easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

duchman

auferetisque

letanie

scrutation

holtorf

lamer

falls

galenapark

septatum

countershade

nolint

labenti

rhetorically

amputational

passino

bulpitt

underflow

unbluffing


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: insisted
cipher variations:
jotjtufe kpukuvgf lqvlvwhg mrwmwxih nsxnxyji
otyoyzkj puzpzalk qvaqabml rwbrbcnm sxcscdon
tydtdepo uzeuefqp vafvfgrq wbgwghsr xchxhits
ydiyijut zejzjkvu afkaklwv bglblmxw chmcmnyx
dindnozy ejoeopaz fkpfpqba glqgqrcb hmrhrsdc

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: insisted
Cipher: rmhrhgvw

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: insisted
Cipher: ABAAA ABBAA BAAAB ABAAA BAAAB BAABA AABAA AAABB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: insisted
cipher variations:
jotjtufezodzdgnkponpnsvqfoxfxedwvohvhqlclorlrctirolrlajuhovhvmra
xofxfyzgnopnpkhmdozdzwpstojtjixykpukuvgfapeaeholqpoqotwrgpygyfex
wpiwirmdmpsmsdujspmsmbkvipwiwnsbypgygzahopqoqlinepaeaxqtupkukjyz
lqvlvwhgbqfbfipmrqprpuxshqzhzgfyxqjxjsnenqtntevktqntnclwjqxjxotc
zqhzhabipqrprmjofqbfbyruvqlvlkzamrwmwxihcrgcgjqnsrqsqvytiraiahgz
yrkyktoforuoufwlurouodmxkrykypudariaibcjqrsqsnkpgrcgczsvwrmwmlab
nsxnxyjidshdhkrotsrtrwzujsbjbihazslzlupgpsvpvgxmvspvpenylszlzqve
bsjbjcdkrstrtolqhsdhdatwxsnxnmbcotyoyzkjetieilsputsusxavktckcjib
atmamvqhqtwqwhynwtqwqfozmtamarwfctkckdelstusupmriteiebuxytoyoncd
puzpzalkfujfjmtqvutvtybwludldkjcbunbnwriruxrxizoxurxrgpanubnbsxg
duldlefmtuvtvqnsjufjfcvyzupzpodeqvaqabmlgvkgknurwvuwuzcxmvemelkd
cvocoxsjsvysyjapyvsyshqbovcoctyhevmemfgnuvwuwrotkvgkgdwzavqaqpef
rwbrbcnmhwlhlovsxwvxvadynwfnfmledwpdpytktwztzkbqzwtztircpwdpduzi
fwnfnghovwxvxspulwhlhexabwrbrqfgsxcscdonixmimpwtyxwywbezoxgognmf
exqeqzuluxaualcraxuaujsdqxeqevajgxogohipwxywytqvmximifybcxscsrgh
tydtdepojynjnqxuzyxzxcfapyhphongfyrfravmvybvbmdsbyvbvkteryfrfwbk
hyphpijqxyzxzurwnyjnjgzcdytdtshiuzeuefqpkzokoryvazyaydgbqziqipoh
gzsgsbwnwzcwcnetczwcwlufszgsgxclizqiqjkryzayavsxozkokhadezueutij
vafvfgrqlaplpszwbazbzehcrajrjqpihathtcxoxadxdofudaxdxmvgtahthydm
jarjrklszabzbwtypalplibefavfvujkwbgwghsrmbqmqtaxcbacafidsbkskrqj
ibuiudypybeyepgvebyeynwhubiuizenkbskslmtabcacxuzqbmqmjcfgbwgwvkl
xchxhitsncrnrubydcbdbgjetcltlsrkjcvjvezqzcfzfqhwfczfzoxivcjvjafo
lctltmnubcdbdyvarcnrnkdghcxhxwlmydiyijutodsosvczedcechkfudmumtsl
kdwkwfaradgagrixgdagapyjwdkwkbgpmdumunovcdecezwbsdosolehidyiyxmn
zejzjkvupetptwdafedfdilgvenvnutmlexlxgbsbehbhsjyhebhbqzkxelxlchq
nevnvopwdefdfaxcteptpmfijezjzynoafkaklwvqfuquxebgfegejmhwfowovun
mfymyhctcficitkzifcicralyfmymdirofwowpqxefgegbydufquqngjkfakazop
bglblmxwrgvrvyfchgfhfknixgpxpwvongznzidudgjdjulajgdjdsbmzgnznejs
pgxpxqryfghfhczevgrvrohklgblbapqchmcmnyxshwswzgdihgiglojyhqyqxwp
ohaoajevehkekvmbkheketcnahoaofktqhyqyrszghigidafwhswspilmhcmcbqr
dindnozytixtxahejihjhmpkzirzryxqpibpbkfwfilflwncliflfudobipbpglu
rizrzstahijhjebgxitxtqjmnidndcrsejoeopazujyuybifkjikinqlajsaszyr
qjcqclgxgjmgmxodmjgmgvepcjqcqhmvsjasatubijkikfchyjuyurknojeoedst
fkpfpqbavkzvzcjglkjljormbktbtazsrkdrdmhyhknhnypenkhnhwfqdkrdrinw
tkbtbuvcjkljlgdizkvzvslopkfpfetuglqgqrcbwlawadkhmlkmkpsnclucubat
sleseniziloiozqfolioixgrelsesjoxulcucvwdklmkmhejalwawtmpqlgqgfuv
hmrhrsdcxmbxbelinmlnlqtodmvdvcbutmftfojajmpjpargpmjpjyhsfmtftkpy
vmdvdwxelmnlnifkbmxbxunqrmhrhgvwinsistedyncycfmjonmomrupenwewdcv
ungugpkbknqkqbshqnkqkzitgnugulqzwnewexyfmnomojglcnycyvorsnisihwx

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: insisted
Cipher: vafvfgrq

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: insisted
Cipher: 4233344234445141

Extended Methods:
Method #1

Plaintext: insisted
method variations:
osxoxykitxctcdpoychyhiutdhndnozy

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
i n s i s t e d 
4 3 3 4 3 4 5 4 
2 3 4 2 4 4 1 1 
They are then read out in rows:
4334345423424411
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: insisted
Cipher: ossumita

Read more ...
Method #3

Plaintext: insisted
method variations:
mntmtyqq ntmtyqqm tmtyqqmn
mtyqqmnt tyqqmntm yqqmntmt
qqmntmty qmntmtyq

