducilsnseeb irreducilsnsebe
irreducilsnseeb irreducilsnsebe irreducilsnsbee irreducilsnsbee irreducilsnbese irreducilsnbees irreducilsnbsee
irreducilsnbsee irreducilsnbese irreducilsnbees irreducilsenesb irreducilsenebs irreducilsenseb irreducilsensbe
irreducilsenbse irreducilsenbes irreducilseensb irreducilseenbs irreducilseesnb irreducilseesbn irreducilseebsn
irreducilseebns irreducilsesenb irreducilsesebn irreducilsesneb irreducilsesnbe irreducilsesbne irreducilsesben
irreducilsebesn irreducilsebens irreducilsebsen irreducilsebsne irreducilsebnse irreducilsebnes irreducilssneeb
irreducilssnebe irreducilssneeb irreducilssnebe irreducilssnbee irreducilssnbee irreducilsseneb irreducilssenbe
irreducilsseenb irreducilsseebn irreducilsseben irreducilssebne irreducilsseenb irreducilsseebn irreducilsseneb
irreducilssenbe irreducilssebne irreducilsseben irreducilssbeen irreducilssbene irreducilssbeen irreducilssbene
irreducilssbnee irreducilssbnee irreducilsbnese irreducilsbnees irreducilsbnsee irreducilsbnsee irreducilsbnese
irreducilsbnees irreducilsbense irreducilsbenes irreducilsbesne irreducilsbesen irreducilsbeesn irreducilsbeens
irreducilsbsene irreducilsbseen irreducilsbsnee irreducilsbsnee irreducilsbsene irreducilsbseen irreducilsbeesn
irreducilsbeens irreducilsbesen irreducilsbesne irreducilsbense irreducilsbenes irreducielbness irreducielbness
irreducielbnses irreducielbnsse irreducielbnsse irreducielbnses irreducielbenss irreducielbenss irreducielbesns
irreducielbessn irreducielbessn irreducielbesns irreducielbsens irreducielbsesn irreducielbsnes irreducielbsnse
irreducielbssne irreducielbssen irreducielbsesn irreducielbsens irreducielbssen irreducielbssne irreducielbsnse
irreducielbsnes irreducielnbess irreducielnbess irreducielnbses irreducielnbsse irreducielnbsse irreducielnbses
irreducielnebss irreducielnebss irreducielnesbs irreducielnessb irreducielnessb irreducielnesbs irreducielnsebs
irreducielnsesb irreducielnsbes irreducielnsbse irreducielnssbe irreducielnsseb irreducielnsesb irreducielnsebs
irreducielnsseb irreducielnssbe irreducielnsbse irreducielnsbes irreducielenbss irreducielenbss irreducielensbs
irreducielenssb irreducielenssb irreducielensbs irreducielebnss irreducielebnss irreducielebsns irreducielebssn
irreducielebssn irreducielebsns irreducielesbns irreducielesbsn irreducielesnbs irreducielesnsb irreducielessnb
irreducielessbn irreducielesbsn irreducielesbns irreducielessbn irreducielessnb irreducielesnsb irreducielesnbs
irreducielsnebs irreducielsnesb irreducielsnbes irreducielsnbse irreducielsnsbe irreducielsnseb irreducielsenbs
irreducielsensb irreducielsebns irreducielsebsn irreducielsesbn irreducielsesnb irreducielsbens irreducielsbesn
irreducielsbnes irreducielsbnse irreducielsbsne irreducielsbsen irreducielssebn irreducielssenb irreducielssben
irreducielssbne irreducielssnbe irreducielssneb irreducielsnesb irreducielsnebs irreducielsnseb irreducielsnsbe
irreducielsnbse irreducielsnbes irreducielsensb irreducielsenbs irreducielsesnb irreducielsesbn irreducielsebsn
irreducielsebns irreducielssenb irreducielssebn irreducielssneb irreducielssnbe irreducielssbne irreducielssben
irreducielsbesn irreducielsbens irreducielsbsen irreducielsbsne irreducielsbnse irreducielsbnes irreducieblness
irreducieblness irreducieblnses irreducieblnsse irreducieblnsse irreducieblnses irreducieblenss irreducieblenss
irreducieblesns irreducieblessn irreducieblessn irreducieblesns irreducieblsens irreducieblsesn irreducieblsnes
irreducieblsnse irreducieblssne irreducieblssen irreducieblsesn irreducieblsens irreducieblssen irreducieblssne
irreducieblsnse irreducieblsnes irreduciebnless irreduciebnless irreduciebnlses irreduciebnlsse irreduciebnlsse
irreduciebnlses irreduciebnelss irreduciebnelss irreduciebnesls irreduciebnessl irreduciebnessl irreduciebnesls
irreduciebnsels irreduciebnsesl irreduciebnsles irreduciebnslse irreduciebnssle irreduciebnssel irreduciebnsesl
irreduciebnsels irreduciebnssel irreduciebnssle irreduciebnslse irreduciebnsles irreduciebenlss irreduciebenlss
irreduciebensls irreduciebenssl irreduciebenssl irreduciebensls irreduciebelnss irreduciebelnss irreduciebelsns
irreduciebelssn irreduciebelssn irreduciebelsns irreduciebeslns irreduciebeslsn irreduciebesnls irreduciebesnsl
irreduciebessnl irreduciebessln irreduciebeslsn irreduciebeslns irreduciebessln irreduciebessnl irreduciebesnsl
irreduciebesnls irreduciebsnels irreduciebsnesl irreduciebsnles irreduciebsnlse irreduciebsnsle irreduciebsnsel
irreduciebsenls irreduciebsensl irreduciebselns irreduciebselsn irreduciebsesln irreduciebsesnl irreduciebslens
irreduciebslesn irreduciebslnes irreduciebslnse irreduciebslsne irreduciebslsen irreduciebsseln irreduciebssenl
irreduciebsslen irreduciebsslne irreduciebssnle irreduciebssnel irreduciebsnesl irreduciebsnels irreduciebsnsel
irreduciebsnsle irreduciebsnlse irreduciebsnles irreduciebsensl irreduciebsenls irreduciebsesnl irreduciebsesln
irreduciebselsn irreduciebselns irreduciebssenl irreduciebsseln irreduciebssnel irreduciebssnle irreduciebsslne
irreduciebsslen irreduciebslesn irreduciebslens irreduciebslsen irreduciebslsne irreduciebslnse irreduciebslnes
irreducienbless irreducienbless irreducienblses irreducienblsse irreducienblsse irreducienblses irreducienbelss
irreducienbelss irreducienbesls irreducienbessl irreducienbessl irreducienbesls irreducienbsels irreducienbsesl
irreducienbsles irreducienbslse irreducienbssle irreducienbssel irreducienbsesl irreducienbsels irreducienbssel
irreducienbssle irreducienbslse irreducienbsles irreducienlbess irreducienlbess irreducienlbses irreducienlbsse
irreducienlbsse irreducienlbses irreducienlebss irreducienlebss irreducienlesbs irreducienlessb irreducienlessb
irreducienlesbs irreducienlsebs irreducienlsesb irreducienlsbes irreducienlsbse irreducienlssbe irreducienlsseb
irreducienlsesb irreducienlsebs irreducienlsseb irreducienlssbe irreducienlsbse irreducienlsbes irreducienelbss
irreducienelbss irreducienelsbs irreducienelssb irreducienelssb irreducienelsbs irreducieneblss irreducieneblss
irreducienebsls irreducienebssl irreducienebssl irreducienebsls irreducienesbls irreducienesbsl irreducieneslbs
irreducieneslsb irreducienesslb irreducienessbl irreducienesbsl irreducienesbls irreducienessbl irreducienesslb
irreducieneslsb irreducieneslbs irreducienslebs irreducienslesb irreducienslbes irreducienslbse irreducienslsbe
irreducienslseb irreducienselbs irreducienselsb irreduciensebls irreduciensebsl irreduciensesbl irreducienseslb
irreduciensbels irreduciensbesl irreduciensbles irreduciensblse irreduciensbsle irreduciensbsel irreducienssebl
irreduciensselb irreducienssbel irreducienssble irreduciensslbe irreducienssleb irreducienslesb irreducienslebs
irreducienslseb irreducienslsbe irreducienslbse irreducienslbes irreducienselsb irreducienselbs irreducienseslb
irreduciensesbl irreduciensebsl irreduciensebls irreduciensselb irreducienssebl irreducienssleb irreduciensslbe
irreducienssble irreducienssbel irreduciensbesl irreduciensbels irreduciensbsel irreduciensbsle irreduciensblse
irreduciensbles irreducieebnlss irreducieebnlss irreducieebnsls irreducieebnssl irreducieebnssl irreducieebnsls
irreducieeblnss irreducieeblnss irreducieeblsns irreducieeblssn irreducieeblssn irreducieeblsns irreducieebslns
irreducieebslsn irreducieebsnls irreducieebsnsl irreducieebssnl irreducieebssln irreducieebslsn irreducieebslns
