easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

adfaturque

urinemia

ounce

hpwalt

thwackstave

suppletory

tenderers

bromethylene

helzer

hpwadcn

rideau

scutation

rectitudes

branches

ragen

auctorizo

moveatis

squanto


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: impederem
cipher variations:
jnqfefsfn korgfgtgo lpshghuhp mqtihiviq nrujijwjr
osvkjkxks ptwlklylt quxmlmzmu rvynmnanv swzonobow
txapopcpx uybqpqdqy vzcrqrerz wadsrsfsa xbetstgtb
ycfutuhuc zdgvuvivd aehwvwjwe bfixwxkxf cgjyxylyg
dhkzyzmzh eilazanai fjmbabobj gkncbcpck hlodcdqdl

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: impederem
Cipher: rnkvwvivn

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: impederem
Cipher: ABAAA ABABB ABBBA AABAA AAABB AABAA BAAAA AABAA ABABB

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: impederem
cipher variations:
jnqfefsfnzlunknanlpjyvqvivjfhcdwdqdhvfglclylfldktitgtdrzsjujwjzhxwrarerx
xvazgzmzvntehmhuhtdripspcprtpmxyxkxpkorgfgtgoamvolobomqkzwrwjwkgidexerei
wghmdmzmgmelujuhuesatkvkxkaiyxsbsfsyywbahanawoufiniviuesjqtqdqsuqnyzylyq
lpshghuhpbnwpmpcpnrlaxsxkxlhjefyfsfjxhinenanhnfmvkvivftbulwlylbjzytctgtz
zxcbibobxpvgjojwjvftkrurertvrozazmzrmqtihiviqcoxqnqdqosmbytylymikfgzgtgk
yijofoboiognwlwjwgucvmxmzmckazuduhuaaydcjcpcyqwhkpkxkwgulsvsfsuwspabanas
nrujijwjrdpyrorerptnczuzmznjlghahuhlzjkpgpcpjphoxmxkxhvdwnynandlbavevivb
bzedkdqdzrxilqlylxhvmtwtgtvxtqbcbobtosvkjkxkseqzspsfsquodavanaokmhibivim
aklqhqdqkqipynylyiwexozoboemcbwfwjwccafelereasyjmrmzmyiwnuxuhuwyurcdcpcu
ptwlklyltfratqtgtrvpebwbobplnijcjwjnblmrirerlrjqzozmzjxfypapcpfndcxgxkxd
dbgfmfsfbtzknsnanzjxovyvivxzvsdedqdvquxmlmzmugsburuhuswqfcxcpcqmojkdkxko
cmnsjsfsmskrapanakygzqbqdqgoedyhylyeechgngtgcualotoboakypwzwjwyawteferew
rvynmnanvhtcvsvivtxrgdydqdrnpklelylpdnotktgtntlsbqboblzharcrerhpfezizmzf
fdihohuhdvbmpupcpblzqxaxkxzbxufgfsfxswzonobowiudwtwjwuyshezeresoqlmfmzmq
eopuluhuoumtcrcpcmaibsdsfsiqgfajanaggejipiviewcnqvqdqcmarybylyacyvghgtgy
txapopcpxjvexuxkxvztifafsftprmngnanrfpqvmvivpvnudsdqdnbjctetgtjrhgbkbobh
hfkjqjwjfxdorwrerdnbszczmzbdzwhihuhzuybqpqdqykwfyvylywaujgbgtguqsnohobos
gqrwnwjwqwovetereockdufuhuksihclcpciiglkrkxkgyepsxsfseoctadanaceaxijivia
vzcrqrerzlxgzwzmzxbvkhchuhvrtopipcpthrsxoxkxrxpwfufsfpdlevgvivltjidmdqdj
jhmlslylhzfqtytgtfpdubebobdfbyjkjwjbwadsrsfsamyhaxanaycwlidiviwsupqjqdqu
istypylysyqxgvgtgqemfwhwjwmukjenerekkinmtmzmiagruzuhugqevcfcpcegczklkxkc
xbetstgtbnzibybobzdxmjejwjxtvqrkrervjtuzqzmztzryhwhuhrfngxixkxnvlkfofsfl
ljonunanjbhsvavivhrfwdgdqdfhdalmlyldycfutuhucoajczcpcaeynkfkxkyuwrslsfsw
kuvaranauaszixivisgohyjylyowmlgpgtgmmkpovobokcitwbwjwisgxeheregiebmnmzme
zdgvuvivdpbkdadqdbfzolglylzvxstmtgtxlvwbsbobvbtajyjwjthpizkzmzpxnmhqhuhn
nlqpwpcpldjuxcxkxjthyfifsfhjfcnonanfaehwvwjweqcleberecgapmhmzmawytunuhuy
mwxctcpcwcubkzkxkuiqjalanaqyonirivioomrqxqdqmekvydylykuizgjgtgikgdopobog
bfixwxkxfrdmfcfsfdhbqninanbxzuvovivznxydudqdxdvclalylvjrkbmbobrzpojsjwjp
pnsryrernflwzezmzlvjahkhuhjlhepqpcphcgjyxylygsengdgtgeicrojobocyavwpwjwa
oyzevereyewdmbmzmwkslcncpcsaqpktkxkqqotszsfsogmxafanamwkbilivikmifqrqdqi
dhkzyzmzhtfohehuhfjdspkpcpdzbwxqxkxbpzafwfsfzfxencnanxltmdodqdtbrqlulylr
rputatgtphnybgbobnxlcjmjwjlnjgrsrerjeilazanaiugpifivigketqlqdqeacxyrylyc
qabgxgtgagyfodoboymunepereucsrmvmzmssqvubuhuqiozchcpcoymdknkxkmokhstsfsk
fjmbabobjvhqjgjwjhlfurmrerfbdyzszmzdrbchyhuhbhzgpepcpznvofqfsfvdtsnwnant
trwvcvivrjpadidqdpznelolylnplitutgtlgkncbcpckwirkhkxkimgvsnsfsgcezatanae
scdiziviciahqfqdqaowpgrgtgweutoxobouusxwdwjwskqbejereqaofmpmzmoqmjuvuhum
hlodcdqdlxjslilyljnhwtotgthdfabubobftdejajwjdjbirgrerbpxqhshuhxfvupypcpv
vtyxexkxtlrcfkfsfrbpgnqnanprnkvwvivnimpederemyktmjmzmkoixupuhuiegbcvcpcg
uefkbkxkekcjshsfscqyritiviygwvqzqdqwwuzyfylyumsdglgtgscqhoroboqsolwxwjwo