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: insisted

first 5040 cipher variations(40320 total)
insisted insistde insisetd insisedt insisdet insisdte insitsed insitsde insitesd insiteds insitdes
insitdse insietsd insietds insiestd insiesdt insiedst insiedts insidtes insidtse insidets insidest
insidset insidste inssited inssitde inssietd inssiedt inssidet inssidte insstied insstide inssteid
insstedi insstdei insstdie inssetid inssetdi insseitd insseidt inssedit inssedti inssdtei inssdtie
inssdeti inssdeit inssdiet inssdite instsied instside instseid instsedi instsdei instsdie instised
instisde instiesd instieds instides instidse insteisd insteids instesid instesdi instedsi instedis
instdies instdise instdeis instdesi instdsei instdsie insestid insestdi insesitd insesidt insesdit
insesdti insetsid insetsdi insetisd insetids insetdis insetdsi inseitsd inseitds inseistd inseisdt
inseidst inseidts insedtis insedtsi insedits insedist insedsit insedsti insdstei insdstie insdseti
insdseit insdsiet insdsite insdtsei insdtsie insdtesi insdteis insdties insdtise insdetsi insdetis
insdesti insdesit insdeist insdeits insdites insditse insdiets insdiest insdiset insdiste inissted
inisstde inissetd inissedt inissdet inissdte inistsed inistsde inistesd inisteds inistdes inistdse
inisetsd inisetds inisestd inisesdt inisedst inisedts inisdtes inisdtse inisdets inisdest inisdset
inisdste inissted inisstde inissetd inissedt inissdet inissdte inistsed inistsde inistesd inisteds
inistdes inistdse inisetsd inisetds inisestd inisesdt inisedst inisedts inisdtes inisdtse inisdets
inisdest inisdset inisdste initssed initssde initsesd initseds initsdes initsdse initssed initssde
initsesd initseds initsdes initsdse initessd initesds initessd initesds initedss initedss initdses
initdsse initdess initdess initdses initdsse iniestsd iniestds iniesstd iniessdt iniesdst iniesdts
inietssd inietsds inietssd inietsds inietdss inietdss iniestsd iniestds iniesstd iniessdt iniesdst
iniesdts iniedtss iniedtss iniedsts iniedsst iniedsst iniedsts inidstes inidstse inidsets inidsest
inidsset inidsste inidtses inidtsse inidtess inidtess inidtses inidtsse inidetss inidetss inidests
inidesst inidesst inidests inidstes inidstse inidsets inidsest inidsset inidsste insisted insistde
insisetd insisedt insisdet insisdte insitsed insitsde insitesd insiteds insitdes insitdse insietsd
insietds insiestd insiesdt insiedst insiedts insidtes insidtse insidets insidest insidset insidste
inssited inssitde inssietd inssiedt inssidet inssidte insstied insstide inssteid insstedi insstdei
insstdie inssetid inssetdi insseitd insseidt inssedit inssedti inssdtei inssdtie inssdeti inssdeit
inssdiet inssdite instsied instside instseid instsedi instsdei instsdie instised instisde instiesd
instieds instides instidse insteisd insteids instesid instesdi instedsi instedis instdies instdise
instdeis instdesi instdsei instdsie insestid insestdi insesitd insesidt insesdit insesdti insetsid
insetsdi insetisd insetids insetdis insetdsi inseitsd inseitds inseistd inseisdt inseidst inseidts
insedtis insedtsi insedits insedist insedsit insedsti insdstei insdstie insdseti insdseit insdsiet
insdsite insdtsei insdtsie insdtesi insdteis insdties insdtise insdetsi insdetis insdesti insdesit
insdeist insdeits insdites insditse insdiets insdiest insdiset insdiste intissed intissde intisesd
intiseds intisdes intisdse intissed intissde intisesd intiseds intisdes intisdse intiessd intiesds
intiessd intiesds intiedss intiedss intidses intidsse intidess intidess intidses intidsse intsised
intsisde intsiesd intsieds intsides intsidse intssied intsside intsseid intssedi intssdei intssdie
intsesid intsesdi intseisd intseids intsedis intsedsi intsdsei intsdsie intsdesi intsdeis intsdies
intsdise intssied intsside intsseid intssedi intssdei intssdie intsised intsisde intsiesd intsieds
intsides intsidse intseisd intseids intsesid intsesdi intsedsi intsedis intsdies intsdise intsdeis
intsdesi intsdsei intsdsie intessid intessdi intesisd intesids intesdis intesdsi intessid intessdi
intesisd intesids intesdis intesdsi inteissd inteisds inteissd inteisds inteidss inteidss intedsis
intedssi intediss intediss intedsis intedssi intdssei intdssie intdsesi intdseis intdsies intdsise
intdssei intdssie intdsesi intdseis intdsies intdsise intdessi intdesis intdessi intdesis intdeiss
intdeiss intdises intdisse intdiess intdiess intdises intdisse ineistsd ineistds ineisstd ineissdt
ineisdst ineisdts ineitssd ineitsds ineitssd ineitsds ineitdss ineitdss ineistsd ineistds ineisstd
ineissdt ineisdst ineisdts ineidtss ineidtss ineidsts ineidsst ineidsst ineidsts inesitsd inesitds
inesistd inesisdt inesidst inesidts inestisd inestids inestsid inestsdi inestdsi inestdis inesstid
inesstdi inessitd inessidt inessdit inessdti inesdtsi inesdtis inesdsti inesdsit inesdist inesdits
inetsisd inetsids inetssid inetssdi inetsdsi inetsdis inetissd inetisds inetissd inetisds inetidss
inetidss inetsisd inetsids inetssid inetssdi inetsdsi inetsdis inetdiss inetdiss inetdsis inetdssi
inetdssi inetdsis inesstid inesstdi inessitd inessidt inessdit inessdti inestsid inestsdi inestisd
inestids inestdis inestdsi inesitsd inesitds inesistd inesisdt inesidst inesidts inesdtis inesdtsi
inesdits inesdist inesdsit inesdsti inedstsi inedstis inedssti inedssit inedsist inedsits inedtssi
inedtsis inedtssi inedtsis inedtiss inedtiss inedstsi inedstis inedssti inedssit inedsist inedsits
ineditss ineditss inedists inedisst inedisst inedists indistes indistse indisets indisest indisset
indisste inditses inditsse inditess inditess inditses inditsse indietss indietss indiests indiesst
indiesst indiests indistes indistse indisets indisest indisset indisste indsites indsitse indsiets
indsiest indsiset indsiste indsties indstise indsteis indstesi indstsei indstsie indsetis indsetsi
indseits indseist indsesit indsesti indsstei indsstie indsseti indsseit indssiet indssite indtsies
indtsise indtseis indtsesi indtssei indtssie indtises indtisse indtiess indtiess indtises indtisse
indteiss indteiss indtesis indtessi indtessi indtesis indtsies indtsise indtseis indtsesi indtssei
indtssie indestis indestsi indesits indesist indessit indessti indetsis indetssi indetiss indetiss
indetsis indetssi indeitss indeitss indeists indeisst indeisst indeists indestis indestsi indesits
indesist indessit indessti indsstei indsstie indsseti indsseit indssiet indssite indstsei indstsie
indstesi indsteis indsties indstise indsetsi indsetis indsesti indsesit indseist indseits indsites