irreducieebssln irreducieebssnl irreducieebsnsl irreducieebsnls irreducieenblss irreducieenblss irreducieenbsls
irreducieenbssl irreducieenbssl irreducieenbsls irreducieenlbss irreducieenlbss irreducieenlsbs irreducieenlssb
irreducieenlssb irreducieenlsbs irreducieenslbs irreducieenslsb irreducieensbls irreducieensbsl irreducieenssbl
irreducieensslb irreducieenslsb irreducieenslbs irreducieensslb irreducieenssbl irreducieensbsl irreducieensbls
irreducieelnbss irreducieelnbss irreducieelnsbs irreducieelnssb irreducieelnssb irreducieelnsbs irreducieelbnss
irreducieelbnss irreducieelbsns irreducieelbssn irreducieelbssn irreducieelbsns irreducieelsbns irreducieelsbsn
irreducieelsnbs irreducieelsnsb irreducieelssnb irreducieelssbn irreducieelsbsn irreducieelsbns irreducieelssbn
irreducieelssnb irreducieelsnsb irreducieelsnbs irreducieesnlbs irreducieesnlsb irreducieesnbls irreducieesnbsl
irreducieesnsbl irreducieesnslb irreducieeslnbs irreducieeslnsb irreducieeslbns irreducieeslbsn irreducieeslsbn
irreducieeslsnb irreducieesblns irreducieesblsn irreducieesbnls irreducieesbnsl irreducieesbsnl irreducieesbsln
irreducieesslbn irreducieesslnb irreducieessbln irreducieessbnl irreducieessnbl irreducieessnlb irreducieesnlsb
irreducieesnlbs irreducieesnslb irreducieesnsbl irreducieesnbsl irreducieesnbls irreducieeslnsb irreducieeslnbs
irreducieeslsnb irreducieeslsbn irreducieeslbsn irreducieeslbns irreducieesslnb irreducieesslbn irreducieessnlb
irreducieessnbl irreducieessbnl irreducieessbln irreducieesblsn irreducieesblns irreducieesbsln irreducieesbsnl
irreducieesbnsl irreducieesbnls irreduciesbnels irreduciesbnesl irreduciesbnles irreduciesbnlse irreduciesbnsle
irreduciesbnsel irreduciesbenls irreduciesbensl irreduciesbelns irreduciesbelsn irreduciesbesln irreduciesbesnl
irreduciesblens irreduciesblesn irreduciesblnes irreduciesblnse irreduciesblsne irreduciesblsen irreduciesbseln
irreduciesbsenl irreduciesbslen irreduciesbslne irreduciesbsnle irreduciesbsnel irreduciesnbels irreduciesnbesl
irreduciesnbles irreduciesnblse irreduciesnbsle irreduciesnbsel irreduciesnebls irreduciesnebsl irreduciesnelbs
irreduciesnelsb irreduciesneslb irreduciesnesbl irreduciesnlebs irreduciesnlesb irreduciesnlbes irreduciesnlbse
irreduciesnlsbe irreduciesnlseb irreduciesnselb irreduciesnsebl irreduciesnsleb irreduciesnslbe irreduciesnsble
irreduciesnsbel irreduciesenbls irreduciesenbsl irreduciesenlbs irreduciesenlsb irreduciesenslb irreduciesensbl
irreduciesebnls irreduciesebnsl irreducieseblns irreducieseblsn irreduciesebsln irreduciesebsnl irreducieselbns
irreducieselbsn irreducieselnbs irreducieselnsb irreducieselsnb irreducieselsbn irreduciesesbln irreduciesesbnl
irreducieseslbn irreducieseslnb irreduciesesnlb irreduciesesnbl irreducieslnebs irreducieslnesb irreducieslnbes
irreducieslnbse irreducieslnsbe irreducieslnseb irreducieslenbs irreducieslensb irreducieslebns irreducieslebsn
irreducieslesbn irreducieslesnb irreducieslbens irreducieslbesn irreducieslbnes irreducieslbnse irreducieslbsne
irreducieslbsen irreducieslsebn irreducieslsenb irreducieslsben irreducieslsbne irreducieslsnbe irreducieslsneb
irreduciessnelb irreduciessnebl irreduciessnleb irreduciessnlbe irreduciessnble irreduciessnbel irreduciessenlb
irreduciessenbl irreduciesselnb irreduciesselbn irreduciessebln irreduciessebnl irreduciesslenb irreduciesslebn
irreduciesslneb irreduciesslnbe irreduciesslbne irreduciesslben irreduciessbeln irreduciessbenl irreduciessblen
irreduciessblne irreduciessbnle irreduciessbnel irreduciesbnesl irreduciesbnels irreduciesbnsel irreduciesbnsle
irreduciesbnlse irreduciesbnles irreduciesbensl irreduciesbenls irreduciesbesnl irreduciesbesln irreduciesbelsn
irreduciesbelns irreduciesbsenl irreduciesbseln irreduciesbsnel irreduciesbsnle irreduciesbslne irreduciesbslen
irreduciesblesn irreduciesblens irreduciesblsen irreduciesblsne irreduciesblnse irreduciesblnes irreduciesnbesl
irreduciesnbels irreduciesnbsel irreduciesnbsle irreduciesnblse irreduciesnbles irreduciesnebsl irreduciesnebls
irreduciesnesbl irreduciesneslb irreduciesnelsb irreduciesnelbs irreduciesnsebl irreduciesnselb irreduciesnsbel
irreduciesnsble irreduciesnslbe irreduciesnsleb irreduciesnlesb irreduciesnlebs irreduciesnlseb irreduciesnlsbe
irreduciesnlbse irreduciesnlbes irreduciesenbsl irreduciesenbls irreduciesensbl irreduciesenslb irreduciesenlsb
irreduciesenlbs irreduciesebnsl irreduciesebnls irreduciesebsnl irreduciesebsln irreducieseblsn irreducieseblns
irreduciesesbnl irreduciesesbln irreduciesesnbl irreduciesesnlb irreducieseslnb irreducieseslbn irreducieselbsn
irreducieselbns irreducieselsbn irreducieselsnb irreducieselnsb irreducieselnbs irreduciessnebl irreduciessnelb
irreduciessnbel irreduciessnble irreduciessnlbe irreduciessnleb irreduciessenbl irreduciessenlb irreduciessebnl
irreduciessebln irreduciesselbn irreduciesselnb irreduciessbenl irreduciessbeln irreduciessbnel irreduciessbnle
irreduciessblne irreduciessblen irreduciesslebn irreduciesslenb irreduciesslben irreduciesslbne irreduciesslnbe
irreduciesslneb irreducieslnesb irreducieslnebs irreducieslnseb irreducieslnsbe irreducieslnbse irreducieslnbes
irreducieslensb irreducieslenbs irreducieslesnb irreducieslesbn irreducieslebsn irreducieslebns irreducieslsenb
irreducieslsebn irreducieslsneb irreducieslsnbe irreducieslsbne irreducieslsben irreducieslbesn irreducieslbens
irreducieslbsen irreducieslbsne irreducieslbnse irreducieslbnes irreducinlebess irreducinlebess irreducinlebses
irreducinlebsse irreducinlebsse irreducinlebses irreducinleebss irreducinleebss irreducinleesbs irreducinleessb
irreducinleessb irreducinleesbs irreducinlesebs irreducinlesesb irreducinlesbes irreducinlesbse irreducinlessbe
irreducinlesseb irreducinlesesb irreducinlesebs irreducinlesseb irreducinlessbe irreducinlesbse irreducinlesbes
irreducinlbeess irreducinlbeess irreducinlbeses irreducinlbesse irreducinlbesse irreducinlbeses irreducinlbeess
irreducinlbeess irreducinlbeses irreducinlbesse irreducinlbesse irreducinlbeses irreducinlbsees irreducinlbsese
irreducinlbsees irreducinlbsese irreducinlbssee irreducinlbssee irreducinlbsese irreducinlbsees irreducinlbssee
irreducinlbssee irreducinlbsese irreducinlbsees irreducinlebess irreducinlebess irreducinlebses irreducinlebsse
irreducinlebsse irreducinlebses irreducinleebss irreducinleebss irreducinleesbs irreducinleessb irreducinleessb
irreducinleesbs irreducinlesebs irreducinlesesb irreducinlesbes irreducinlesbse irreducinlessbe irreducinlesseb
irreducinlesesb irreducinlesebs irreducinlesseb irreducinlessbe irreducinlesbse irreducinlesbes irreducinlsbees
irreducinlsbese irreducinlsbees irreducinlsbese irreducinlsbsee irreducinlsbsee irreducinlsebes irreducinlsebse
irreducinlseebs irreducinlseesb irreducinlseseb irreducinlsesbe irreducinlseebs irreducinlseesb irreducinlsebes
irreducinlsebse irreducinlsesbe irreducinlseseb irreducinlsseeb irreducinlssebe irreducinlsseeb irreducinlssebe
irreducinlssbee irreducinlssbee irreducinlsbese irreducinlsbees irreducinlsbsee irreducinlsbsee irreducinlsbese
irreducinlsbees irreducinlsebse irreducinlsebes irreducinlsesbe irreducinlseseb irreducinlseesb irreducinlseebs
irreducinlssebe irreducinlsseeb irreducinlssbee irreducinlssbee irreducinlssebe irreducinlsseeb irreducinlseesb