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: impederem
Cipher: vzcrqrerz

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: impederem
Cipher: 422353514151245123

Extended Methods:
Method #1

Plaintext: impederem
method variations:
orukikwkrtwzpopbpwybeutugubdgkzyzmzg

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
i m p e d e r e m 
4 2 5 5 4 5 2 5 2 
2 3 3 1 1 1 4 1 3 
They are then read out in rows:
425545252233111413
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: impederem
Cipher: izywgnaql

Read more ...
Method #3

Plaintext: impederem
method variations:
gxxqvfyfs xxqvfyfsg xqvfyfsgx
qvfyfsgxx vfyfsgxxq fyfsgxxqv
yfsgxxqvf fsgxxqvfy sgxxqvfyf

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: impederem

first 5040 cipher variations(362880 total)
impederem impederme impedeerm impedeemr impedemer impedemre impedreem impedreme impedreem impedreme impedrmee
impedrmee impederem impederme impedeerm impedeemr impedemer impedemre impedmree impedmree impedmere impedmeer
impedmeer impedmere impeedrem impeedrme impeederm impeedemr impeedmer impeedmre impeerdem impeerdme impeeredm
impeeremd impeermed impeermde impeeerdm impeeermd impeeedrm impeeedmr impeeemdr impeeemrd impeemred impeemrde
impeemerd impeemedr impeemder impeemdre imperedem imperedme impereedm impereemd imperemed imperemde imperdeem
imperdeme imperdeem imperdeme imperdmee imperdmee imperedem imperedme impereedm impereemd imperemed imperemde
impermdee impermdee impermede impermeed impermeed impermede impeeerdm impeeermd impeeedrm impeeedmr impeeemdr
impeeemrd impeeredm impeeremd impeerdem impeerdme impeermde impeermed impeedrem impeedrme impeederm impeedemr
impeedmer impeedmre impeemrde impeemred impeemdre impeemder impeemedr impeemerd impemered impemerde impemeerd
impemeedr impemeder impemedre impemreed impemrede impemreed impemrede impemrdee impemrdee impemered impemerde
impemeerd impemeedr impemeder impemedre impemdree impemdree impemdere impemdeer impemdeer impemdere impdeerem
impdeerme impdeeerm impdeeemr impdeemer impdeemre impdereem impdereme impdereem impdereme impdermee impdermee
impdeerem impdeerme impdeeerm impdeeemr impdeemer impdeemre impdemree impdemree impdemere impdemeer impdemeer
impdemere impdeerem impdeerme impdeeerm impdeeemr impdeemer impdeemre impdereem impdereme impdereem impdereme
impdermee impdermee impdeerem impdeerme impdeeerm impdeeemr impdeemer impdeemre impdemree impdemree impdemere
impdemeer impdemeer impdemere impdreeem impdreeme impdreeem impdreeme impdremee impdremee impdreeem impdreeme
impdreeem impdreeme impdremee impdremee impdreeem impdreeme impdreeem impdreeme impdremee impdremee impdrmeee
impdrmeee impdrmeee impdrmeee impdrmeee impdrmeee impdeerem impdeerme impdeeerm impdeeemr impdeemer impdeemre
impdereem impdereme impdereem impdereme impdermee impdermee impdeerem impdeerme impdeeerm impdeeemr impdeemer
impdeemre impdemree impdemree impdemere impdemeer impdemeer impdemere impdmeree impdmeree impdmeere impdmeeer
impdmeeer impdmeere impdmreee impdmreee impdmreee impdmreee impdmreee impdmreee impdmeree impdmeree impdmeere
impdmeeer impdmeeer impdmeere impdmeree impdmeree impdmeere impdmeeer impdmeeer impdmeere impederem impederme
impedeerm impedeemr impedemer impedemre impedreem impedreme impedreem impedreme impedrmee impedrmee impederem
impederme impedeerm impedeemr impedemer impedemre impedmree impedmree impedmere impedmeer impedmeer impedmere
impeedrem impeedrme impeederm impeedemr impeedmer impeedmre impeerdem impeerdme impeeredm impeeremd impeermed
impeermde impeeerdm impeeermd impeeedrm impeeedmr impeeemdr impeeemrd impeemred impeemrde impeemerd impeemedr
impeemder impeemdre imperedem imperedme impereedm impereemd imperemed imperemde imperdeem imperdeme imperdeem
imperdeme imperdmee imperdmee imperedem imperedme impereedm impereemd imperemed imperemde impermdee impermdee
impermede impermeed impermeed impermede impeeerdm impeeermd impeeedrm impeeedmr impeeemdr impeeemrd impeeredm
impeeremd impeerdem impeerdme impeermde impeermed impeedrem impeedrme impeederm impeedemr impeedmer impeedmre
impeemrde impeemred impeemdre impeemder impeemedr impeemerd impemered impemerde impemeerd impemeedr impemeder
impemedre impemreed impemrede impemreed impemrede impemrdee impemrdee impemered impemerde impemeerd impemeedr
impemeder impemedre impemdree impemdree impemdere impemdeer impemdeer impemdere imprdeeem imprdeeme imprdeeem
imprdeeme imprdemee imprdemee imprdeeem imprdeeme imprdeeem imprdeeme imprdemee imprdemee imprdeeem imprdeeme
imprdeeem imprdeeme imprdemee imprdemee imprdmeee imprdmeee imprdmeee imprdmeee imprdmeee imprdmeee impredeem
impredeme impredeem impredeme impredmee impredmee impreedem impreedme impreeedm impreeemd impreemed impreemde