indsitse indsiets indsiest indsiset indsiste isnisted isnistde isnisetd isnisedt isnisdet isnisdte
isnitsed isnitsde isnitesd isniteds isnitdes isnitdse isnietsd isnietds isniestd isniesdt isniedst
isniedts isnidtes isnidtse isnidets isnidest isnidset isnidste isnsited isnsitde isnsietd isnsiedt
isnsidet isnsidte isnstied isnstide isnsteid isnstedi isnstdei isnstdie isnsetid isnsetdi isnseitd
isnseidt isnsedit isnsedti isnsdtei isnsdtie isnsdeti isnsdeit isnsdiet isnsdite isntsied isntside
isntseid isntsedi isntsdei isntsdie isntised isntisde isntiesd isntieds isntides isntidse isnteisd
isnteids isntesid isntesdi isntedsi isntedis isntdies isntdise isntdeis isntdesi isntdsei isntdsie
isnestid isnestdi isnesitd isnesidt isnesdit isnesdti isnetsid isnetsdi isnetisd isnetids isnetdis
isnetdsi isneitsd isneitds isneistd isneisdt isneidst isneidts isnedtis isnedtsi isnedits isnedist
isnedsit isnedsti isndstei isndstie isndseti isndseit isndsiet isndsite isndtsei isndtsie isndtesi
isndteis isndties isndtise isndetsi isndetis isndesti isndesit isndeist isndeits isndites isnditse
isndiets isndiest isndiset isndiste isinsted isinstde isinsetd isinsedt isinsdet isinsdte isintsed
isintsde isintesd isinteds isintdes isintdse isinetsd isinetds isinestd isinesdt isinedst isinedts
isindtes isindtse isindets isindest isindset isindste isisnted isisntde isisnetd isisnedt isisndet
isisndte isistned isistnde isistend isistedn isistden isistdne isisetnd isisetdn isisentd isisendt
isisednt isisedtn isisdten isisdtne isisdetn isisdent isisdnet isisdnte isitsned isitsnde isitsend
isitsedn isitsden isitsdne isitnsed isitnsde isitnesd isitneds isitndes isitndse isitensd isitends
isitesnd isitesdn isitedsn isitedns isitdnes isitdnse isitdens isitdesn isitdsen isitdsne isiestnd
isiestdn isiesntd isiesndt isiesdnt isiesdtn isietsnd isietsdn isietnsd isietnds isietdns isietdsn
isientsd isientds isienstd isiensdt isiendst isiendts isiedtns isiedtsn isiednts isiednst isiedsnt
isiedstn isidsten isidstne isidsetn isidsent isidsnet isidsnte isidtsen isidtsne isidtesn isidtens
isidtnes isidtnse isidetsn isidetns isidestn isidesnt isidenst isidents isidntes isidntse isidnets
isidnest isidnset isidnste issinted issintde issinetd issinedt issindet issindte issitned issitnde
issitend issitedn issitden issitdne issietnd issietdn issientd issiendt issiednt issiedtn issidten
issidtne issidetn issident issidnet issidnte issnited issnitde issnietd issniedt issnidet issnidte
issntied issntide issnteid issntedi issntdei issntdie issnetid issnetdi issneitd issneidt issnedit
issnedti issndtei issndtie issndeti issndeit issndiet issndite isstnied isstnide isstneid isstnedi
isstndei isstndie isstined isstinde isstiend isstiedn isstiden isstidne issteind issteidn isstenid
isstendi isstedni isstedin isstdien isstdine isstdein isstdeni isstdnei isstdnie issentid issentdi
issenitd issenidt issendit issendti issetnid issetndi issetind issetidn issetdin issetdni isseitnd
isseitdn isseintd isseindt isseidnt isseidtn issedtin issedtni isseditn issedint issednit issednti
issdntei issdntie issdneti issdneit issdniet issdnite issdtnei issdtnie issdteni issdtein issdtien
issdtine issdetni issdetin issdenti issdenit issdeint issdeitn issditen issditne issdietn issdient
issdinet issdinte istisned istisnde istisend istisedn istisden istisdne istinsed istinsde istinesd
istineds istindes istindse istiensd istiends istiesnd istiesdn istiedsn istiedns istidnes istidnse
istidens istidesn istidsen istidsne istsined istsinde istsiend istsiedn istsiden istsidne istsnied
istsnide istsneid istsnedi istsndei istsndie istsenid istsendi istseind istseidn istsedin istsedni
istsdnei istsdnie istsdeni istsdein istsdien istsdine istnsied istnside istnseid istnsedi istnsdei
istnsdie istnised istnisde istniesd istnieds istnides istnidse istneisd istneids istnesid istnesdi
istnedsi istnedis istndies istndise istndeis istndesi istndsei istndsie istesnid istesndi istesind
istesidn istesdin istesdni istensid istensdi istenisd istenids istendis istendsi isteinsd isteinds
isteisnd isteisdn isteidsn isteidns istednis istednsi istedins istedisn istedsin istedsni istdsnei
istdsnie istdseni istdsein istdsien istdsine istdnsei istdnsie istdnesi istdneis istdnies istdnise
istdensi istdenis istdesni istdesin istdeisn istdeins istdines istdinse istdiens istdiesn istdisen
istdisne iseistnd iseistdn iseisntd iseisndt iseisdnt iseisdtn iseitsnd iseitsdn iseitnsd iseitnds
iseitdns iseitdsn iseintsd iseintds iseinstd iseinsdt iseindst iseindts iseidtns iseidtsn iseidnts
iseidnst iseidsnt iseidstn isesitnd isesitdn isesintd isesindt isesidnt isesidtn isestind isestidn
isestnid isestndi isestdni isestdin isesntid isesntdi isesnitd isesnidt isesndit isesndti isesdtni
isesdtin isesdnti isesdnit isesdint isesditn isetsind isetsidn isetsnid isetsndi isetsdni isetsdin
isetisnd isetisdn isetinsd isetinds isetidns isetidsn isetnisd isetnids isetnsid isetnsdi isetndsi
isetndis isetdins isetdisn isetdnis isetdnsi isetdsni isetdsin isenstid isenstdi isensitd isensidt
isensdit isensdti isentsid isentsdi isentisd isentids isentdis isentdsi isenitsd isenitds isenistd
isenisdt isenidst isenidts isendtis isendtsi isendits isendist isendsit isendsti isedstni isedstin
isedsnti isedsnit isedsint isedsitn isedtsni isedtsin isedtnsi isedtnis isedtins isedtisn isedntsi
isedntis isednsti isednsit isednist isednits iseditns iseditsn isedints isedinst isedisnt isedistn
isdisten isdistne isdisetn isdisent isdisnet isdisnte isditsen isditsne isditesn isditens isditnes
isditnse isdietsn isdietns isdiestn isdiesnt isdienst isdients isdintes isdintse isdinets isdinest
isdinset isdinste isdsiten isdsitne isdsietn isdsient isdsinet isdsinte isdstien isdstine isdstein
isdsteni isdstnei isdstnie isdsetin isdsetni isdseitn isdseint isdsenit isdsenti isdsntei isdsntie
isdsneti isdsneit isdsniet isdsnite isdtsien isdtsine isdtsein isdtseni isdtsnei isdtsnie isdtisen
isdtisne isdtiesn isdtiens isdtines isdtinse isdteisn isdteins isdtesin isdtesni isdtensi isdtenis
isdtnies isdtnise isdtneis isdtnesi isdtnsei isdtnsie isdestin isdestni isdesitn isdesint isdesnit
isdesnti isdetsin isdetsni isdetisn isdetins isdetnis isdetnsi isdeitsn isdeitns isdeistn isdeisnt
isdeinst isdeints isdentis isdentsi isdenits isdenist isdensit isdensti isdnstei isdnstie isdnseti
isdnseit isdnsiet isdnsite isdntsei isdntsie isdntesi isdnteis isdnties isdntise isdnetsi isdnetis