irreducinlseebs irreducinlseseb irreducinlsesbe irreducinlsebse irreducinlsebes irreducinelbess irreducinelbess
irreducinelbses irreducinelbsse irreducinelbsse irreducinelbses irreducinelebss irreducinelebss irreducinelesbs
irreducinelessb irreducinelessb irreducinelesbs irreducinelsebs irreducinelsesb irreducinelsbes irreducinelsbse
irreducinelssbe irreducinelsseb irreducinelsesb irreducinelsebs irreducinelsseb irreducinelssbe irreducinelsbse
irreducinelsbes irreducinebless irreducinebless irreducineblses irreducineblsse irreducineblsse irreducineblses
irreducinebelss irreducinebelss irreducinebesls irreducinebessl irreducinebessl irreducinebesls irreducinebsels
irreducinebsesl irreducinebsles irreducinebslse irreducinebssle irreducinebssel irreducinebsesl irreducinebsels
irreducinebssel irreducinebssle irreducinebslse irreducinebsles irreducineeblss irreducineeblss irreducineebsls
irreducineebssl irreducineebssl irreducineebsls irreducineelbss irreducineelbss irreducineelsbs irreducineelssb
irreducineelssb irreducineelsbs irreducineeslbs irreducineeslsb irreducineesbls irreducineesbsl irreducineessbl
irreducineesslb irreducineeslsb irreducineeslbs irreducineesslb irreducineessbl irreducineesbsl irreducineesbls
irreducinesbels irreducinesbesl irreducinesbles irreducinesblse irreducinesbsle irreducinesbsel irreducinesebls
irreducinesebsl irreducineselbs irreducineselsb irreducineseslb irreducinesesbl irreducineslebs irreducineslesb
irreducineslbes irreducineslbse irreducineslsbe irreducineslseb irreducinesselb irreducinessebl irreducinessleb
irreducinesslbe irreducinessble irreducinessbel irreducinesbesl irreducinesbels irreducinesbsel irreducinesbsle
irreducinesblse irreducinesbles irreducinesebsl irreducinesebls irreducinesesbl irreducineseslb irreducineselsb
irreducineselbs irreducinessebl irreducinesselb irreducinessbel irreducinessble irreducinesslbe irreducinessleb
irreducineslesb irreducineslebs irreducineslseb irreducineslsbe irreducineslbse irreducineslbes irreducinbeless
irreducinbeless irreducinbelses irreducinbelsse irreducinbelsse irreducinbelses irreducinbeelss irreducinbeelss
irreducinbeesls irreducinbeessl irreducinbeessl irreducinbeesls irreducinbesels irreducinbesesl irreducinbesles
irreducinbeslse irreducinbessle irreducinbessel irreducinbesesl irreducinbesels irreducinbessel irreducinbessle
irreducinbeslse irreducinbesles irreducinbleess irreducinbleess irreducinbleses irreducinblesse irreducinblesse
irreducinbleses irreducinbleess irreducinbleess irreducinbleses irreducinblesse irreducinblesse irreducinbleses
irreducinblsees irreducinblsese irreducinblsees irreducinblsese irreducinblssee irreducinblssee irreducinblsese
irreducinblsees irreducinblssee irreducinblssee irreducinblsese irreducinblsees irreducinbeless irreducinbeless
irreducinbelses irreducinbelsse irreducinbelsse irreducinbelses irreducinbeelss irreducinbeelss irreducinbeesls
irreducinbeessl irreducinbeessl irreducinbeesls irreducinbesels irreducinbesesl irreducinbesles irreducinbeslse
irreducinbessle irreducinbessel irreducinbesesl irreducinbesels irreducinbessel irreducinbessle irreducinbeslse
irreducinbesles irreducinbslees irreducinbslese irreducinbslees irreducinbslese irreducinbslsee irreducinbslsee
irreducinbseles irreducinbselse irreducinbseels irreducinbseesl irreducinbsesel irreducinbsesle irreducinbseels
irreducinbseesl irreducinbseles irreducinbselse irreducinbsesle irreducinbsesel irreducinbsseel irreducinbssele
irreducinbsseel irreducinbssele irreducinbsslee irreducinbsslee irreducinbslese irreducinbslees irreducinbslsee
irreducinbslsee irreducinbslese irreducinbslees irreducinbselse irreducinbseles irreducinbsesle irreducinbsesel
irreducinbseesl irreducinbseels irreducinbssele irreducinbsseel irreducinbsslee irreducinbsslee irreducinbssele
irreducinbsseel irreducinbseesl irreducinbseels irreducinbsesel irreducinbsesle irreducinbselse irreducinbseles
irreducineeblss irreducineeblss irreducineebsls irreducineebssl irreducineebssl irreducineebsls irreducineelbss
irreducineelbss irreducineelsbs irreducineelssb irreducineelssb irreducineelsbs irreducineeslbs irreducineeslsb
irreducineesbls irreducineesbsl irreducineessbl irreducineesslb irreducineeslsb irreducineeslbs irreducineesslb
irreducineessbl irreducineesbsl irreducineesbls irreducinebelss irreducinebelss irreducinebesls irreducinebessl
irreducinebessl irreducinebesls irreducinebless irreducinebless irreducineblses irreducineblsse irreducineblsse
irreducineblses irreducinebsles irreducinebslse irreducinebsels irreducinebsesl irreducinebssel irreducinebssle
irreducinebslse irreducinebsles irreducinebssle irreducinebssel irreducinebsesl irreducinebsels irreducinelbess
irreducinelbess irreducinelbses irreducinelbsse irreducinelbsse irreducinelbses irreducinelebss irreducinelebss
irreducinelesbs irreducinelessb irreducinelessb irreducinelesbs irreducinelsebs irreducinelsesb irreducinelsbes
irreducinelsbse irreducinelssbe irreducinelsseb irreducinelsesb irreducinelsebs irreducinelsseb irreducinelssbe
irreducinelsbse irreducinelsbes irreducinesbles irreducinesblse irreducinesbels irreducinesbesl irreducinesbsel
irreducinesbsle irreducineslbes irreducineslbse irreducineslebs irreducineslesb irreducineslseb irreducineslsbe
irreducineselbs irreducineselsb irreducinesebls irreducinesebsl irreducinesesbl irreducineseslb irreducinessleb
irreducinesslbe irreducinesselb irreducinessebl irreducinessbel irreducinessble irreducinesblse irreducinesbles
irreducinesbsle irreducinesbsel irreducinesbesl irreducinesbels irreducineslbse irreducineslbes irreducineslsbe
irreducineslseb irreducineslesb irreducineslebs irreducinesslbe irreducinessleb irreducinessble irreducinessbel
irreducinessebl irreducinesselb irreducineselsb irreducineselbs irreducineseslb irreducinesesbl irreducinesebsl
irreducinesebls irreducinsebels irreducinsebesl irreducinsebles irreducinseblse irreducinsebsle irreducinsebsel
irreducinseebls irreducinseebsl irreducinseelbs irreducinseelsb irreducinseeslb irreducinseesbl irreducinselebs
irreducinselesb irreducinselbes irreducinselbse irreducinselsbe irreducinselseb irreducinseselb irreducinsesebl
irreducinsesleb irreducinseslbe irreducinsesble irreducinsesbel irreducinsbeels irreducinsbeesl irreducinsbeles
irreducinsbelse irreducinsbesle irreducinsbesel irreducinsbeels irreducinsbeesl irreducinsbeles irreducinsbelse
irreducinsbesle irreducinsbesel irreducinsblees irreducinsblese irreducinsblees irreducinsblese irreducinsblsee
irreducinsblsee irreducinsbsele irreducinsbseel irreducinsbslee irreducinsbslee irreducinsbsele irreducinsbseel
irreducinsebels irreducinsebesl irreducinsebles irreducinseblse irreducinsebsle irreducinsebsel irreducinseebls
irreducinseebsl irreducinseelbs irreducinseelsb irreducinseeslb irreducinseesbl irreducinselebs irreducinselesb
irreducinselbes irreducinselbse irreducinselsbe irreducinselseb irreducinseselb irreducinsesebl irreducinsesleb
irreducinseslbe irreducinsesble irreducinsesbel irreducinslbees irreducinslbese irreducinslbees irreducinslbese
irreducinslbsee irreducinslbsee irreducinslebes irreducinslebse irreducinsleebs irreducinsleesb irreducinsleseb
irreducinslesbe irreducinsleebs irreducinsleesb irreducinslebes irreducinslebse irreducinslesbe irreducinsleseb
irreducinslseeb irreducinslsebe irreducinslseeb irreducinslsebe irreducinslsbee irreducinslsbee irreducinssbele