impreeedm impreeemd impreedem impreedme impreemde impreemed impremeed impremede impremeed impremede impremdee
impremdee impreedem impreedme impreeedm impreeemd impreemed impreemde impredeem impredeme impredeem impredeme
impredmee impredmee impreedem impreedme impreeedm impreeemd impreemed impreemde impremdee impremdee impremede
impremeed impremeed impremede impreeedm impreeemd impreedem impreedme impreemde impreemed impreeedm impreeemd
impreedem impreedme impreemde impreemed impredeem impredeme impredeem impredeme impredmee impredmee impremede
impremeed impremdee impremdee impremede impremeed imprmeeed imprmeede imprmeeed imprmeede imprmedee imprmedee
imprmeeed imprmeede imprmeeed imprmeede imprmedee imprmedee imprmeeed imprmeede imprmeeed imprmeede imprmedee
imprmedee imprmdeee imprmdeee imprmdeee imprmdeee imprmdeee imprmdeee impederem impederme impedeerm impedeemr
impedemer impedemre impedreem impedreme impedreem impedreme impedrmee impedrmee impederem impederme impedeerm
impedeemr impedemer impedemre impedmree impedmree impedmere impedmeer impedmeer impedmere impeedrem impeedrme
impeederm impeedemr impeedmer impeedmre impeerdem impeerdme impeeredm impeeremd impeermed impeermde impeeerdm
impeeermd impeeedrm impeeedmr impeeemdr impeeemrd impeemred impeemrde impeemerd impeemedr impeemder impeemdre
imperedem imperedme impereedm impereemd imperemed imperemde imperdeem imperdeme imperdeem imperdeme imperdmee
imperdmee imperedem imperedme impereedm impereemd imperemed imperemde impermdee impermdee impermede impermeed
impermeed impermede impeeerdm impeeermd impeeedrm impeeedmr impeeemdr impeeemrd impeeredm impeeremd impeerdem
impeerdme impeermde impeermed impeedrem impeedrme impeederm impeedemr impeedmer impeedmre impeemrde impeemred
impeemdre impeemder impeemedr impeemerd impemered impemerde impemeerd impemeedr impemeder impemedre impemreed
impemrede impemreed impemrede impemrdee impemrdee impemered impemerde impemeerd impemeedr impemeder impemedre
impemdree impemdree impemdere impemdeer impemdeer impemdere impmderee impmderee impmdeere impmdeeer impmdeeer
impmdeere impmdreee impmdreee impmdreee impmdreee impmdreee impmdreee impmderee impmderee impmdeere impmdeeer
impmdeeer impmdeere impmderee impmderee impmdeere impmdeeer impmdeeer impmdeere impmedree impmedree impmedere
impmedeer impmedeer impmedere impmerdee impmerdee impmerede impmereed impmereed impmerede impmeerde impmeered
impmeedre impmeeder impmeeedr impmeeerd impmeered impmeerde impmeeerd impmeeedr impmeeder impmeedre impmredee
impmredee impmreede impmreeed impmreeed impmreede impmrdeee impmrdeee impmrdeee impmrdeee impmrdeee impmrdeee
impmredee impmredee impmreede impmreeed impmreeed impmreede impmredee impmredee impmreede impmreeed impmreeed
impmreede impmeerde impmeered impmeedre impmeeder impmeeedr impmeeerd impmerede impmereed impmerdee impmerdee
impmerede impmereed impmedree impmedree impmedere impmedeer impmedeer impmedere impmeerde impmeered impmeedre
impmeeder impmeeedr impmeeerd impmeered impmeerde impmeeerd impmeeedr impmeeder impmeedre impmereed impmerede
impmereed impmerede impmerdee impmerdee impmeered impmeerde impmeeerd impmeeedr impmeeder impmeedre impmedree
impmedree impmedere impmedeer impmedeer impmedere imepderem imepderme imepdeerm imepdeemr imepdemer imepdemre
imepdreem imepdreme imepdreem imepdreme imepdrmee imepdrmee imepderem imepderme imepdeerm imepdeemr imepdemer
imepdemre imepdmree imepdmree imepdmere imepdmeer imepdmeer imepdmere imepedrem imepedrme imepederm imepedemr
imepedmer imepedmre imeperdem imeperdme imeperedm imeperemd imepermed imepermde imepeerdm imepeermd imepeedrm
imepeedmr imepeemdr imepeemrd imepemred imepemrde imepemerd imepemedr imepemder imepemdre imepredem imepredme
imepreedm imepreemd imepremed imepremde imeprdeem imeprdeme imeprdeem imeprdeme imeprdmee imeprdmee imepredem
imepredme imepreedm imepreemd imepremed imepremde imeprmdee imeprmdee imeprmede imeprmeed imeprmeed imeprmede
imepeerdm imepeermd imepeedrm imepeedmr imepeemdr imepeemrd imeperedm imeperemd imeperdem imeperdme imepermde
imepermed imepedrem imepedrme imepederm imepedemr imepedmer imepedmre imepemrde imepemred imepemdre imepemder
imepemedr imepemerd imepmered imepmerde imepmeerd imepmeedr imepmeder imepmedre imepmreed imepmrede imepmreed
imepmrede imepmrdee imepmrdee imepmered imepmerde imepmeerd imepmeedr imepmeder imepmedre imepmdree imepmdree
imepmdere imepmdeer imepmdeer imepmdere imedperem imedperme imedpeerm imedpeemr imedpemer imedpemre imedpreem
imedpreme imedpreem imedpreme imedprmee imedprmee imedperem imedperme imedpeerm imedpeemr imedpemer imedpemre
imedpmree imedpmree imedpmere imedpmeer imedpmeer imedpmere imedeprem imedeprme imedeperm imedepemr imedepmer