isdnesti isdnesit isdneist isdneits isdnites isdnitse isdniets isdniest isdniset isdniste iisnsted
iisnstde iisnsetd iisnsedt iisnsdet iisnsdte iisntsed iisntsde iisntesd iisnteds iisntdes iisntdse
iisnetsd iisnetds iisnestd iisnesdt iisnedst iisnedts iisndtes iisndtse iisndets iisndest iisndset
iisndste iissnted iissntde iissnetd iissnedt iissndet iissndte iisstned iisstnde iisstend iisstedn
iisstden iisstdne iissetnd iissetdn iissentd iissendt iissednt iissedtn iissdten iissdtne iissdetn
iissdent iissdnet iissdnte iistsned iistsnde iistsend iistsedn iistsden iistsdne iistnsed iistnsde
iistnesd iistneds iistndes iistndse iistensd iistends iistesnd iistesdn iistedsn iistedns iistdnes
iistdnse iistdens iistdesn iistdsen iistdsne iisestnd iisestdn iisesntd iisesndt iisesdnt iisesdtn
iisetsnd iisetsdn iisetnsd iisetnds iisetdns iisetdsn iisentsd iisentds iisenstd iisensdt iisendst
iisendts iisedtns iisedtsn iisednts iisednst iisedsnt iisedstn iisdsten iisdstne iisdsetn iisdsent
iisdsnet iisdsnte iisdtsen iisdtsne iisdtesn iisdtens iisdtnes iisdtnse iisdetsn iisdetns iisdestn
iisdesnt iisdenst iisdents iisdntes iisdntse iisdnets iisdnest iisdnset iisdnste iinssted iinsstde
iinssetd iinssedt iinssdet iinssdte iinstsed iinstsde iinstesd iinsteds iinstdes iinstdse iinsetsd
iinsetds iinsestd iinsesdt iinsedst iinsedts iinsdtes iinsdtse iinsdets iinsdest iinsdset iinsdste
iinssted iinsstde iinssetd iinssedt iinssdet iinssdte iinstsed iinstsde iinstesd iinsteds iinstdes
iinstdse iinsetsd iinsetds iinsestd iinsesdt iinsedst iinsedts iinsdtes iinsdtse iinsdets iinsdest
iinsdset iinsdste iintssed iintssde iintsesd iintseds iintsdes iintsdse iintssed iintssde iintsesd
iintseds iintsdes iintsdse iintessd iintesds iintessd iintesds iintedss iintedss iintdses iintdsse
iintdess iintdess iintdses iintdsse iinestsd iinestds iinesstd iinessdt iinesdst iinesdts iinetssd
iinetsds iinetssd iinetsds iinetdss iinetdss iinestsd iinestds iinesstd iinessdt iinesdst iinesdts
iinedtss iinedtss iinedsts iinedsst iinedsst iinedsts iindstes iindstse iindsets iindsest iindsset
iindsste iindtses iindtsse iindtess iindtess iindtses iindtsse iindetss iindetss iindests iindesst
iindesst iindests iindstes iindstse iindsets iindsest iindsset iindsste iisnsted iisnstde iisnsetd
iisnsedt iisnsdet iisnsdte iisntsed iisntsde iisntesd iisnteds iisntdes iisntdse iisnetsd iisnetds
iisnestd iisnesdt iisnedst iisnedts iisndtes iisndtse iisndets iisndest iisndset iisndste iissnted
iissntde iissnetd iissnedt iissndet iissndte iisstned iisstnde iisstend iisstedn iisstden iisstdne
iissetnd iissetdn iissentd iissendt iissednt iissedtn iissdten iissdtne iissdetn iissdent iissdnet
iissdnte iistsned iistsnde iistsend iistsedn iistsden iistsdne iistnsed iistnsde iistnesd iistneds
iistndes iistndse iistensd iistends iistesnd iistesdn iistedsn iistedns iistdnes iistdnse iistdens
iistdesn iistdsen iistdsne iisestnd iisestdn iisesntd iisesndt iisesdnt iisesdtn iisetsnd iisetsdn
iisetnsd iisetnds iisetdns iisetdsn iisentsd iisentds iisenstd iisensdt iisendst iisendts iisedtns
iisedtsn iisednts iisednst iisedsnt iisedstn iisdsten iisdstne iisdsetn iisdsent iisdsnet iisdsnte
iisdtsen iisdtsne iisdtesn iisdtens iisdtnes iisdtnse iisdetsn iisdetns iisdestn iisdesnt iisdenst
iisdents iisdntes iisdntse iisdnets iisdnest iisdnset iisdnste iitnssed iitnssde iitnsesd iitnseds
iitnsdes iitnsdse iitnssed iitnssde iitnsesd iitnseds iitnsdes iitnsdse iitnessd iitnesds iitnessd
iitnesds iitnedss iitnedss iitndses iitndsse iitndess iitndess iitndses iitndsse iitsnsed iitsnsde
iitsnesd iitsneds iitsndes iitsndse iitssned iitssnde iitssend iitssedn iitssden iitssdne iitsesnd
iitsesdn iitsensd iitsends iitsedns iitsedsn iitsdsen iitsdsne iitsdesn iitsdens iitsdnes iitsdnse
iitssned iitssnde iitssend iitssedn iitssden iitssdne iitsnsed iitsnsde iitsnesd iitsneds iitsndes
iitsndse iitsensd iitsends iitsesnd iitsesdn iitsedsn iitsedns iitsdnes iitsdnse iitsdens iitsdesn
iitsdsen iitsdsne iitessnd iitessdn iitesnsd iitesnds iitesdns iitesdsn iitessnd iitessdn iitesnsd
iitesnds iitesdns iitesdsn iitenssd iitensds iitenssd iitensds iitendss iitendss iitedsns iitedssn
iitednss iitednss iitedsns iitedssn iitdssen iitdssne iitdsesn iitdsens iitdsnes iitdsnse iitdssen
iitdssne iitdsesn iitdsens iitdsnes iitdsnse iitdessn iitdesns iitdessn iitdesns iitdenss iitdenss
iitdnses iitdnsse iitdness iitdness iitdnses iitdnsse iienstsd iienstds iiensstd iienssdt iiensdst
iiensdts iientssd iientsds iientssd iientsds iientdss iientdss iienstsd iienstds iiensstd iienssdt
iiensdst iiensdts iiendtss iiendtss iiendsts iiendsst iiendsst iiendsts iiesntsd iiesntds iiesnstd
iiesnsdt iiesndst iiesndts iiestnsd iiestnds iiestsnd iiestsdn iiestdsn iiestdns iiesstnd iiesstdn
iiessntd iiessndt iiessdnt iiessdtn iiesdtsn iiesdtns iiesdstn iiesdsnt iiesdnst iiesdnts iietsnsd
iietsnds iietssnd iietssdn iietsdsn iietsdns iietnssd iietnsds iietnssd iietnsds iietndss iietndss
iietsnsd iietsnds iietssnd iietssdn iietsdsn iietsdns iietdnss iietdnss iietdsns iietdssn iietdssn
iietdsns iiesstnd iiesstdn iiessntd iiessndt iiessdnt iiessdtn iiestsnd iiestsdn iiestnsd iiestnds
iiestdns iiestdsn iiesntsd iiesntds iiesnstd iiesnsdt iiesndst iiesndts iiesdtns iiesdtsn iiesdnts
iiesdnst iiesdsnt iiesdstn iiedstsn iiedstns iiedsstn iiedssnt iiedsnst iiedsnts iiedtssn iiedtsns
iiedtssn iiedtsns iiedtnss iiedtnss iiedstsn iiedstns iiedsstn iiedssnt iiedsnst iiedsnts iiedntss
iiedntss iiednsts iiednsst iiednsst iiednsts iidnstes iidnstse iidnsets iidnsest iidnsset iidnsste
iidntses iidntsse iidntess iidntess iidntses iidntsse iidnetss iidnetss iidnests iidnesst iidnesst
iidnests iidnstes iidnstse iidnsets iidnsest iidnsset iidnsste iidsntes iidsntse iidsnets iidsnest
iidsnset iidsnste iidstnes iidstnse iidstens iidstesn iidstsen iidstsne iidsetns iidsetsn iidsents
iidsenst iidsesnt iidsestn iidssten iidsstne iidssetn iidssent iidssnet iidssnte iidtsnes iidtsnse
iidtsens iidtsesn iidtssen iidtssne iidtnses iidtnsse iidtness iidtness iidtnses iidtnsse iidtenss
iidtenss iidtesns iidtessn iidtessn iidtesns iidtsnes iidtsnse iidtsens iidtsesn iidtssen iidtssne
iidestns iidestsn iidesnts iidesnst iidessnt iidesstn iidetsns iidetssn iidetnss iidetnss iidetsns
iidetssn iidentss iidentss iidensts iidensst iidensst iidensts iidestns iidestsn iidesnts iidesnst
iidessnt iidesstn iidssten iidsstne iidssetn iidssent iidssnet iidssnte iidstsen iidstsne iidstesn
iidstens iidstnes iidstnse iidsetsn iidsetns iidsestn iidsesnt iidsenst iidsents iidsntes iidsntse