irreducinssbeel irreducinssblee irreducinssblee irreducinssbele irreducinssbeel irreducinsseble irreducinssebel
irreducinsselbe irreducinsseleb irreducinsseelb irreducinsseebl irreducinsslebe irreducinssleeb irreducinsslbee
irreducinsslbee irreducinsslebe irreducinssleeb irreducinsseelb irreducinsseebl irreducinsseleb irreducinsselbe
irreducinsseble irreducinssebel irreducinsebesl irreducinsebels irreducinsebsel irreducinsebsle irreducinseblse
irreducinsebles irreducinseebsl irreducinseebls irreducinseesbl irreducinseeslb irreducinseelsb irreducinseelbs
irreducinsesebl irreducinseselb irreducinsesbel irreducinsesble irreducinseslbe irreducinsesleb irreducinselesb
irreducinselebs irreducinselseb irreducinselsbe irreducinselbse irreducinselbes irreducinsbeesl irreducinsbeels
irreducinsbesel irreducinsbesle irreducinsbelse irreducinsbeles irreducinsbeesl irreducinsbeels irreducinsbesel
irreducinsbesle irreducinsbelse irreducinsbeles irreducinsbseel irreducinsbsele irreducinsbseel irreducinsbsele
irreducinsbslee irreducinsbslee irreducinsblese irreducinsblees irreducinsblsee irreducinsblsee irreducinsblese
irreducinsblees irreducinsebesl irreducinsebels irreducinsebsel irreducinsebsle irreducinseblse irreducinsebles
irreducinseebsl irreducinseebls irreducinseesbl irreducinseeslb irreducinseelsb irreducinseelbs irreducinsesebl
irreducinseselb irreducinsesbel irreducinsesble irreducinseslbe irreducinsesleb irreducinselesb irreducinselebs
irreducinselseb irreducinselsbe irreducinselbse irreducinselbes irreducinssbeel irreducinssbele irreducinssbeel
irreducinssbele irreducinssblee irreducinssblee irreducinssebel irreducinsseble irreducinsseebl irreducinsseelb
irreducinsseleb irreducinsselbe irreducinsseebl irreducinsseelb irreducinssebel irreducinsseble irreducinsselbe
irreducinsseleb irreducinssleeb irreducinsslebe irreducinssleeb irreducinsslebe irreducinsslbee irreducinsslbee
irreducinslbese irreducinslbees irreducinslbsee irreducinslbsee irreducinslbese irreducinslbees irreducinslebse
irreducinslebes irreducinslesbe irreducinsleseb irreducinsleesb irreducinsleebs irreducinslsebe irreducinslseeb
irreducinslsbee irreducinslsbee irreducinslsebe irreducinslseeb irreducinsleesb irreducinsleebs irreducinsleseb
irreducinslesbe irreducinslebse irreducinslebes irreducielenbss irreducielenbss irreducielensbs irreducielenssb
irreducielenssb irreducielensbs irreducielebnss irreducielebnss irreducielebsns irreducielebssn irreducielebssn
irreducielebsns irreducielesbns irreducielesbsn irreducielesnbs irreducielesnsb irreducielessnb irreducielessbn
irreducielesbsn irreducielesbns irreducielessbn irreducielessnb irreducielesnsb irreducielesnbs irreducielnebss
irreducielnebss irreducielnesbs irreducielnessb irreducielnessb irreducielnesbs irreducielnbess irreducielnbess
irreducielnbses irreducielnbsse irreducielnbsse irreducielnbses irreducielnsbes irreducielnsbse irreducielnsebs
irreducielnsesb irreducielnsseb irreducielnssbe irreducielnsbse irreducielnsbes irreducielnssbe irreducielnsseb
irreducielnsesb irreducielnsebs irreducielbness irreducielbness irreducielbnses irreducielbnsse irreducielbnsse
irreducielbnses irreducielbenss irreducielbenss irreducielbesns irreducielbessn irreducielbessn irreducielbesns
irreducielbsens irreducielbsesn irreducielbsnes irreducielbsnse irreducielbssne irreducielbssen irreducielbsesn
irreducielbsens irreducielbssen irreducielbssne irreducielbsnse irreducielbsnes irreducielsnbes irreducielsnbse
irreducielsnebs irreducielsnesb irreducielsnseb irreducielsnsbe irreducielsbnes irreducielsbnse irreducielsbens
irreducielsbesn irreducielsbsen irreducielsbsne irreducielsebns irreducielsebsn irreducielsenbs irreducielsensb
irreducielsesnb irreducielsesbn irreducielssben irreducielssbne irreducielssebn irreducielssenb irreducielssneb
irreducielssnbe irreducielsnbse irreducielsnbes irreducielsnsbe irreducielsnseb irreducielsnesb irreducielsnebs
irreducielsbnse irreducielsbnes irreducielsbsne irreducielsbsen irreducielsbesn irreducielsbens irreducielssbne
irreducielssben irreducielssnbe irreducielssneb irreducielssenb irreducielssebn irreducielsebsn irreducielsebns
irreducielsesbn irreducielsesnb irreducielsensb irreducielsenbs irreducieelnbss irreducieelnbss irreducieelnsbs
irreducieelnssb irreducieelnssb irreducieelnsbs irreducieelbnss irreducieelbnss irreducieelbsns irreducieelbssn
irreducieelbssn irreducieelbsns irreducieelsbns irreducieelsbsn irreducieelsnbs irreducieelsnsb irreducieelssnb
irreducieelssbn irreducieelsbsn irreducieelsbns irreducieelssbn irreducieelssnb irreducieelsnsb irreducieelsnbs
irreducieenlbss irreducieenlbss irreducieenlsbs irreducieenlssb irreducieenlssb irreducieenlsbs irreducieenblss
irreducieenblss irreducieenbsls irreducieenbssl irreducieenbssl irreducieenbsls irreducieensbls irreducieensbsl
irreducieenslbs irreducieenslsb irreducieensslb irreducieenssbl irreducieensbsl irreducieensbls irreducieenssbl
irreducieensslb irreducieenslsb irreducieenslbs irreducieebnlss irreducieebnlss irreducieebnsls irreducieebnssl
irreducieebnssl irreducieebnsls irreducieeblnss irreducieeblnss irreducieeblsns irreducieeblssn irreducieeblssn
irreducieeblsns irreducieebslns irreducieebslsn irreducieebsnls irreducieebsnsl irreducieebssnl irreducieebssln
irreducieebslsn irreducieebslns irreducieebssln irreducieebssnl irreducieebsnsl irreducieebsnls irreducieesnbls
irreducieesnbsl irreducieesnlbs irreducieesnlsb irreducieesnslb irreducieesnsbl irreducieesbnls irreducieesbnsl
irreducieesblns irreducieesblsn irreducieesbsln irreducieesbsnl irreducieeslbns irreducieeslbsn irreducieeslnbs
irreducieeslnsb irreducieeslsnb irreducieeslsbn irreducieessbln irreducieessbnl irreducieesslbn irreducieesslnb
irreducieessnlb irreducieessnbl irreducieesnbsl irreducieesnbls irreducieesnsbl irreducieesnslb irreducieesnlsb
irreducieesnlbs irreducieesbnsl irreducieesbnls irreducieesbsnl irreducieesbsln irreducieesblsn irreducieesblns
irreducieessbnl irreducieessbln irreducieessnbl irreducieessnlb irreducieesslnb irreducieesslbn irreducieeslbsn
irreducieeslbns irreducieeslsbn irreducieeslsnb irreducieeslnsb irreducieeslnbs irreducienelbss irreducienelbss
irreducienelsbs irreducienelssb irreducienelssb irreducienelsbs irreducieneblss irreducieneblss irreducienebsls
irreducienebssl irreducienebssl irreducienebsls irreducienesbls irreducienesbsl irreducieneslbs irreducieneslsb
irreducienesslb irreducienessbl irreducienesbsl irreducienesbls irreducienessbl irreducienesslb irreducieneslsb
irreducieneslbs irreducienlebss irreducienlebss irreducienlesbs irreducienlessb irreducienlessb irreducienlesbs
irreducienlbess irreducienlbess irreducienlbses irreducienlbsse irreducienlbsse irreducienlbses irreducienlsbes
irreducienlsbse irreducienlsebs irreducienlsesb irreducienlsseb irreducienlssbe irreducienlsbse irreducienlsbes
irreducienlssbe irreducienlsseb irreducienlsesb irreducienlsebs irreducienbless irreducienbless irreducienblses
irreducienblsse irreducienblsse irreducienblses irreducienbelss irreducienbelss irreducienbesls irreducienbessl
irreducienbessl irreducienbesls irreducienbsels irreducienbsesl irreducienbsles irreducienbslse irreducienbssle
irreducienbssel irreducienbsesl irreducienbsels irreducienbssel irreducienbssle irreducienbslse irreducienbsles
irreducienslbes irreducienslbse irreducienslebs irreducienslesb irreducienslseb irreducienslsbe irreduciensbles