imedepmre imederpem imederpme imederepm imederemp imedermep imedermpe imedeerpm imedeermp imedeeprm imedeepmr
imedeempr imedeemrp imedemrep imedemrpe imedemerp imedemepr imedemper imedempre imedrepem imedrepme imedreepm
imedreemp imedremep imedrempe imedrpeem imedrpeme imedrpeem imedrpeme imedrpmee imedrpmee imedrepem imedrepme
imedreepm imedreemp imedremep imedrempe imedrmpee imedrmpee imedrmepe imedrmeep imedrmeep imedrmepe imedeerpm
imedeermp imedeeprm imedeepmr imedeempr imedeemrp imederepm imederemp imederpem imederpme imedermpe imedermep
imedeprem imedeprme imedeperm imedepemr imedepmer imedepmre imedemrpe imedemrep imedempre imedemper imedemepr
imedemerp imedmerep imedmerpe imedmeerp imedmeepr imedmeper imedmepre imedmreep imedmrepe imedmreep imedmrepe
imedmrpee imedmrpee imedmerep imedmerpe imedmeerp imedmeepr imedmeper imedmepre imedmpree imedmpree imedmpere
imedmpeer imedmpeer imedmpere imeedprem imeedprme imeedperm imeedpemr imeedpmer imeedpmre imeedrpem imeedrpme
imeedrepm imeedremp imeedrmep imeedrmpe imeederpm imeedermp imeedeprm imeedepmr imeedempr imeedemrp imeedmrep
imeedmrpe imeedmerp imeedmepr imeedmper imeedmpre imeepdrem imeepdrme imeepderm imeepdemr imeepdmer imeepdmre
imeeprdem imeeprdme imeepredm imeepremd imeeprmed imeeprmde imeeperdm imeepermd imeepedrm imeepedmr imeepemdr
imeepemrd imeepmred imeepmrde imeepmerd imeepmedr imeepmder imeepmdre imeerpdem imeerpdme imeerpedm imeerpemd
imeerpmed imeerpmde imeerdpem imeerdpme imeerdepm imeerdemp imeerdmep imeerdmpe imeeredpm imeeredmp imeerepdm
imeerepmd imeerempd imeeremdp imeermdep imeermdpe imeermedp imeermepd imeermped imeermpde imeeeprdm imeeeprmd
imeeepdrm imeeepdmr imeeepmdr imeeepmrd imeeerpdm imeeerpmd imeeerdpm imeeerdmp imeeermdp imeeermpd imeeedrpm
imeeedrmp imeeedprm imeeedpmr imeeedmpr imeeedmrp imeeemrdp imeeemrpd imeeemdrp imeeemdpr imeeempdr imeeemprd
imeempred imeemprde imeemperd imeempedr imeempder imeempdre imeemrped imeemrpde imeemrepd imeemredp imeemrdep
imeemrdpe imeemerpd imeemerdp imeemeprd imeemepdr imeemedpr imeemedrp imeemdrep imeemdrpe imeemderp imeemdepr
imeemdper imeemdpre imerdepem imerdepme imerdeepm imerdeemp imerdemep imerdempe imerdpeem imerdpeme imerdpeem
imerdpeme imerdpmee imerdpmee imerdepem imerdepme imerdeepm imerdeemp imerdemep imerdempe imerdmpee imerdmpee
imerdmepe imerdmeep imerdmeep imerdmepe imeredpem imeredpme imeredepm imeredemp imeredmep imeredmpe imerepdem
imerepdme imerepedm imerepemd imerepmed imerepmde imereepdm imereepmd imereedpm imereedmp imereemdp imereempd
imeremped imerempde imeremepd imeremedp imeremdep imeremdpe imerpedem imerpedme imerpeedm imerpeemd imerpemed
imerpemde imerpdeem imerpdeme imerpdeem imerpdeme imerpdmee imerpdmee imerpedem imerpedme imerpeedm imerpeemd
imerpemed imerpemde imerpmdee imerpmdee imerpmede imerpmeed imerpmeed imerpmede imereepdm imereepmd imereedpm
imereedmp imereemdp imereempd imerepedm imerepemd imerepdem imerepdme imerepmde imerepmed imeredpem imeredpme
imeredepm imeredemp imeredmep imeredmpe imerempde imeremped imeremdpe imeremdep imeremedp imeremepd imermeped
imermepde imermeepd imermeedp imermedep imermedpe imermpeed imermpede imermpeed imermpede imermpdee imermpdee
imermeped imermepde imermeepd imermeedp imermedep imermedpe imermdpee imermdpee imermdepe imermdeep imermdeep
imermdepe imeederpm imeedermp imeedeprm imeedepmr imeedempr imeedemrp imeedrepm imeedremp imeedrpem imeedrpme
imeedrmpe imeedrmep imeedprem imeedprme imeedperm imeedpemr imeedpmer imeedpmre imeedmrpe imeedmrep imeedmpre
imeedmper imeedmepr imeedmerp imeeedrpm imeeedrmp imeeedprm imeeedpmr imeeedmpr imeeedmrp imeeerdpm imeeerdmp
imeeerpdm imeeerpmd imeeermpd imeeermdp imeeeprdm imeeeprmd imeeepdrm imeeepdmr imeeepmdr imeeepmrd imeeemrpd
imeeemrdp imeeemprd imeeempdr imeeemdpr imeeemdrp imeeredpm imeeredmp imeerepdm imeerepmd imeerempd imeeremdp
imeerdepm imeerdemp imeerdpem imeerdpme imeerdmpe imeerdmep imeerpdem imeerpdme imeerpedm imeerpemd imeerpmed
imeerpmde imeermdpe imeermdep imeermpde imeermped imeermepd imeermedp imeeperdm imeepermd imeepedrm imeepedmr
imeepemdr imeepemrd imeepredm imeepremd imeeprdem imeeprdme imeeprmde imeeprmed imeepdrem imeepdrme imeepderm
imeepdemr imeepdmer imeepdmre imeepmrde imeepmred imeepmdre imeepmder imeepmedr imeepmerd imeemerpd imeemerdp
imeemeprd imeemepdr imeemedpr imeemedrp imeemrepd imeemredp imeemrped imeemrpde imeemrdpe imeemrdep imeempred
imeemprde imeemperd imeempedr imeempder imeempdre imeemdrpe imeemdrep imeemdpre imeemdper imeemdepr imeemderp
imemderep imemderpe imemdeerp imemdeepr imemdeper imemdepre imemdreep imemdrepe imemdreep imemdrepe imemdrpee
imemdrpee imemderep imemderpe imemdeerp imemdeepr imemdeper imemdepre imemdpree imemdpree imemdpere imemdpeer