iidsnets iidsnest iidsnset iidsnste issinted issintde issinetd issinedt issindet issindte issitned
issitnde issitend issitedn issitden issitdne issietnd issietdn issientd issiendt issiednt issiedtn
issidten issidtne issidetn issident issidnet issidnte issnited issnitde issnietd issniedt issnidet
issnidte issntied issntide issnteid issntedi issntdei issntdie issnetid issnetdi issneitd issneidt
issnedit issnedti issndtei issndtie issndeti issndeit issndiet issndite isstnied isstnide isstneid
isstnedi isstndei isstndie isstined isstinde isstiend isstiedn isstiden isstidne issteind issteidn
isstenid isstendi isstedni isstedin isstdien isstdine isstdein isstdeni isstdnei isstdnie issentid
issentdi issenitd issenidt issendit issendti issetnid issetndi issetind issetidn issetdin issetdni
isseitnd isseitdn isseintd isseindt isseidnt isseidtn issedtin issedtni isseditn issedint issednit
issednti issdntei issdntie issdneti issdneit issdniet issdnite issdtnei issdtnie issdteni issdtein
issdtien issdtine issdetni issdetin issdenti issdenit issdeint issdeitn issditen issditne issdietn
issdient issdinet issdinte isisnted isisntde isisnetd isisnedt isisndet isisndte isistned isistnde
isistend isistedn isistden isistdne isisetnd isisetdn isisentd isisendt isisednt isisedtn isisdten
isisdtne isisdetn isisdent isisdnet isisdnte isinsted isinstde isinsetd isinsedt isinsdet isinsdte
isintsed isintsde isintesd isinteds isintdes isintdse isinetsd isinetds isinestd isinesdt isinedst
isinedts isindtes isindtse isindets isindest isindset isindste isitnsed isitnsde isitnesd isitneds
isitndes isitndse isitsned isitsnde isitsend isitsedn isitsden isitsdne isitesnd isitesdn isitensd
isitends isitedns isitedsn isitdsen isitdsne isitdesn isitdens isitdnes isitdnse isientsd isientds
isienstd isiensdt isiendst isiendts isietnsd isietnds isietsnd isietsdn isietdsn isietdns isiestnd
isiestdn isiesntd isiesndt isiesdnt isiesdtn isiedtsn isiedtns isiedstn isiedsnt isiednst isiednts
isidntes isidntse isidnets isidnest isidnset isidnste isidtnes isidtnse isidtens isidtesn isidtsen
isidtsne isidetns isidetsn isidents isidenst isidesnt isidestn isidsten isidstne isidsetn isidsent
isidsnet isidsnte isnisted isnistde isnisetd isnisedt isnisdet isnisdte isnitsed isnitsde isnitesd
isniteds isnitdes isnitdse isnietsd isnietds isniestd isniesdt isniedst isniedts isnidtes isnidtse
isnidets isnidest isnidset isnidste isnsited isnsitde isnsietd isnsiedt isnsidet isnsidte isnstied
isnstide isnsteid isnstedi isnstdei isnstdie isnsetid isnsetdi isnseitd isnseidt isnsedit isnsedti
isnsdtei isnsdtie isnsdeti isnsdeit isnsdiet isnsdite isntsied isntside isntseid isntsedi isntsdei
isntsdie isntised isntisde isntiesd isntieds isntides isntidse isnteisd isnteids isntesid isntesdi
isntedsi isntedis isntdies isntdise isntdeis isntdesi isntdsei isntdsie isnestid isnestdi isnesitd
isnesidt isnesdit isnesdti isnetsid isnetsdi isnetisd isnetids isnetdis isnetdsi isneitsd isneitds
isneistd isneisdt isneidst isneidts isnedtis isnedtsi isnedits isnedist isnedsit isnedsti isndstei
isndstie isndseti isndseit isndsiet isndsite isndtsei isndtsie isndtesi isndteis isndties isndtise
isndetsi isndetis isndesti isndesit isndeist isndeits isndites isnditse isndiets isndiest isndiset
isndiste istinsed istinsde istinesd istineds istindes istindse istisned istisnde istisend istisedn
istisden istisdne istiesnd istiesdn istiensd istiends istiedns istiedsn istidsen istidsne istidesn
istidens istidnes istidnse istnised istnisde istniesd istnieds istnides istnidse istnsied istnside
istnseid istnsedi istnsdei istnsdie istnesid istnesdi istneisd istneids istnedis istnedsi istndsei
istndsie istndesi istndeis istndies istndise istsnied istsnide istsneid istsnedi istsndei istsndie
istsined istsinde istsiend istsiedn istsiden istsidne istseind istseidn istsenid istsendi istsedni
istsedin istsdien istsdine istsdein istsdeni istsdnei istsdnie istensid istensdi istenisd istenids
istendis istendsi istesnid istesndi istesind istesidn istesdin istesdni isteisnd isteisdn isteinsd
isteinds isteidns isteidsn istedsin istedsni istedisn istedins istednis istednsi istdnsei istdnsie
istdnesi istdneis istdnies istdnise istdsnei istdsnie istdseni istdsein istdsien istdsine istdesni
istdesin istdensi istdenis istdeins istdeisn istdisen istdisne istdiesn istdiens istdines istdinse
iseintsd iseintds iseinstd iseinsdt iseindst iseindts iseitnsd iseitnds iseitsnd iseitsdn iseitdsn
iseitdns iseistnd iseistdn iseisntd iseisndt iseisdnt iseisdtn iseidtsn iseidtns iseidstn iseidsnt
iseidnst iseidnts isenitsd isenitds isenistd isenisdt isenidst isenidts isentisd isentids isentsid
isentsdi isentdsi isentdis isenstid isenstdi isensitd isensidt isensdit isensdti isendtsi isendtis
isendsti isendsit isendist isendits isetnisd isetnids isetnsid isetnsdi isetndsi isetndis isetinsd
isetinds isetisnd isetisdn isetidsn isetidns isetsind isetsidn isetsnid isetsndi isetsdni isetsdin
isetdisn isetdins isetdsin isetdsni isetdnsi isetdnis isesntid isesntdi isesnitd isesnidt isesndit
isesndti isestnid isestndi isestind isestidn isestdin isestdni isesitnd isesitdn isesintd isesindt
isesidnt isesidtn isesdtin isesdtni isesditn isesdint isesdnit isesdnti isedntsi isedntis isednsti
isednsit isednist isednits isedtnsi isedtnis isedtsni isedtsin isedtisn isedtins isedstni isedstin
isedsnti isedsnit isedsint isedsitn iseditsn iseditns isedistn isedisnt isedinst isedints isdintes
isdintse isdinets isdinest isdinset isdinste isditnes isditnse isditens isditesn isditsen isditsne
isdietns isdietsn isdients isdienst isdiesnt isdiestn isdisten isdistne isdisetn isdisent isdisnet
isdisnte isdnites isdnitse isdniets isdniest isdniset isdniste isdnties isdntise isdnteis isdntesi
isdntsei isdntsie isdnetis isdnetsi isdneits isdneist isdnesit isdnesti isdnstei isdnstie isdnseti
isdnseit isdnsiet isdnsite isdtnies isdtnise isdtneis isdtnesi isdtnsei isdtnsie isdtines isdtinse
isdtiens isdtiesn isdtisen isdtisne isdteins isdteisn isdtenis isdtensi isdtesni isdtesin isdtsien
isdtsine isdtsein isdtseni isdtsnei isdtsnie isdentis isdentsi isdenits isdenist isdensit isdensti
isdetnis isdetnsi isdetins isdetisn isdetsin isdetsni isdeitns isdeitsn isdeints isdeinst isdeisnt
isdeistn isdestin isdestni isdesitn isdesint isdesnit isdesnti isdsntei isdsntie isdsneti isdsneit
isdsniet isdsnite isdstnei isdstnie isdsteni isdstein isdstien isdstine isdsetni isdsetin isdsenti
isdsenit isdseint isdseitn isdsiten isdsitne isdsietn isdsient isdsinet isdsinte itsisned itsisnde