irreduciensblse irreduciensbels irreduciensbesl irreduciensbsel irreduciensbsle irreduciensebls irreduciensebsl
irreducienselbs irreducienselsb irreducienseslb irreduciensesbl irreducienssbel irreducienssble irreducienssebl
irreduciensselb irreducienssleb irreduciensslbe irreducienslbse irreducienslbes irreducienslsbe irreducienslseb
irreducienslesb irreducienslebs irreduciensblse irreduciensbles irreduciensbsle irreduciensbsel irreduciensbesl
irreduciensbels irreducienssble irreducienssbel irreduciensslbe irreducienssleb irreduciensselb irreducienssebl
irreduciensebsl irreduciensebls irreduciensesbl irreducienseslb irreducienselsb irreducienselbs irreduciebenlss
irreduciebenlss irreduciebensls irreduciebenssl irreduciebenssl irreduciebensls irreduciebelnss irreduciebelnss
irreduciebelsns irreduciebelssn irreduciebelssn irreduciebelsns irreduciebeslns irreduciebeslsn irreduciebesnls
irreduciebesnsl irreduciebessnl irreduciebessln irreduciebeslsn irreduciebeslns irreduciebessln irreduciebessnl
irreduciebesnsl irreduciebesnls irreduciebnelss irreduciebnelss irreduciebnesls irreduciebnessl irreduciebnessl
irreduciebnesls irreduciebnless irreduciebnless irreduciebnlses irreduciebnlsse irreduciebnlsse irreduciebnlses
irreduciebnsles irreduciebnslse irreduciebnsels irreduciebnsesl irreduciebnssel irreduciebnssle irreduciebnslse
irreduciebnsles irreduciebnssle irreduciebnssel irreduciebnsesl irreduciebnsels irreducieblness irreducieblness
irreducieblnses irreducieblnsse irreducieblnsse irreducieblnses irreducieblenss irreducieblenss irreducieblesns
irreducieblessn irreducieblessn irreducieblesns irreducieblsens irreducieblsesn irreducieblsnes irreducieblsnse
irreducieblssne irreducieblssen irreducieblsesn irreducieblsens irreducieblssen irreducieblssne irreducieblsnse
irreducieblsnes irreduciebsnles irreduciebsnlse irreduciebsnels irreduciebsnesl irreduciebsnsel irreduciebsnsle
irreduciebslnes irreduciebslnse irreduciebslens irreduciebslesn irreduciebslsen irreduciebslsne irreduciebselns
irreduciebselsn irreduciebsenls irreduciebsensl irreduciebsesnl irreduciebsesln irreduciebsslen irreduciebsslne
irreduciebsseln irreduciebssenl irreduciebssnel irreduciebssnle irreduciebsnlse irreduciebsnles irreduciebsnsle
irreduciebsnsel irreduciebsnesl irreduciebsnels irreduciebslnse irreduciebslnes irreduciebslsne irreduciebslsen
irreduciebslesn irreduciebslens irreduciebsslne irreduciebsslen irreduciebssnle irreduciebssnel irreduciebssenl
irreduciebsseln irreduciebselsn irreduciebselns irreduciebsesln irreduciebsesnl irreduciebsensl irreduciebsenls
irreduciesenbls irreduciesenbsl irreduciesenlbs irreduciesenlsb irreduciesenslb irreduciesensbl irreduciesebnls
irreduciesebnsl irreducieseblns irreducieseblsn irreduciesebsln irreduciesebsnl irreducieselbns irreducieselbsn
irreducieselnbs irreducieselnsb irreducieselsnb irreducieselsbn irreduciesesbln irreduciesesbnl irreducieseslbn
irreducieseslnb irreduciesesnlb irreduciesesnbl irreduciesnebls irreduciesnebsl irreduciesnelbs irreduciesnelsb
irreduciesneslb irreduciesnesbl irreduciesnbels irreduciesnbesl irreduciesnbles irreduciesnblse irreduciesnbsle
irreduciesnbsel irreduciesnlbes irreduciesnlbse irreduciesnlebs irreduciesnlesb irreduciesnlseb irreduciesnlsbe
irreduciesnsble irreduciesnsbel irreduciesnslbe irreduciesnsleb irreduciesnselb irreduciesnsebl irreduciesbnels
irreduciesbnesl irreduciesbnles irreduciesbnlse irreduciesbnsle irreduciesbnsel irreduciesbenls irreduciesbensl
irreduciesbelns irreduciesbelsn irreduciesbesln irreduciesbesnl irreduciesblens irreduciesblesn irreduciesblnes
irreduciesblnse irreduciesblsne irreduciesblsen irreduciesbseln irreduciesbsenl irreduciesbslen irreduciesbslne
irreduciesbsnle irreduciesbsnel irreducieslnbes irreducieslnbse irreducieslnebs irreducieslnesb irreducieslnseb
irreducieslnsbe irreducieslbnes irreducieslbnse irreducieslbens irreducieslbesn irreducieslbsen irreducieslbsne
irreducieslebns irreducieslebsn irreducieslenbs irreducieslensb irreducieslesnb irreducieslesbn irreducieslsben
irreducieslsbne irreducieslsebn irreducieslsenb irreducieslsneb irreducieslsnbe irreduciessnble irreduciessnbel
irreduciessnlbe irreduciessnleb irreduciessnelb irreduciessnebl irreduciessbnle irreduciessbnel irreduciessblne
irreduciessblen irreduciessbeln irreduciessbenl irreduciesslbne irreduciesslben irreduciesslnbe irreduciesslneb
irreduciesslenb irreduciesslebn irreduciessebln irreduciessebnl irreduciesselbn irreduciesselnb irreduciessenlb
irreduciessenbl irreduciesenbsl irreduciesenbls irreduciesensbl irreduciesenslb irreduciesenlsb irreduciesenlbs
irreduciesebnsl irreduciesebnls irreduciesebsnl irreduciesebsln irreducieseblsn irreducieseblns irreduciesesbnl
irreduciesesbln irreduciesesnbl irreduciesesnlb irreducieseslnb irreducieseslbn irreducieselbsn irreducieselbns
irreducieselsbn irreducieselsnb irreducieselnsb irreducieselnbs irreduciesnebsl irreduciesnebls irreduciesnesbl
irreduciesneslb irreduciesnelsb irreduciesnelbs irreduciesnbesl irreduciesnbels irreduciesnbsel irreduciesnbsle
irreduciesnblse irreduciesnbles irreduciesnsbel irreduciesnsble irreduciesnsebl irreduciesnselb irreduciesnsleb
irreduciesnslbe irreduciesnlbse irreduciesnlbes irreduciesnlsbe irreduciesnlseb irreduciesnlesb irreduciesnlebs
irreduciesbnesl irreduciesbnels irreduciesbnsel irreduciesbnsle irreduciesbnlse irreduciesbnles irreduciesbensl
irreduciesbenls irreduciesbesnl irreduciesbesln irreduciesbelsn irreduciesbelns irreduciesbsenl irreduciesbseln
irreduciesbsnel irreduciesbsnle irreduciesbslne irreduciesbslen irreduciesblesn irreduciesblens irreduciesblsen
irreduciesblsne irreduciesblnse irreduciesblnes irreduciessnbel irreduciessnble irreduciessnebl irreduciessnelb
irreduciessnleb irreduciessnlbe irreduciessbnel irreduciessbnle irreduciessbenl irreduciessbeln irreduciessblen
irreduciessblne irreduciessebnl irreduciessebln irreduciessenbl irreduciessenlb irreduciesselnb irreduciesselbn
irreduciesslben irreduciesslbne irreduciesslebn irreduciesslenb irreduciesslneb irreduciesslnbe irreducieslnbse
irreducieslnbes irreducieslnsbe irreducieslnseb irreducieslnesb irreducieslnebs irreducieslbnse irreducieslbnes
irreducieslbsne irreducieslbsen irreducieslbesn irreducieslbens irreducieslsbne irreducieslsben irreducieslsnbe
irreducieslsneb irreducieslsenb irreducieslsebn irreducieslebsn irreducieslebns irreducieslesbn irreducieslesnb
irreducieslensb irreducieslenbs irreducislenebs irreducislenesb irreducislenbes irreducislenbse irreducislensbe
irreducislenseb irreducisleenbs irreducisleensb irreducisleebns irreducisleebsn irreducisleesbn irreducisleesnb
irreducislebens irreducislebesn irreducislebnes irreducislebnse irreducislebsne irreducislebsen irreducislesebn
irreducislesenb irreducislesben irreducislesbne irreducislesnbe irreducislesneb irreducislneebs irreducislneesb
irreducislnebes irreducislnebse irreducislnesbe irreducislneseb irreducislneebs irreducislneesb irreducislnebes
irreducislnebse irreducislnesbe irreducislneseb irreducislnbees irreducislnbese irreducislnbees irreducislnbese
irreducislnbsee irreducislnbsee irreducislnsebe irreducislnseeb irreducislnsbee irreducislnsbee irreducislnsebe
irreducislnseeb irreducislenebs irreducislenesb irreducislenbes irreducislenbse irreducislensbe irreducislenseb
irreducisleenbs irreducisleensb irreducisleebns irreducisleebsn irreducisleesbn irreducisleesnb irreducislebens