imemdpeer imemdpere imemedrep imemedrpe imemederp imemedepr imemedper imemedpre imemerdep imemerdpe imemeredp
imemerepd imemerped imemerpde imemeerdp imemeerpd imemeedrp imemeedpr imemeepdr imemeeprd imemepred imemeprde
imemeperd imemepedr imemepder imemepdre imemredep imemredpe imemreedp imemreepd imemreped imemrepde imemrdeep
imemrdepe imemrdeep imemrdepe imemrdpee imemrdpee imemredep imemredpe imemreedp imemreepd imemreped imemrepde
imemrpdee imemrpdee imemrpede imemrpeed imemrpeed imemrpede imemeerdp imemeerpd imemeedrp imemeedpr imemeepdr
imemeeprd imemeredp imemerepd imemerdep imemerdpe imemerpde imemerped imemedrep imemedrpe imemederp imemedepr
imemedper imemedpre imemeprde imemepred imemepdre imemepder imemepedr imemeperd imempered imemperde imempeerd
imempeedr imempeder imempedre imempreed imemprede imempreed imemprede imemprdee imemprdee imempered imemperde
imempeerd imempeedr imempeder imempedre imempdree imempdree imempdere imempdeer imempdeer imempdere imdeperem
imdeperme imdepeerm imdepeemr imdepemer imdepemre imdepreem imdepreme imdepreem imdepreme imdeprmee imdeprmee
imdeperem imdeperme imdepeerm imdepeemr imdepemer imdepemre imdepmree imdepmree imdepmere imdepmeer imdepmeer
imdepmere imdeeprem imdeeprme imdeeperm imdeepemr imdeepmer imdeepmre imdeerpem imdeerpme imdeerepm imdeeremp
imdeermep imdeermpe imdeeerpm imdeeermp imdeeeprm imdeeepmr imdeeempr imdeeemrp imdeemrep imdeemrpe imdeemerp
imdeemepr imdeemper imdeempre imderepem imderepme imdereepm imdereemp imderemep imderempe imderpeem imderpeme
imderpeem imderpeme imderpmee imderpmee imderepem imderepme imdereepm imdereemp imderemep imderempe imdermpee
imdermpee imdermepe imdermeep imdermeep imdermepe imdeeerpm imdeeermp imdeeeprm imdeeepmr imdeeempr imdeeemrp
imdeerepm imdeeremp imdeerpem imdeerpme imdeermpe imdeermep imdeeprem imdeeprme imdeeperm imdeepemr imdeepmer
imdeepmre imdeemrpe imdeemrep imdeempre imdeemper imdeemepr imdeemerp imdemerep imdemerpe imdemeerp imdemeepr
imdemeper imdemepre imdemreep imdemrepe imdemreep imdemrepe imdemrpee imdemrpee imdemerep imdemerpe imdemeerp
imdemeepr imdemeper imdemepre imdempree imdempree imdempere imdempeer imdempeer imdempere imdpeerem imdpeerme
imdpeeerm imdpeeemr imdpeemer imdpeemre imdpereem imdpereme imdpereem imdpereme imdpermee imdpermee imdpeerem
imdpeerme imdpeeerm imdpeeemr imdpeemer imdpeemre imdpemree imdpemree imdpemere imdpemeer imdpemeer imdpemere
imdpeerem imdpeerme imdpeeerm imdpeeemr imdpeemer imdpeemre imdpereem imdpereme imdpereem imdpereme imdpermee
imdpermee imdpeerem imdpeerme imdpeeerm imdpeeemr imdpeemer imdpeemre imdpemree imdpemree imdpemere imdpemeer
imdpemeer imdpemere imdpreeem imdpreeme imdpreeem imdpreeme imdpremee imdpremee imdpreeem imdpreeme imdpreeem
imdpreeme imdpremee imdpremee imdpreeem imdpreeme imdpreeem imdpreeme imdpremee imdpremee imdprmeee imdprmeee
imdprmeee imdprmeee imdprmeee imdprmeee imdpeerem imdpeerme imdpeeerm imdpeeemr imdpeemer imdpeemre imdpereem
imdpereme imdpereem imdpereme imdpermee imdpermee imdpeerem imdpeerme imdpeeerm imdpeeemr imdpeemer imdpeemre
imdpemree imdpemree imdpemere imdpemeer imdpemeer imdpemere imdpmeree imdpmeree imdpmeere imdpmeeer imdpmeeer
imdpmeere imdpmreee imdpmreee imdpmreee imdpmreee imdpmreee imdpmreee imdpmeree imdpmeree imdpmeere imdpmeeer
imdpmeeer imdpmeere imdpmeree imdpmeree imdpmeere imdpmeeer imdpmeeer imdpmeere imdeperem imdeperme imdepeerm
imdepeemr imdepemer imdepemre imdepreem imdepreme imdepreem imdepreme imdeprmee imdeprmee imdeperem imdeperme
imdepeerm imdepeemr imdepemer imdepemre imdepmree imdepmree imdepmere imdepmeer imdepmeer imdepmere imdeeprem
imdeeprme imdeeperm imdeepemr imdeepmer imdeepmre imdeerpem imdeerpme imdeerepm imdeeremp imdeermep imdeermpe
imdeeerpm imdeeermp imdeeeprm imdeeepmr imdeeempr imdeeemrp imdeemrep imdeemrpe imdeemerp imdeemepr imdeemper
imdeempre imderepem imderepme imdereepm imdereemp imderemep imderempe imderpeem imderpeme imderpeem imderpeme
imderpmee imderpmee imderepem imderepme imdereepm imdereemp imderemep imderempe imdermpee imdermpee imdermepe
imdermeep imdermeep imdermepe imdeeerpm imdeeermp imdeeeprm imdeeepmr imdeeempr imdeeemrp imdeerepm imdeeremp
imdeerpem imdeerpme imdeermpe imdeermep imdeeprem imdeeprme imdeeperm imdeepemr imdeepmer imdeepmre imdeemrpe
imdeemrep imdeempre imdeemper imdeemepr imdeemerp imdemerep imdemerpe imdemeerp imdemeepr imdemeper imdemepre
imdemreep imdemrepe imdemreep imdemrepe imdemrpee imdemrpee imdemerep imdemerpe imdemeerp imdemeepr imdemeper
imdemepre imdempree imdempree imdempere imdempeer imdempeer imdempere imdrpeeem imdrpeeme imdrpeeem imdrpeeme
imdrpemee imdrpemee imdrpeeem imdrpeeme imdrpeeem imdrpeeme imdrpemee imdrpemee imdrpeeem imdrpeeme imdrpeeem
imdrpeeme imdrpemee imdrpemee imdrpmeee imdrpmeee imdrpmeee imdrpmeee imdrpmeee imdrpmeee imdrepeem imdrepeme