itsisend itsisedn itsisden itsisdne itsinsed itsinsde itsinesd itsineds itsindes itsindse itsiensd
itsiends itsiesnd itsiesdn itsiedsn itsiedns itsidnes itsidnse itsidens itsidesn itsidsen itsidsne
itssined itssinde itssiend itssiedn itssiden itssidne itssnied itssnide itssneid itssnedi itssndei
itssndie itssenid itssendi itsseind itsseidn itssedin itssedni itssdnei itssdnie itssdeni itssdein
itssdien itssdine itsnsied itsnside itsnseid itsnsedi itsnsdei itsnsdie itsnised itsnisde itsniesd
itsnieds itsnides itsnidse itsneisd itsneids itsnesid itsnesdi itsnedsi itsnedis itsndies itsndise
itsndeis itsndesi itsndsei itsndsie itsesnid itsesndi itsesind itsesidn itsesdin itsesdni itsensid
itsensdi itsenisd itsenids itsendis itsendsi itseinsd itseinds itseisnd itseisdn itseidsn itseidns
itsednis itsednsi itsedins itsedisn itsedsin itsedsni itsdsnei itsdsnie itsdseni itsdsein itsdsien
itsdsine itsdnsei itsdnsie itsdnesi itsdneis itsdnies itsdnise itsdensi itsdenis itsdesni itsdesin
itsdeisn itsdeins itsdines itsdinse itsdiens itsdiesn itsdisen itsdisne itissned itissnde itissend
itissedn itissden itissdne itisnsed itisnsde itisnesd itisneds itisndes itisndse itisensd itisends
itisesnd itisesdn itisedsn itisedns itisdnes itisdnse itisdens itisdesn itisdsen itisdsne itissned
itissnde itissend itissedn itissden itissdne itisnsed itisnsde itisnesd itisneds itisndes itisndse
itisensd itisends itisesnd itisesdn itisedsn itisedns itisdnes itisdnse itisdens itisdesn itisdsen
itisdsne itinssed itinssde itinsesd itinseds itinsdes itinsdse itinssed itinssde itinsesd itinseds
itinsdes itinsdse itinessd itinesds itinessd itinesds itinedss itinedss itindses itindsse itindess
itindess itindses itindsse itiesnsd itiesnds itiessnd itiessdn itiesdsn itiesdns itienssd itiensds
itienssd itiensds itiendss itiendss itiesnsd itiesnds itiessnd itiessdn itiesdsn itiesdns itiednss
itiednss itiedsns itiedssn itiedssn itiedsns itidsnes itidsnse itidsens itidsesn itidssen itidssne
itidnses itidnsse itidness itidness itidnses itidnsse itidenss itidenss itidesns itidessn itidessn
itidesns itidsnes itidsnse itidsens itidsesn itidssen itidssne itsisned itsisnde itsisend itsisedn
itsisden itsisdne itsinsed itsinsde itsinesd itsineds itsindes itsindse itsiensd itsiends itsiesnd
itsiesdn itsiedsn itsiedns itsidnes itsidnse itsidens itsidesn itsidsen itsidsne itssined itssinde
itssiend itssiedn itssiden itssidne itssnied itssnide itssneid itssnedi itssndei itssndie itssenid
itssendi itsseind itsseidn itssedin itssedni itssdnei itssdnie itssdeni itssdein itssdien itssdine
itsnsied itsnside itsnseid itsnsedi itsnsdei itsnsdie itsnised itsnisde itsniesd itsnieds itsnides
itsnidse itsneisd itsneids itsnesid itsnesdi itsnedsi itsnedis itsndies itsndise itsndeis itsndesi
itsndsei itsndsie itsesnid itsesndi itsesind itsesidn itsesdin itsesdni itsensid itsensdi itsenisd
itsenids itsendis itsendsi itseinsd itseinds itseisnd itseisdn itseidsn itseidns itsednis itsednsi
itsedins itsedisn itsedsin itsedsni itsdsnei itsdsnie itsdseni itsdsein itsdsien itsdsine itsdnsei
itsdnsie itsdnesi itsdneis itsdnies itsdnise itsdensi itsdenis itsdesni itsdesin itsdeisn itsdeins
itsdines itsdinse itsdiens itsdiesn itsdisen itsdisne itnissed itnissde itnisesd itniseds itnisdes
itnisdse itnissed itnissde itnisesd itniseds itnisdes itnisdse itniessd itniesds itniessd itniesds
itniedss itniedss itnidses itnidsse itnidess itnidess itnidses itnidsse itnsised itnsisde itnsiesd
itnsieds itnsides itnsidse itnssied itnsside itnsseid itnssedi itnssdei itnssdie itnsesid itnsesdi
itnseisd itnseids itnsedis itnsedsi itnsdsei itnsdsie itnsdesi itnsdeis itnsdies itnsdise itnssied
itnsside itnsseid itnssedi itnssdei itnssdie itnsised itnsisde itnsiesd itnsieds itnsides itnsidse
itnseisd itnseids itnsesid itnsesdi itnsedsi itnsedis itnsdies itnsdise itnsdeis itnsdesi itnsdsei
itnsdsie itnessid itnessdi itnesisd itnesids itnesdis itnesdsi itnessid itnessdi itnesisd itnesids
itnesdis itnesdsi itneissd itneisds itneissd itneisds itneidss itneidss itnedsis itnedssi itnediss
itnediss itnedsis itnedssi itndssei itndssie itndsesi itndseis itndsies itndsise itndssei itndssie
itndsesi itndseis itndsies itndsise itndessi itndesis itndessi itndesis itndeiss itndeiss itndises
itndisse itndiess itndiess itndises itndisse iteisnsd iteisnds iteissnd iteissdn iteisdsn iteisdns
iteinssd iteinsds iteinssd iteinsds iteindss iteindss iteisnsd iteisnds iteissnd iteissdn iteisdsn
iteisdns iteidnss iteidnss iteidsns iteidssn iteidssn iteidsns itesinsd itesinds itesisnd itesisdn
itesidsn itesidns itesnisd itesnids itesnsid itesnsdi itesndsi itesndis itessnid itessndi itessind
itessidn itessdin itessdni itesdnsi itesdnis itesdsni itesdsin itesdisn itesdins itensisd itensids
itenssid itenssdi itensdsi itensdis itenissd itenisds itenissd itenisds itenidss itenidss itensisd
itensids itenssid itenssdi itensdsi itensdis itendiss itendiss itendsis itendssi itendssi itendsis
itessnid itessndi itessind itessidn itessdin itessdni itesnsid itesnsdi itesnisd itesnids itesndis
itesndsi itesinsd itesinds itesisnd itesisdn itesidsn itesidns itesdnis itesdnsi itesdins itesdisn
itesdsin itesdsni itedsnsi itedsnis itedssni itedssin itedsisn itedsins itednssi itednsis itednssi
itednsis itedniss itedniss itedsnsi itedsnis itedssni itedssin itedsisn itedsins itedinss itedinss
itedisns itedissn itedissn itedisns itdisnes itdisnse itdisens itdisesn itdissen itdissne itdinses
itdinsse itdiness itdiness itdinses itdinsse itdienss itdienss itdiesns itdiessn itdiessn itdiesns
itdisnes itdisnse itdisens itdisesn itdissen itdissne itdsines itdsinse itdsiens itdsiesn itdsisen
itdsisne itdsnies itdsnise itdsneis itdsnesi itdsnsei itdsnsie itdsenis itdsensi itdseins itdseisn
itdsesin itdsesni itdssnei itdssnie itdsseni itdssein itdssien itdssine itdnsies itdnsise itdnseis
itdnsesi itdnssei itdnssie itdnises itdnisse itdniess itdniess itdnises itdnisse itdneiss itdneiss
itdnesis itdnessi itdnessi itdnesis itdnsies itdnsise itdnseis itdnsesi itdnssei itdnssie itdesnis
itdesnsi itdesins itdesisn itdessin itdessni itdensis itdenssi itdeniss itdeniss itdensis itdenssi
itdeinss itdeinss itdeisns itdeissn itdeissn itdeisns itdesnis itdesnsi itdesins itdesisn itdessin
itdessni itdssnei itdssnie itdsseni itdssein itdssien itdssine itdsnsei itdsnsie itdsnesi itdsneis
itdsnies itdsnise itdsensi itdsenis itdsesni itdsesin itdseisn itdseins itdsines itdsinse itdsiens