irreducislebesn irreducislebnes irreducislebnse irreducislebsne irreducislebsen irreducislesebn irreducislesenb
irreducislesben irreducislesbne irreducislesnbe irreducislesneb irreducislbnees irreducislbnese irreducislbnees
irreducislbnese irreducislbnsee irreducislbnsee irreducislbenes irreducislbense irreducislbeens irreducislbeesn
irreducislbesen irreducislbesne irreducislbeens irreducislbeesn irreducislbenes irreducislbense irreducislbesne
irreducislbesen irreducislbseen irreducislbsene irreducislbseen irreducislbsene irreducislbsnee irreducislbsnee
irreducislsnebe irreducislsneeb irreducislsnbee irreducislsnbee irreducislsnebe irreducislsneeb irreducislsenbe
irreducislseneb irreducislsebne irreducislseben irreducislseebn irreducislseenb irreducislsbene irreducislsbeen
irreducislsbnee irreducislsbnee irreducislsbene irreducislsbeen irreducislseebn irreducislseenb irreducislseben
irreducislsebne irreducislsenbe irreducislseneb irreduciselnebs irreduciselnesb irreduciselnbes irreduciselnbse
irreduciselnsbe irreduciselnseb irreduciselenbs irreduciselensb irreduciselebns irreduciselebsn irreduciselesbn
irreduciselesnb irreduciselbens irreduciselbesn irreduciselbnes irreduciselbnse irreduciselbsne irreduciselbsen
irreduciselsebn irreduciselsenb irreduciselsben irreduciselsbne irreduciselsnbe irreduciselsneb irreducisenlebs
irreducisenlesb irreducisenlbes irreducisenlbse irreducisenlsbe irreducisenlseb irreducisenelbs irreducisenelsb
irreducisenebls irreducisenebsl irreducisenesbl irreduciseneslb irreducisenbels irreducisenbesl irreducisenbles
irreducisenblse irreducisenbsle irreducisenbsel irreducisensebl irreducisenselb irreducisensbel irreducisensble
irreducisenslbe irreducisensleb irreduciseenlbs irreduciseenlsb irreduciseenbls irreduciseenbsl irreduciseensbl
irreduciseenslb irreduciseelnbs irreduciseelnsb irreduciseelbns irreduciseelbsn irreduciseelsbn irreduciseelsnb
irreduciseeblns irreduciseeblsn irreduciseebnls irreduciseebnsl irreduciseebsnl irreduciseebsln irreduciseeslbn
irreduciseeslnb irreduciseesbln irreduciseesbnl irreduciseesnbl irreduciseesnlb irreducisebnels irreducisebnesl
irreducisebnles irreducisebnlse irreducisebnsle irreducisebnsel irreducisebenls irreducisebensl irreducisebelns
irreducisebelsn irreducisebesln irreducisebesnl irreduciseblens irreduciseblesn irreduciseblnes irreduciseblnse
irreduciseblsne irreduciseblsen irreducisebseln irreducisebsenl irreducisebslen irreducisebslne irreducisebsnle
irreducisebsnel irreducisesnebl irreducisesnelb irreducisesnbel irreducisesnble irreducisesnlbe irreducisesnleb
irreducisesenbl irreducisesenlb irreducisesebnl irreducisesebln irreduciseselbn irreduciseselnb irreducisesbenl
irreducisesbeln irreducisesbnel irreducisesbnle irreducisesblne irreducisesblen irreduciseslebn irreduciseslenb
irreduciseslben irreduciseslbne irreduciseslnbe irreduciseslneb irreducisnelebs irreducisnelesb irreducisnelbes
irreducisnelbse irreducisnelsbe irreducisnelseb irreducisneelbs irreducisneelsb irreducisneebls irreducisneebsl
irreducisneesbl irreducisneeslb irreducisnebels irreducisnebesl irreducisnebles irreducisneblse irreducisnebsle
irreducisnebsel irreducisnesebl irreducisneselb irreducisnesbel irreducisnesble irreducisneslbe irreducisnesleb
irreducisnleebs irreducisnleesb irreducisnlebes irreducisnlebse irreducisnlesbe irreducisnleseb irreducisnleebs
irreducisnleesb irreducisnlebes irreducisnlebse irreducisnlesbe irreducisnleseb irreducisnlbees irreducisnlbese
irreducisnlbees irreducisnlbese irreducisnlbsee irreducisnlbsee irreducisnlsebe irreducisnlseeb irreducisnlsbee
irreducisnlsbee irreducisnlsebe irreducisnlseeb irreducisnelebs irreducisnelesb irreducisnelbes irreducisnelbse
irreducisnelsbe irreducisnelseb irreducisneelbs irreducisneelsb irreducisneebls irreducisneebsl irreducisneesbl
irreducisneeslb irreducisnebels irreducisnebesl irreducisnebles irreducisneblse irreducisnebsle irreducisnebsel
irreducisnesebl irreducisneselb irreducisnesbel irreducisnesble irreducisneslbe irreducisnesleb irreducisnblees
irreducisnblese irreducisnblees irreducisnblese irreducisnblsee irreducisnblsee irreducisnbeles irreducisnbelse
irreducisnbeels irreducisnbeesl irreducisnbesel irreducisnbesle irreducisnbeels irreducisnbeesl irreducisnbeles
irreducisnbelse irreducisnbesle irreducisnbesel irreducisnbseel irreducisnbsele irreducisnbseel irreducisnbsele
irreducisnbslee irreducisnbslee irreducisnslebe irreducisnsleeb irreducisnslbee irreducisnslbee irreducisnslebe
irreducisnsleeb irreducisnselbe irreducisnseleb irreducisnseble irreducisnsebel irreducisnseebl irreducisnseelb
irreducisnsbele irreducisnsbeel irreducisnsblee irreducisnsblee irreducisnsbele irreducisnsbeel irreducisnseebl
irreducisnseelb irreducisnsebel irreducisnseble irreducisnselbe irreducisnseleb irreduciseenlbs irreduciseenlsb
irreduciseenbls irreduciseenbsl irreduciseensbl irreduciseenslb irreduciseelnbs irreduciseelnsb irreduciseelbns
irreduciseelbsn irreduciseelsbn irreduciseelsnb irreduciseeblns irreduciseeblsn irreduciseebnls irreduciseebnsl
irreduciseebsnl irreduciseebsln irreduciseeslbn irreduciseeslnb irreduciseesbln irreduciseesbnl irreduciseesnbl
irreduciseesnlb irreducisenelbs irreducisenelsb irreducisenebls irreducisenebsl irreducisenesbl irreduciseneslb
irreducisenlebs irreducisenlesb irreducisenlbes irreducisenlbse irreducisenlsbe irreducisenlseb irreducisenbles
irreducisenblse irreducisenbels irreducisenbesl irreducisenbsel irreducisenbsle irreducisenslbe irreducisensleb
irreducisensble irreducisensbel irreducisensebl irreducisenselb irreduciselnebs irreduciselnesb irreduciselnbes
irreduciselnbse irreduciselnsbe irreduciselnseb irreduciselenbs irreduciselensb irreduciselebns irreduciselebsn
irreduciselesbn irreduciselesnb irreduciselbens irreduciselbesn irreduciselbnes irreduciselbnse irreduciselbsne
irreduciselbsen irreduciselsebn irreduciselsenb irreduciselsben irreduciselsbne irreduciselsnbe irreduciselsneb
irreducisebnles irreducisebnlse irreducisebnels irreducisebnesl irreducisebnsel irreducisebnsle irreduciseblnes
irreduciseblnse irreduciseblens irreduciseblesn irreduciseblsen irreduciseblsne irreducisebelns irreducisebelsn
irreducisebenls irreducisebensl irreducisebesnl irreducisebesln irreducisebslen irreducisebslne irreducisebseln
irreducisebsenl irreducisebsnel irreducisebsnle irreducisesnlbe irreducisesnleb irreducisesnble irreducisesnbel
irreducisesnebl irreducisesnelb irreduciseslnbe irreduciseslneb irreduciseslbne irreduciseslben irreduciseslebn
irreduciseslenb irreducisesblne irreducisesblen irreducisesbnle irreducisesbnel irreducisesbenl irreducisesbeln
irreduciseselbn irreduciseselnb irreducisesebln irreducisesebnl irreducisesenbl irreducisesenlb irreducisbenels
irreducisbenesl irreducisbenles irreducisbenlse irreducisbensle irreducisbensel irreducisbeenls irreducisbeensl
irreducisbeelns irreducisbeelsn irreducisbeesln irreducisbeesnl irreducisbelens irreducisbelesn irreducisbelnes
irreducisbelnse irreducisbelsne irreducisbelsen irreducisbeseln irreducisbesenl irreducisbeslen irreducisbeslne
irreducisbesnle irreducisbesnel irreducisbneels irreducisbneesl irreducisbneles irreducisbnelse irreducisbnesle
irreducisbnesel irreducisbneels irreducisbneesl irreducisbneles irreducisbnelse irreducisbnesle irreducisbnesel
irreducisbnlees irreducisbnlese irreducisbnlees irreducisbnlese irreducisbnlsee irreducisbnlsee irreducisbnsele