imdrepeem imdrepeme imdrepmee imdrepmee imdreepem imdreepme imdreeepm imdreeemp imdreemep imdreempe imdreeepm
imdreeemp imdreepem imdreepme imdreempe imdreemep imdremeep imdremepe imdremeep imdremepe imdrempee imdrempee
imdreepem imdreepme imdreeepm imdreeemp imdreemep imdreempe imdrepeem imdrepeme imdrepeem imdrepeme imdrepmee
imdrepmee imdreepem imdreepme imdreeepm imdreeemp imdreemep imdreempe imdrempee imdrempee imdremepe imdremeep
imdremeep imdremepe imdreeepm imdreeemp imdreepem imdreepme imdreempe imdreemep imdreeepm imdreeemp imdreepem
imdreepme imdreempe imdreemep imdrepeem imdrepeme imdrepeem imdrepeme imdrepmee imdrepmee imdremepe imdremeep
imdrempee imdrempee imdremepe imdremeep imdrmeeep imdrmeepe imdrmeeep imdrmeepe imdrmepee imdrmepee imdrmeeep
imdrmeepe imdrmeeep imdrmeepe imdrmepee imdrmepee imdrmeeep imdrmeepe imdrmeeep imdrmeepe imdrmepee imdrmepee
imdrmpeee imdrmpeee imdrmpeee imdrmpeee imdrmpeee imdrmpeee imdeperem imdeperme imdepeerm imdepeemr imdepemer
imdepemre imdepreem imdepreme imdepreem imdepreme imdeprmee imdeprmee imdeperem imdeperme imdepeerm imdepeemr
imdepemer imdepemre imdepmree imdepmree imdepmere imdepmeer imdepmeer imdepmere imdeeprem imdeeprme imdeeperm
imdeepemr imdeepmer imdeepmre imdeerpem imdeerpme imdeerepm imdeeremp imdeermep imdeermpe imdeeerpm imdeeermp
imdeeeprm imdeeepmr imdeeempr imdeeemrp imdeemrep imdeemrpe imdeemerp imdeemepr imdeemper imdeempre imderepem
imderepme imdereepm imdereemp imderemep imderempe imderpeem imderpeme imderpeem imderpeme imderpmee imderpmee
imderepem imderepme imdereepm imdereemp imderemep imderempe imdermpee imdermpee imdermepe imdermeep imdermeep
imdermepe imdeeerpm imdeeermp imdeeeprm imdeeepmr imdeeempr imdeeemrp imdeerepm imdeeremp imdeerpem imdeerpme
imdeermpe imdeermep imdeeprem imdeeprme imdeeperm imdeepemr imdeepmer imdeepmre imdeemrpe imdeemrep imdeempre
imdeemper imdeemepr imdeemerp imdemerep imdemerpe imdemeerp imdemeepr imdemeper imdemepre imdemreep imdemrepe
imdemreep imdemrepe imdemrpee imdemrpee imdemerep imdemerpe imdemeerp imdemeepr imdemeper imdemepre imdempree
imdempree imdempere imdempeer imdempeer imdempere imdmperee imdmperee imdmpeere imdmpeeer imdmpeeer imdmpeere
imdmpreee imdmpreee imdmpreee imdmpreee imdmpreee imdmpreee imdmperee imdmperee imdmpeere imdmpeeer imdmpeeer
imdmpeere imdmperee imdmperee imdmpeere imdmpeeer imdmpeeer imdmpeere imdmepree imdmepree imdmepere imdmepeer
imdmepeer imdmepere imdmerpee imdmerpee imdmerepe imdmereep imdmereep imdmerepe imdmeerpe imdmeerep imdmeepre
imdmeeper imdmeeepr imdmeeerp imdmeerep imdmeerpe imdmeeerp imdmeeepr imdmeeper imdmeepre imdmrepee imdmrepee
imdmreepe imdmreeep imdmreeep imdmreepe imdmrpeee imdmrpeee imdmrpeee imdmrpeee imdmrpeee imdmrpeee imdmrepee
imdmrepee imdmreepe imdmreeep imdmreeep imdmreepe imdmrepee imdmrepee imdmreepe imdmreeep imdmreeep imdmreepe
imdmeerpe imdmeerep imdmeepre imdmeeper imdmeeepr imdmeeerp imdmerepe imdmereep imdmerpee imdmerpee imdmerepe
imdmereep imdmepree imdmepree imdmepere imdmepeer imdmepeer imdmepere imdmeerpe imdmeerep imdmeepre imdmeeper
imdmeeepr imdmeeerp imdmeerep imdmeerpe imdmeeerp imdmeeepr imdmeeper imdmeepre imdmereep imdmerepe imdmereep
imdmerepe imdmerpee imdmerpee imdmeerep imdmeerpe imdmeeerp imdmeeepr imdmeeper imdmeepre imdmepree imdmepree
imdmepere imdmepeer imdmepeer imdmepere imeedprem imeedprme imeedperm imeedpemr imeedpmer imeedpmre imeedrpem
imeedrpme imeedrepm imeedremp imeedrmep imeedrmpe imeederpm imeedermp imeedeprm imeedepmr imeedempr imeedemrp
imeedmrep imeedmrpe imeedmerp imeedmepr imeedmper imeedmpre imeepdrem imeepdrme imeepderm imeepdemr imeepdmer
imeepdmre imeeprdem imeeprdme imeepredm imeepremd imeeprmed imeeprmde imeeperdm imeepermd imeepedrm imeepedmr
imeepemdr imeepemrd imeepmred imeepmrde imeepmerd imeepmedr imeepmder imeepmdre imeerpdem imeerpdme imeerpedm
imeerpemd imeerpmed imeerpmde imeerdpem imeerdpme imeerdepm imeerdemp imeerdmep imeerdmpe imeeredpm imeeredmp
imeerepdm imeerepmd imeerempd imeeremdp imeermdep imeermdpe imeermedp imeermepd imeermped imeermpde imeeeprdm
imeeeprmd imeeepdrm imeeepdmr imeeepmdr imeeepmrd imeeerpdm imeeerpmd imeeerdpm imeeerdmp imeeermdp imeeermpd
imeeedrpm imeeedrmp imeeedprm imeeedpmr imeeedmpr imeeedmrp imeeemrdp imeeemrpd imeeemdrp imeeemdpr imeeempdr
imeeemprd imeempred imeemprde imeemperd imeempedr imeempder imeempdre imeemrped imeemrpde imeemrepd imeemredp
imeemrdep imeemrdpe imeemerpd imeemerdp imeemeprd imeemepdr imeemedpr imeemedrp imeemdrep imeemdrpe imeemderp
imeemdepr imeemdper imeemdpre imedeprem imedeprme imedeperm imedepemr imedepmer imedepmre imederpem imederpme
imederepm imederemp imedermep imedermpe imedeerpm imedeermp imedeeprm imedeepmr imedeempr imedeemrp imedemrep