itdsiesn itdsisen itdsisne iesistnd iesistdn iesisntd iesisndt iesisdnt iesisdtn iesitsnd iesitsdn
iesitnsd iesitnds iesitdns iesitdsn iesintsd iesintds iesinstd iesinsdt iesindst iesindts iesidtns
iesidtsn iesidnts iesidnst iesidsnt iesidstn iessitnd iessitdn iessintd iessindt iessidnt iessidtn
iesstind iesstidn iesstnid iesstndi iesstdni iesstdin iessntid iessntdi iessnitd iessnidt iessndit
iessndti iessdtni iessdtin iessdnti iessdnit iessdint iessditn iestsind iestsidn iestsnid iestsndi
iestsdni iestsdin iestisnd iestisdn iestinsd iestinds iestidns iestidsn iestnisd iestnids iestnsid
iestnsdi iestndsi iestndis iestdins iestdisn iestdnis iestdnsi iestdsni iestdsin iesnstid iesnstdi
iesnsitd iesnsidt iesnsdit iesnsdti iesntsid iesntsdi iesntisd iesntids iesntdis iesntdsi iesnitsd
iesnitds iesnistd iesnisdt iesnidst iesnidts iesndtis iesndtsi iesndits iesndist iesndsit iesndsti
iesdstni iesdstin iesdsnti iesdsnit iesdsint iesdsitn iesdtsni iesdtsin iesdtnsi iesdtnis iesdtins
iesdtisn iesdntsi iesdntis iesdnsti iesdnsit iesdnist iesdnits iesditns iesditsn iesdints iesdinst
iesdisnt iesdistn ieisstnd ieisstdn ieissntd ieissndt ieissdnt ieissdtn ieistsnd ieistsdn ieistnsd
ieistnds ieistdns ieistdsn ieisntsd ieisntds ieisnstd ieisnsdt ieisndst ieisndts ieisdtns ieisdtsn
ieisdnts ieisdnst ieisdsnt ieisdstn ieisstnd ieisstdn ieissntd ieissndt ieissdnt ieissdtn ieistsnd
ieistsdn ieistnsd ieistnds ieistdns ieistdsn ieisntsd ieisntds ieisnstd ieisnsdt ieisndst ieisndts
ieisdtns ieisdtsn ieisdnts ieisdnst ieisdsnt ieisdstn ieitssnd ieitssdn ieitsnsd ieitsnds ieitsdns
ieitsdsn ieitssnd ieitssdn ieitsnsd ieitsnds ieitsdns ieitsdsn ieitnssd ieitnsds ieitnssd ieitnsds
ieitndss ieitndss ieitdsns ieitdssn ieitdnss ieitdnss ieitdsns ieitdssn ieinstsd ieinstds ieinsstd
ieinssdt ieinsdst ieinsdts ieintssd ieintsds ieintssd ieintsds ieintdss ieintdss ieinstsd ieinstds
ieinsstd ieinssdt ieinsdst ieinsdts ieindtss ieindtss ieindsts ieindsst ieindsst ieindsts ieidstns
ieidstsn ieidsnts ieidsnst ieidssnt ieidsstn ieidtsns ieidtssn ieidtnss ieidtnss ieidtsns ieidtssn
ieidntss ieidntss ieidnsts ieidnsst ieidnsst ieidnsts ieidstns ieidstsn ieidsnts ieidsnst ieidssnt
ieidsstn iesistnd iesistdn iesisntd iesisndt iesisdnt iesisdtn iesitsnd iesitsdn iesitnsd iesitnds
iesitdns iesitdsn iesintsd iesintds iesinstd iesinsdt iesindst iesindts iesidtns iesidtsn iesidnts
iesidnst iesidsnt iesidstn iessitnd iessitdn iessintd iessindt iessidnt iessidtn iesstind iesstidn
iesstnid iesstndi iesstdni iesstdin iessntid iessntdi iessnitd iessnidt iessndit iessndti iessdtni
iessdtin iessdnti iessdnit iessdint iessditn iestsind iestsidn iestsnid iestsndi iestsdni iestsdin
iestisnd iestisdn iestinsd iestinds iestidns iestidsn iestnisd iestnids iestnsid iestnsdi iestndsi
iestndis iestdins iestdisn iestdnis iestdnsi iestdsni iestdsin iesnstid iesnstdi iesnsitd iesnsidt
iesnsdit iesnsdti iesntsid iesntsdi iesntisd iesntids iesntdis iesntdsi iesnitsd iesnitds iesnistd
iesnisdt iesnidst iesnidts iesndtis iesndtsi iesndits iesndist iesndsit iesndsti iesdstni iesdstin
iesdsnti iesdsnit iesdsint iesdsitn iesdtsni iesdtsin iesdtnsi iesdtnis iesdtins iesdtisn iesdntsi
iesdntis iesdnsti iesdnsit iesdnist iesdnits iesditns iesditsn iesdints iesdinst iesdisnt iesdistn
ietissnd ietissdn ietisnsd ietisnds ietisdns ietisdsn ietissnd ietissdn ietisnsd ietisnds ietisdns
ietisdsn ietinssd ietinsds ietinssd ietinsds ietindss ietindss ietidsns ietidssn ietidnss ietidnss
ietidsns ietidssn ietsisnd ietsisdn ietsinsd ietsinds ietsidns ietsidsn ietssind ietssidn ietssnid
ietssndi ietssdni ietssdin ietsnsid ietsnsdi ietsnisd ietsnids ietsndis ietsndsi ietsdsni ietsdsin
ietsdnsi ietsdnis ietsdins ietsdisn ietssind ietssidn ietssnid ietssndi ietssdni ietssdin ietsisnd
ietsisdn ietsinsd ietsinds ietsidns ietsidsn ietsnisd ietsnids ietsnsid ietsnsdi ietsndsi ietsndis
ietsdins ietsdisn ietsdnis ietsdnsi ietsdsni ietsdsin ietnssid ietnssdi ietnsisd ietnsids ietnsdis
ietnsdsi ietnssid ietnssdi ietnsisd ietnsids ietnsdis ietnsdsi ietnissd ietnisds ietnissd ietnisds
ietnidss ietnidss ietndsis ietndssi ietndiss ietndiss ietndsis ietndssi ietdssni ietdssin ietdsnsi
ietdsnis ietdsins ietdsisn ietdssni ietdssin ietdsnsi ietdsnis ietdsins ietdsisn ietdnssi ietdnsis
ietdnssi ietdnsis ietdniss ietdniss ietdisns ietdissn ietdinss ietdinss ietdisns ietdissn ienistsd
ienistds ienisstd ienissdt ienisdst ienisdts ienitssd ienitsds ienitssd ienitsds ienitdss ienitdss
ienistsd ienistds ienisstd ienissdt ienisdst ienisdts ienidtss ienidtss ienidsts ienidsst ienidsst
ienidsts iensitsd iensitds iensistd iensisdt iensidst iensidts ienstisd ienstids ienstsid ienstsdi
ienstdsi ienstdis iensstid iensstdi ienssitd ienssidt ienssdit ienssdti iensdtsi iensdtis iensdsti
iensdsit iensdist iensdits ientsisd ientsids ientssid ientssdi ientsdsi ientsdis ientissd ientisds
ientissd ientisds ientidss ientidss ientsisd ientsids ientssid ientssdi ientsdsi ientsdis ientdiss
ientdiss ientdsis ientdssi ientdssi ientdsis iensstid iensstdi ienssitd ienssidt ienssdit ienssdti
ienstsid ienstsdi ienstisd ienstids ienstdis ienstdsi iensitsd iensitds iensistd iensisdt iensidst
iensidts iensdtis iensdtsi iensdits iensdist iensdsit iensdsti iendstsi iendstis iendssti iendssit
iendsist iendsits iendtssi iendtsis iendtssi iendtsis iendtiss iendtiss iendstsi iendstis iendssti
iendssit iendsist iendsits ienditss ienditss iendists iendisst iendisst iendists iedistns iedistsn
iedisnts iedisnst iedissnt iedisstn ieditsns ieditssn ieditnss ieditnss ieditsns ieditssn iedintss
iedintss iedinsts iedinsst iedinsst iedinsts iedistns iedistsn iedisnts iedisnst iedissnt iedisstn
iedsitns iedsitsn iedsints iedsinst iedsisnt iedsistn iedstins iedstisn iedstnis iedstnsi iedstsni
iedstsin iedsntis iedsntsi iedsnits iedsnist iedsnsit iedsnsti iedsstni iedsstin iedssnti iedssnit
iedssint iedssitn iedtsins iedtsisn iedtsnis iedtsnsi iedtssni iedtssin iedtisns iedtissn iedtinss
iedtinss iedtisns iedtissn iedtniss iedtniss iedtnsis iedtnssi iedtnssi iedtnsis iedtsins iedtsisn
iedtsnis iedtsnsi iedtssni iedtssin iednstis iednstsi iednsits iednsist iednssit iednssti iedntsis
iedntssi iedntiss iedntiss iedntsis iedntssi iednitss iednitss iednists iednisst iednisst iednists
iednstis iednstsi iednsits iednsist iednssit iednssti iedsstni iedsstin iedssnti iedssnit iedssint
iedssitn iedstsni iedstsin iedstnsi iedstnis iedstins iedstisn iedsntsi iedsntis iedsnsti iedsnsit
iedsnist iedsnits iedsitns iedsitsn iedsints iedsinst iedsisnt iedsistn idsisten idsistne idsisetn