irreducisbnseel irreducisbnslee irreducisbnslee irreducisbnsele irreducisbnseel irreducisbenels irreducisbenesl
irreducisbenles irreducisbenlse irreducisbensle irreducisbensel irreducisbeenls irreducisbeensl irreducisbeelns
irreducisbeelsn irreducisbeesln irreducisbeesnl irreducisbelens irreducisbelesn irreducisbelnes irreducisbelnse
irreducisbelsne irreducisbelsen irreducisbeseln irreducisbesenl irreducisbeslen irreducisbeslne irreducisbesnle
irreducisbesnel irreducisblnees irreducisblnese irreducisblnees irreducisblnese irreducisblnsee irreducisblnsee
irreducisblenes irreducisblense irreducisbleens irreducisbleesn irreducisblesen irreducisblesne irreducisbleens
irreducisbleesn irreducisblenes irreducisblense irreducisblesne irreducisblesen irreducisblseen irreducisblsene
irreducisblseen irreducisblsene irreducisblsnee irreducisblsnee irreducisbsnele irreducisbsneel irreducisbsnlee
irreducisbsnlee irreducisbsnele irreducisbsneel irreducisbsenle irreducisbsenel irreducisbselne irreducisbselen
irreducisbseeln irreducisbseenl irreducisbslene irreducisbsleen irreducisbslnee irreducisbslnee irreducisbslene
irreducisbsleen irreducisbseeln irreducisbseenl irreducisbselen irreducisbselne irreducisbsenle irreducisbsenel
irreducissenebl irreducissenelb irreducissenbel irreducissenble irreducissenlbe irreducissenleb irreducisseenbl
irreducisseenlb irreducisseebnl irreducisseebln irreducisseelbn irreducisseelnb irreducissebenl irreducissebeln
irreducissebnel irreducissebnle irreducisseblne irreducisseblen irreducisselebn irreducisselenb irreducisselben
irreducisselbne irreducisselnbe irreducisselneb irreducissneebl irreducissneelb irreducissnebel irreducissneble
irreducissnelbe irreducissneleb irreducissneebl irreducissneelb irreducissnebel irreducissneble irreducissnelbe
irreducissneleb irreducissnbeel irreducissnbele irreducissnbeel irreducissnbele irreducissnblee irreducissnblee
irreducissnlebe irreducissnleeb irreducissnlbee irreducissnlbee irreducissnlebe irreducissnleeb irreducissenebl
irreducissenelb irreducissenbel irreducissenble irreducissenlbe irreducissenleb irreducisseenbl irreducisseenlb
irreducisseebnl irreducisseebln irreducisseelbn irreducisseelnb irreducissebenl irreducissebeln irreducissebnel
irreducissebnle irreducisseblne irreducisseblen irreducisselebn irreducisselenb irreducisselben irreducisselbne
irreducisselnbe irreducisselneb irreducissbneel irreducissbnele irreducissbneel irreducissbnele irreducissbnlee
irreducissbnlee irreducissbenel irreducissbenle irreducissbeenl irreducissbeeln irreducissbelen irreducissbelne
irreducissbeenl irreducissbeeln irreducissbenel irreducissbenle irreducissbelne irreducissbelen irreducissbleen
irreducissblene irreducissbleen irreducissblene irreducissblnee irreducissblnee irreducisslnebe irreducisslneeb
irreducisslnbee irreducisslnbee irreducisslnebe irreducisslneeb irreducisslenbe irreducissleneb irreducisslebne
irreducissleben irreducissleebn irreducissleenb irreducisslbene irreducisslbeen irreducisslbnee irreducisslbnee
irreducisslbene irreducisslbeen irreducissleebn irreducissleenb irreducissleben irreducisslebne irreducisslenbe
irreducissleneb irreducislenesb irreducislenebs irreducislenseb irreducislensbe irreducislenbse irreducislenbes
irreducisleensb irreducisleenbs irreducisleesnb irreducisleesbn irreducisleebsn irreducisleebns irreducislesenb
irreducislesebn irreducislesneb irreducislesnbe irreducislesbne irreducislesben irreducislebesn irreducislebens
irreducislebsen irreducislebsne irreducislebnse irreducislebnes irreducislneesb irreducislneebs irreducislneseb
irreducislnesbe irreducislnebse irreducislnebes irreducislneesb irreducislneebs irreducislneseb irreducislnesbe
irreducislnebse irreducislnebes irreducislnseeb irreducislnsebe irreducislnseeb irreducislnsebe irreducislnsbee
irreducislnsbee irreducislnbese irreducislnbees irreducislnbsee irreducislnbsee irreducislnbese irreducislnbees
irreducislenesb irreducislenebs irreducislenseb irreducislensbe irreducislenbse irreducislenbes irreducisleensb
irreducisleenbs irreducisleesnb irreducisleesbn irreducisleebsn irreducisleebns irreducislesenb irreducislesebn
irreducislesneb irreducislesnbe irreducislesbne irreducislesben irreducislebesn irreducislebens irreducislebsen
irreducislebsne irreducislebnse irreducislebnes irreducislsneeb irreducislsnebe irreducislsneeb irreducislsnebe
irreducislsnbee irreducislsnbee irreducislseneb irreducislsenbe irreducislseenb irreducislseebn irreducislseben
irreducislsebne irreducislseenb irreducislseebn irreducislseneb irreducislsenbe irreducislsebne irreducislseben
irreducislsbeen irreducislsbene irreducislsbeen irreducislsbene irreducislsbnee irreducislsbnee irreducislbnese
irreducislbnees irreducislbnsee irreducislbnsee irreducislbnese irreducislbnees irreducislbense irreducislbenes
irreducislbesne irreducislbesen irreducislbeesn irreducislbeens irreducislbsene irreducislbseen irreducislbsnee
irreducislbsnee irreducislbsene irreducislbseen irreducislbeesn irreducislbeens irreducislbesen irreducislbesne
irreducislbense irreducislbenes irreduciselnesb irreduciselnebs irreduciselnseb irreduciselnsbe irreduciselnbse
irreduciselnbes irreduciselensb irreduciselenbs irreduciselesnb irreduciselesbn irreduciselebsn irreduciselebns
irreduciselsenb irreduciselsebn irreduciselsneb irreduciselsnbe irreduciselsbne irreduciselsben irreduciselbesn
irreduciselbens irreduciselbsen irreduciselbsne irreduciselbnse irreduciselbnes irreducisenlesb irreducisenlebs
irreducisenlseb irreducisenlsbe irreducisenlbse irreducisenlbes irreducisenelsb irreducisenelbs irreduciseneslb
irreducisenesbl irreducisenebsl irreducisenebls irreducisenselb irreducisensebl irreducisensleb irreducisenslbe
irreducisensble irreducisensbel irreducisenbesl irreducisenbels irreducisenbsel irreducisenbsle irreducisenblse
irreducisenbles irreduciseenlsb irreduciseenlbs irreduciseenslb irreduciseensbl irreduciseenbsl irreduciseenbls
irreduciseelnsb irreduciseelnbs irreduciseelsnb irreduciseelsbn irreduciseelbsn irreduciseelbns irreduciseeslnb
irreduciseeslbn irreduciseesnlb irreduciseesnbl irreduciseesbnl irreduciseesbln irreduciseeblsn irreduciseeblns
irreduciseebsln irreduciseebsnl irreduciseebnsl irreduciseebnls irreducisesnelb irreducisesnebl irreducisesnleb
irreducisesnlbe irreducisesnble irreducisesnbel irreducisesenlb irreducisesenbl irreduciseselnb irreduciseselbn
irreducisesebln irreducisesebnl irreduciseslenb irreduciseslebn irreduciseslneb irreduciseslnbe irreduciseslbne
irreduciseslben irreducisesbeln irreducisesbenl irreducisesblen irreducisesblne irreducisesbnle irreducisesbnel
irreducisebnesl irreducisebnels irreducisebnsel irreducisebnsle irreducisebnlse irreducisebnles irreducisebensl
irreducisebenls irreducisebesnl irreducisebesln irreducisebelsn irreducisebelns irreducisebsenl irreducisebseln
irreducisebsnel irreducisebsnle irreducisebslne irreducisebslen irreduciseblesn irreduciseblens irreduciseblsen
irreduciseblsne irreduciseblnse irreduciseblnes irreducisnelesb irreducisnelebs irreducisnelseb irreducisnelsbe
irreducisnelbse irreducisnelbes irreducisneelsb irreducisneelbs irreducisneeslb irreducisneesbl irreducisneebsl
irreducisneebls irreducisneselb irreducisnesebl irreducisnesleb irreducisneslbe irreducisnesble irreducisnesbel
irreducisnebesl irreducisnebels irreducisnebsel irreducisnebsle irreducisneblse irreducisnebles irreducisnleesb