imedemrpe imedemerp imedemepr imedemper imedempre imedperem imedperme imedpeerm imedpeemr imedpemer imedpemre
imedpreem imedpreme imedpreem imedpreme imedprmee imedprmee imedperem imedperme imedpeerm imedpeemr imedpemer
imedpemre imedpmree imedpmree imedpmere imedpmeer imedpmeer imedpmere imedrpeem imedrpeme imedrpeem imedrpeme
imedrpmee imedrpmee imedrepem imedrepme imedreepm imedreemp imedremep imedrempe imedreepm imedreemp imedrepem
imedrepme imedrempe imedremep imedrmeep imedrmepe imedrmeep imedrmepe imedrmpee imedrmpee imedeprem imedeprme
imedeperm imedepemr imedepmer imedepmre imederpem imederpme imederepm imederemp imedermep imedermpe imedeerpm
imedeermp imedeeprm imedeepmr imedeempr imedeemrp imedemrep imedemrpe imedemerp imedemepr imedemper imedempre
imedmpree imedmpree imedmpere imedmpeer imedmpeer imedmpere imedmrpee imedmrpee imedmrepe imedmreep imedmreep
imedmrepe imedmerpe imedmerep imedmepre imedmeper imedmeepr imedmeerp imedmerep imedmerpe imedmeerp imedmeepr
imedmeper imedmepre imepderem imepderme imepdeerm imepdeemr imepdemer imepdemre imepdreem imepdreme imepdreem
imepdreme imepdrmee imepdrmee imepderem imepderme imepdeerm imepdeemr imepdemer imepdemre imepdmree imepdmree
imepdmere imepdmeer imepdmeer imepdmere imepedrem imepedrme imepederm imepedemr imepedmer imepedmre imeperdem
imeperdme imeperedm imeperemd imepermed imepermde imepeerdm imepeermd imepeedrm imepeedmr imepeemdr imepeemrd
imepemred imepemrde imepemerd imepemedr imepemder imepemdre imepredem imepredme imepreedm imepreemd imepremed
imepremde imeprdeem imeprdeme imeprdeem imeprdeme imeprdmee imeprdmee imepredem imepredme imepreedm imepreemd
imepremed imepremde imeprmdee imeprmdee imeprmede imeprmeed imeprmeed imeprmede imepeerdm imepeermd imepeedrm
imepeedmr imepeemdr imepeemrd imeperedm imeperemd imeperdem imeperdme imepermde imepermed imepedrem imepedrme
imepederm imepedemr imepedmer imepedmre imepemrde imepemred imepemdre imepemder imepemedr imepemerd imepmered
imepmerde imepmeerd imepmeedr imepmeder imepmedre imepmreed imepmrede imepmreed imepmrede imepmrdee imepmrdee
imepmered imepmerde imepmeerd imepmeedr imepmeder imepmedre imepmdree imepmdree imepmdere imepmdeer imepmdeer
imepmdere imerdpeem imerdpeme imerdpeem imerdpeme imerdpmee imerdpmee imerdepem imerdepme imerdeepm imerdeemp
imerdemep imerdempe imerdeepm imerdeemp imerdepem imerdepme imerdempe imerdemep imerdmeep imerdmepe imerdmeep
imerdmepe imerdmpee imerdmpee imerpdeem imerpdeme imerpdeem imerpdeme imerpdmee imerpdmee imerpedem imerpedme
imerpeedm imerpeemd imerpemed imerpemde imerpeedm imerpeemd imerpedem imerpedme imerpemde imerpemed imerpmeed
imerpmede imerpmeed imerpmede imerpmdee imerpmdee imerepdem imerepdme imerepedm imerepemd imerepmed imerepmde
imeredpem imeredpme imeredepm imeredemp imeredmep imeredmpe imereedpm imereedmp imereepdm imereepmd imereempd
imereemdp imeremdep imeremdpe imeremedp imeremepd imeremped imerempde imerepedm imerepemd imerepdem imerepdme
imerepmde imerepmed imereepdm imereepmd imereedpm imereedmp imereemdp imereempd imeredepm imeredemp imeredpem
imeredpme imeredmpe imeredmep imeremedp imeremepd imeremdep imeremdpe imerempde imeremped imermpeed imermpede
imermpeed imermpede imermpdee imermpdee imermeped imermepde imermeepd imermeedp imermedep imermedpe imermeepd
imermeedp imermeped imermepde imermedpe imermedep imermdeep imermdepe imermdeep imermdepe imermdpee imermdpee
imeedprem imeedprme imeedperm imeedpemr imeedpmer imeedpmre imeedrpem imeedrpme imeedrepm imeedremp imeedrmep
imeedrmpe imeederpm imeedermp imeedeprm imeedepmr imeedempr imeedemrp imeedmrep imeedmrpe imeedmerp imeedmepr
imeedmper imeedmpre imeepdrem imeepdrme imeepderm imeepdemr imeepdmer imeepdmre imeeprdem imeeprdme imeepredm
imeepremd imeeprmed imeeprmde imeeperdm imeepermd imeepedrm imeepedmr imeepemdr imeepemrd imeepmred imeepmrde
imeepmerd imeepmedr imeepmder imeepmdre imeerpdem imeerpdme imeerpedm imeerpemd imeerpmed imeerpmde imeerdpem
imeerdpme imeerdepm imeerdemp imeerdmep imeerdmpe imeeredpm imeeredmp imeerepdm imeerepmd imeerempd imeeremdp
imeermdep imeermdpe imeermedp imeermepd imeermped imeermpde imeeeprdm imeeeprmd imeeepdrm imeeepdmr imeeepmdr
imeeepmrd imeeerpdm imeeerpmd imeeerdpm imeeerdmp imeeermdp imeeermpd imeeedrpm imeeedrmp imeeedprm imeeedpmr
imeeedmpr imeeedmrp imeeemrdp imeeemrpd imeeemdrp imeeemdpr imeeempdr imeeemprd imeempred imeemprde imeemperd
imeempedr imeempder imeempdre imeemrped imeemrpde imeemrepd imeemredp imeemrdep imeemrdpe imeemerpd imeemerdp
imeemeprd imeemepdr imeemedpr imeemedrp imeemdrep imeemdrpe imeemderp imeemdepr imeemdper imeemdpre imemdpree
imemdpree imemdpere imemdpeer imemdpeer imemdpere imemdrpee imemdrpee imemdrepe imemdreep imemdreep imemdrepe