idsisent idsisnet idsisnte idsitsen idsitsne idsitesn idsitens idsitnes idsitnse idsietsn idsietns
idsiestn idsiesnt idsienst idsients idsintes idsintse idsinets idsinest idsinset idsinste idssiten
idssitne idssietn idssient idssinet idssinte idsstien idsstine idsstein idssteni idsstnei idsstnie
idssetin idssetni idsseitn idsseint idssenit idssenti idssntei idssntie idssneti idssneit idssniet
idssnite idstsien idstsine idstsein idstseni idstsnei idstsnie idstisen idstisne idstiesn idstiens
idstines idstinse idsteisn idsteins idstesin idstesni idstensi idstenis idstnies idstnise idstneis
idstnesi idstnsei idstnsie idsestin idsestni idsesitn idsesint idsesnit idsesnti idsetsin idsetsni
idsetisn idsetins idsetnis idsetnsi idseitsn idseitns idseistn idseisnt idseinst idseints idsentis
idsentsi idsenits idsenist idsensit idsensti idsnstei idsnstie idsnseti idsnseit idsnsiet idsnsite
idsntsei idsntsie idsntesi idsnteis idsnties idsntise idsnetsi idsnetis idsnesti idsnesit idsneist
idsneits idsnites idsnitse idsniets idsniest idsniset idsniste idissten idisstne idissetn idissent
idissnet idissnte idistsen idistsne idistesn idistens idistnes idistnse idisetsn idisetns idisestn
idisesnt idisenst idisents idisntes idisntse idisnets idisnest idisnset idisnste idissten idisstne
idissetn idissent idissnet idissnte idistsen idistsne idistesn idistens idistnes idistnse idisetsn
idisetns idisestn idisesnt idisenst idisents idisntes idisntse idisnets idisnest idisnset idisnste
iditssen iditssne iditsesn iditsens iditsnes iditsnse iditssen iditssne iditsesn iditsens iditsnes
iditsnse iditessn iditesns iditessn iditesns iditenss iditenss iditnses iditnsse iditness iditness
iditnses iditnsse idiestsn idiestns idiesstn idiessnt idiesnst idiesnts idietssn idietsns idietssn
idietsns idietnss idietnss idiestsn idiestns idiesstn idiessnt idiesnst idiesnts idientss idientss
idiensts idiensst idiensst idiensts idinstes idinstse idinsets idinsest idinsset idinsste idintses
idintsse idintess idintess idintses idintsse idinetss idinetss idinests idinesst idinesst idinests
idinstes idinstse idinsets idinsest idinsset idinsste idsisten idsistne idsisetn idsisent idsisnet
idsisnte idsitsen idsitsne idsitesn idsitens idsitnes idsitnse idsietsn idsietns idsiestn idsiesnt
idsienst idsients idsintes idsintse idsinets idsinest idsinset idsinste idssiten idssitne idssietn
idssient idssinet idssinte idsstien idsstine idsstein idssteni idsstnei idsstnie idssetin idssetni
idsseitn idsseint idssenit idssenti idssntei idssntie idssneti idssneit idssniet idssnite idstsien
idstsine idstsein idstseni idstsnei idstsnie idstisen idstisne idstiesn idstiens idstines idstinse
idsteisn idsteins idstesin idstesni idstensi idstenis idstnies idstnise idstneis idstnesi idstnsei
idstnsie idsestin idsestni idsesitn idsesint idsesnit idsesnti idsetsin idsetsni idsetisn idsetins
idsetnis idsetnsi idseitsn idseitns idseistn idseisnt idseinst idseints idsentis idsentsi idsenits
idsenist idsensit idsensti idsnstei idsnstie idsnseti idsnseit idsnsiet idsnsite idsntsei idsntsie
idsntesi idsnteis idsnties idsntise idsnetsi idsnetis idsnesti idsnesit idsneist idsneits idsnites
idsnitse idsniets idsniest idsniset idsniste idtissen idtissne idtisesn idtisens idtisnes idtisnse
idtissen idtissne idtisesn idtisens idtisnes idtisnse idtiessn idtiesns idtiessn idtiesns idtienss
idtienss idtinses idtinsse idtiness idtiness idtinses idtinsse idtsisen idtsisne idtsiesn idtsiens
idtsines idtsinse idtssien idtssine idtssein idtsseni idtssnei idtssnie idtsesin idtsesni idtseisn
idtseins idtsenis idtsensi idtsnsei idtsnsie idtsnesi idtsneis idtsnies idtsnise idtssien idtssine
idtssein idtsseni idtssnei idtssnie idtsisen idtsisne idtsiesn idtsiens idtsines idtsinse idtseisn
idtseins idtsesin idtsesni idtsensi idtsenis idtsnies idtsnise idtsneis idtsnesi idtsnsei idtsnsie
idtessin idtessni idtesisn idtesins idtesnis idtesnsi idtessin idtessni idtesisn idtesins idtesnis
idtesnsi idteissn idteisns idteissn idteisns idteinss idteinss idtensis idtenssi idteniss idteniss
idtensis idtenssi idtnssei idtnssie idtnsesi idtnseis idtnsies idtnsise idtnssei idtnssie idtnsesi
idtnseis idtnsies idtnsise idtnessi idtnesis idtnessi idtnesis idtneiss idtneiss idtnises idtnisse
idtniess idtniess idtnises idtnisse ideistsn ideistns ideisstn ideissnt ideisnst ideisnts ideitssn
ideitsns ideitssn ideitsns ideitnss ideitnss ideistsn ideistns ideisstn ideissnt ideisnst ideisnts
ideintss ideintss ideinsts ideinsst ideinsst ideinsts idesitsn idesitns idesistn idesisnt idesinst
idesints idestisn idestins idestsin idestsni idestnsi idestnis idesstin idesstni idessitn idessint
idessnit idessnti idesntsi idesntis idesnsti idesnsit idesnist idesnits idetsisn idetsins idetssin
idetssni idetsnsi idetsnis idetissn idetisns idetissn idetisns idetinss idetinss idetsisn idetsins
idetssin idetssni idetsnsi idetsnis idetniss idetniss idetnsis idetnssi idetnssi idetnsis idesstin
idesstni idessitn idessint idessnit idessnti idestsin idestsni idestisn idestins idestnis idestnsi
idesitsn idesitns idesistn idesisnt idesinst idesints idesntis idesntsi idesnits idesnist idesnsit
idesnsti idenstsi idenstis idenssti idenssit idensist idensits identssi identsis identssi identsis
identiss identiss idenstsi idenstis idenssti idenssit idensist idensits idenitss idenitss idenists
idenisst idenisst idenists idnistes idnistse idnisets idnisest idnisset idnisste idnitses idnitsse
idnitess idnitess idnitses idnitsse idnietss idnietss idniests idniesst idniesst idniests idnistes
idnistse idnisets idnisest idnisset idnisste idnsites idnsitse idnsiets idnsiest idnsiset idnsiste
idnsties idnstise idnsteis idnstesi idnstsei idnstsie idnsetis idnsetsi idnseits idnseist idnsesit
idnsesti idnsstei idnsstie idnsseti idnsseit idnssiet idnssite idntsies idntsise idntseis idntsesi
idntssei idntssie idntises idntisse idntiess idntiess idntises idntisse idnteiss idnteiss idntesis
idntessi idntessi idntesis idntsies idntsise idntseis idntsesi idntssei idntssie idnestis idnestsi
idnesits idnesist idnessit idnessti idnetsis idnetssi idnetiss idnetiss idnetsis idnetssi idneitss
idneitss idneists idneisst idneisst idneists idnestis idnestsi idnesits idnesist idnessit idnessti
idnsstei idnsstie idnsseti idnsseit idnssiet idnssite idnstsei idnstsie idnstesi idnsteis idnsties
idnstise idnsetsi idnsetis idnsesti idnsesit idnseist idnseits idnsites idnsitse idnsiets idnsiest
idnsiset idnsiste

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us