irreducisnleebs irreducisnleseb irreducisnlesbe irreducisnlebse irreducisnlebes irreducisnleesb irreducisnleebs
irreducisnleseb irreducisnlesbe irreducisnlebse irreducisnlebes irreducisnlseeb irreducisnlsebe irreducisnlseeb
irreducisnlsebe irreducisnlsbee irreducisnlsbee irreducisnlbese irreducisnlbees irreducisnlbsee irreducisnlbsee
irreducisnlbese irreducisnlbees irreducisnelesb irreducisnelebs irreducisnelseb irreducisnelsbe irreducisnelbse
irreducisnelbes irreducisneelsb irreducisneelbs irreducisneeslb irreducisneesbl irreducisneebsl irreducisneebls
irreducisneselb irreducisnesebl irreducisnesleb irreducisneslbe irreducisnesble irreducisnesbel irreducisnebesl
irreducisnebels irreducisnebsel irreducisnebsle irreducisneblse irreducisnebles irreducisnsleeb irreducisnslebe
irreducisnsleeb irreducisnslebe irreducisnslbee irreducisnslbee irreducisnseleb irreducisnselbe irreducisnseelb
irreducisnseebl irreducisnsebel irreducisnseble irreducisnseelb irreducisnseebl irreducisnseleb irreducisnselbe
irreducisnseble irreducisnsebel irreducisnsbeel irreducisnsbele irreducisnsbeel irreducisnsbele irreducisnsblee
irreducisnsblee irreducisnblese irreducisnblees irreducisnblsee irreducisnblsee irreducisnblese irreducisnblees
irreducisnbelse irreducisnbeles irreducisnbesle irreducisnbesel irreducisnbeesl irreducisnbeels irreducisnbsele
irreducisnbseel irreducisnbslee irreducisnbslee irreducisnbsele irreducisnbseel irreducisnbeesl irreducisnbeels
irreducisnbesel irreducisnbesle irreducisnbelse irreducisnbeles irreduciseenlsb irreduciseenlbs irreduciseenslb
irreduciseensbl irreduciseenbsl irreduciseenbls irreduciseelnsb irreduciseelnbs irreduciseelsnb irreduciseelsbn
irreduciseelbsn irreduciseelbns irreduciseeslnb irreduciseeslbn irreduciseesnlb irreduciseesnbl irreduciseesbnl
irreduciseesbln irreduciseeblsn irreduciseeblns irreduciseebsln irreduciseebsnl irreduciseebnsl irreduciseebnls
irreducisenelsb irreducisenelbs irreduciseneslb irreducisenesbl irreducisenebsl irreducisenebls irreducisenlesb
irreducisenlebs irreducisenlseb irreducisenlsbe irreducisenlbse irreducisenlbes irreducisensleb irreducisenslbe
irreducisenselb irreducisensebl irreducisensbel irreducisensble irreducisenblse irreducisenbles irreducisenbsle
irreducisenbsel irreducisenbesl irreducisenbels irreduciselnesb irreduciselnebs irreduciselnseb irreduciselnsbe
irreduciselnbse irreduciselnbes irreduciselensb irreduciselenbs irreduciselesnb irreduciselesbn irreduciselebsn
irreduciselebns irreduciselsenb irreduciselsebn irreduciselsneb irreduciselsnbe irreduciselsbne irreduciselsben
irreduciselbesn irreduciselbens irreduciselbsen irreduciselbsne irreduciselbnse irreduciselbnes irreducisesnleb
irreducisesnlbe irreducisesnelb irreducisesnebl irreducisesnbel irreducisesnble irreduciseslneb irreduciseslnbe
irreduciseslenb irreduciseslebn irreduciseslben irreduciseslbne irreduciseselnb irreduciseselbn irreducisesenlb
irreducisesenbl irreducisesebnl irreducisesebln irreducisesblen irreducisesblne irreducisesbeln irreducisesbenl
irreducisesbnel irreducisesbnle irreducisebnlse irreducisebnles irreducisebnsle irreducisebnsel irreducisebnesl
irreducisebnels irreduciseblnse irreduciseblnes irreduciseblsne irreduciseblsen irreduciseblesn irreduciseblens
irreducisebslne irreducisebslen irreducisebsnle irreducisebsnel irreducisebsenl irreducisebseln irreducisebelsn
irreducisebelns irreducisebesln irreducisebesnl irreducisebensl irreducisebenls irreducissenelb irreducissenebl
irreducissenleb irreducissenlbe irreducissenble irreducissenbel irreducisseenlb irreducisseenbl irreducisseelnb
irreducisseelbn irreducisseebln irreducisseebnl irreducisselenb irreducisselebn irreducisselneb irreducisselnbe
irreducisselbne irreducisselben irreducissebeln irreducissebenl irreducisseblen irreducisseblne irreducissebnle
irreducissebnel irreducissneelb irreducissneebl irreducissneleb irreducissnelbe irreducissneble irreducissnebel
irreducissneelb irreducissneebl irreducissneleb irreducissnelbe irreducissneble irreducissnebel irreducissnleeb
irreducissnlebe irreducissnleeb irreducissnlebe irreducissnlbee irreducissnlbee irreducissnbele irreducissnbeel
irreducissnblee irreducissnblee irreducissnbele irreducissnbeel irreducissenelb irreducissenebl irreducissenleb
irreducissenlbe irreducissenble irreducissenbel irreducisseenlb irreducisseenbl irreducisseelnb irreducisseelbn
irreducisseebln irreducisseebnl irreducisselenb irreducisselebn irreducisselneb irreducisselnbe irreducisselbne
irreducisselben irreducissebeln irreducissebenl irreducisseblen irreducisseblne irreducissebnle irreducissebnel
irreducisslneeb irreducisslnebe irreducisslneeb irreducisslnebe irreducisslnbee irreducisslnbee irreducissleneb
irreducisslenbe irreducissleenb irreducissleebn irreducissleben irreducisslebne irreducissleenb irreducissleebn
irreducissleneb irreducisslenbe irreducisslebne irreducissleben irreducisslbeen irreducisslbene irreducisslbeen
irreducisslbene irreducisslbnee irreducisslbnee irreducissbnele irreducissbneel irreducissbnlee irreducissbnlee
irreducissbnele irreducissbneel irreducissbenle irreducissbenel irreducissbelne irreducissbelen irreducissbeeln
irreducissbeenl irreducissblene irreducissbleen irreducissblnee irreducissblnee irreducissblene irreducissbleen
irreducissbeeln irreducissbeenl irreducissbelen irreducissbelne irreducissbenle irreducissbenel irreducisbenesl
irreducisbenels irreducisbensel irreducisbensle irreducisbenlse irreducisbenles irreducisbeensl irreducisbeenls
irreducisbeesnl irreducisbeesln irreducisbeelsn irreducisbeelns irreducisbesenl irreducisbeseln irreducisbesnel
irreducisbesnle irreducisbeslne irreducisbeslen irreducisbelesn irreducisbelens irreducisbelsen irreducisbelsne
irreducisbelnse irreducisbelnes irreducisbneesl irreducisbneels irreducisbnesel irreducisbnesle irreducisbnelse
irreducisbneles irreducisbneesl irreducisbneels irreducisbnesel irreducisbnesle irreducisbnelse irreducisbneles
irreducisbnseel irreducisbnsele irreducisbnseel irreducisbnsele irreducisbnslee irreducisbnslee irreducisbnlese
irreducisbnlees irreducisbnlsee irreducisbnlsee irreducisbnlese irreducisbnlees irreducisbenesl irreducisbenels
irreducisbensel irreducisbensle irreducisbenlse irreducisbenles irreducisbeensl irreducisbeenls irreducisbeesnl
irreducisbeesln irreducisbeelsn irreducisbeelns irreducisbesenl irreducisbeseln irreducisbesnel irreducisbesnle
irreducisbeslne irreducisbeslen irreducisbelesn irreducisbelens irreducisbelsen irreducisbelsne irreducisbelnse
irreducisbelnes irreducisbsneel irreducisbsnele irreducisbsneel irreducisbsnele irreducisbsnlee irreducisbsnlee
irreducisbsenel irreducisbsenle irreducisbseenl irreducisbseeln irreducisbselen irreducisbselne irreducisbseenl
irreducisbseeln irreducisbsenel irreducisbsenle irreducisbselne irreducisbselen irreducisbsleen irreducisbslene
irreducisbsleen irreducisbslene irreducisbslnee irreducisbslnee irreducisblnese irreducisblnees irreducisblnsee
irreducisblnsee irreducisblnese irreducisblnees irreducisblense irreducisblenes irreducisblesne irreducisblesen
irreducisbleesn irreducisbleens irreducisblsene irreducisblseen irreducisblsnee irreducisblsnee irreducisblsene
irreducisblseen irreducisbleesn irreducisbleens irreducisblesen irreducisblesne irreducisblense irreducisblenes

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us