imemderpe imemderep imemdepre imemdeper imemdeepr imemdeerp imemderep imemderpe imemdeerp imemdeepr imemdeper
imemdepre imempdree imempdree imempdere imempdeer imempdeer imempdere imemprdee imemprdee imemprede imempreed
imempreed imemprede imemperde imempered imempedre imempeder imempeedr imempeerd imempered imemperde imempeerd
imempeedr imempeder imempedre imemrpdee imemrpdee imemrpede imemrpeed imemrpeed imemrpede imemrdpee imemrdpee
imemrdepe imemrdeep imemrdeep imemrdepe imemredpe imemredep imemrepde imemreped imemreepd imemreedp imemredep
imemredpe imemreedp imemreepd imemreped imemrepde imemeprde imemepred imemepdre imemepder imemepedr imemeperd
imemerpde imemerped imemerdpe imemerdep imemeredp imemerepd imemedrpe imemedrep imemedpre imemedper imemedepr
imemederp imemeerdp imemeerpd imemeedrp imemeedpr imemeepdr imemeeprd imemepred imemeprde imemeperd imemepedr
imemepder imemepdre imemerped imemerpde imemerepd imemeredp imemerdep imemerdpe imemeerpd imemeerdp imemeeprd
imemeepdr imemeedpr imemeedrp imemedrep imemedrpe imemederp imemedepr imemedper imemedpre imredepem imredepme
imredeepm imredeemp imredemep imredempe imredpeem imredpeme imredpeem imredpeme imredpmee imredpmee imredepem
imredepme imredeepm imredeemp imredemep imredempe imredmpee imredmpee imredmepe imredmeep imredmeep imredmepe
imreedpem imreedpme imreedepm imreedemp imreedmep imreedmpe imreepdem imreepdme imreepedm imreepemd imreepmed
imreepmde imreeepdm imreeepmd imreeedpm imreeedmp imreeemdp imreeempd imreemped imreempde imreemepd imreemedp
imreemdep imreemdpe imrepedem imrepedme imrepeedm imrepeemd imrepemed imrepemde imrepdeem imrepdeme imrepdeem
imrepdeme imrepdmee imrepdmee imrepedem imrepedme imrepeedm imrepeemd imrepemed imrepemde imrepmdee imrepmdee
imrepmede imrepmeed imrepmeed imrepmede imreeepdm imreeepmd imreeedpm imreeedmp imreeemdp imreeempd imreepedm
imreepemd imreepdem imreepdme imreepmde imreepmed imreedpem imreedpme imreedepm imreedemp imreedmep imreedmpe
imreempde imreemped imreemdpe imreemdep imreemedp imreemepd imremeped imremepde imremeepd imremeedp imremedep
imremedpe imrempeed imrempede imrempeed imrempede imrempdee imrempdee imremeped imremepde imremeepd imremeedp
imremedep imremedpe imremdpee imremdpee imremdepe imremdeep imremdeep imremdepe imrdeepem imrdeepme imrdeeepm
imrdeeemp imrdeemep imrdeempe imrdepeem imrdepeme imrdepeem imrdepeme imrdepmee imrdepmee imrdeepem imrdeepme
imrdeeepm imrdeeemp imrdeemep imrdeempe imrdempee imrdempee imrdemepe imrdemeep imrdemeep imrdemepe imrdeepem
imrdeepme imrdeeepm imrdeeemp imrdeemep imrdeempe imrdepeem imrdepeme imrdepeem imrdepeme imrdepmee imrdepmee
imrdeepem imrdeepme imrdeeepm imrdeeemp imrdeemep imrdeempe imrdempee imrdempee imrdemepe imrdemeep imrdemeep
imrdemepe imrdpeeem imrdpeeme imrdpeeem imrdpeeme imrdpemee imrdpemee imrdpeeem imrdpeeme imrdpeeem imrdpeeme
imrdpemee imrdpemee imrdpeeem imrdpeeme imrdpeeem imrdpeeme imrdpemee imrdpemee imrdpmeee imrdpmeee imrdpmeee
imrdpmeee imrdpmeee imrdpmeee imrdeepem imrdeepme imrdeeepm imrdeeemp imrdeemep imrdeempe imrdepeem imrdepeme
imrdepeem imrdepeme imrdepmee imrdepmee imrdeepem imrdeepme imrdeeepm imrdeeemp imrdeemep imrdeempe imrdempee
imrdempee imrdemepe imrdemeep imrdemeep imrdemepe imrdmepee imrdmepee imrdmeepe imrdmeeep imrdmeeep imrdmeepe
imrdmpeee imrdmpeee imrdmpeee imrdmpeee imrdmpeee imrdmpeee imrdmepee imrdmepee imrdmeepe imrdmeeep imrdmeeep
imrdmeepe imrdmepee imrdmepee imrdmeepe imrdmeeep imrdmeeep imrdmeepe imredepem imredepme imredeepm imredeemp
imredemep imredempe imredpeem imredpeme imredpeem imredpeme imredpmee imredpmee imredepem imredepme imredeepm
imredeemp imredemep imredempe imredmpee imredmpee imredmepe imredmeep imredmeep imredmepe imreedpem imreedpme
imreedepm imreedemp imreedmep imreedmpe imreepdem imreepdme imreepedm imreepemd imreepmed imreepmde imreeepdm
imreeepmd imreeedpm imreeedmp imreeemdp imreeempd imreemped imreempde imreemepd imreemedp imreemdep imreemdpe
imrepedem imrepedme imrepeedm imrepeemd imrepemed imrepemde imrepdeem imrepdeme imrepdeem imrepdeme imrepdmee
imrepdmee imrepedem imrepedme imrepeedm imrepeemd imrepemed imrepemde imrepmdee imrepmdee imrepmede imrepmeed
imrepmeed imrepmede imreeepdm imreeepmd imreeedpm imreeedmp imreeemdp imreeempd imreepedm imreepemd imreepdem
imreepdme imreepmde imreepmed imreedpem imreedpme imreedepm imreedemp imreedmep imreedmpe imreempde imreemped
imreemdpe imreemdep imreemedp imreemepd imremeped imremepde imremeepd imremeedp imremedep imremedpe imrempeed
imrempede imrempeed imrempede imrempdee imrempdee imremeped imremepde imremeepd imremeedp imremedep imremedpe
imremdpee imremdpee imremdepe imremdeep imremdeep imremdepe imrpdeeem imrpdeeme imrpdeeem imrpdeeme imrpdemee
imrpdemee imrpdeeem imrpdeeme imrpdeeem imrpdeeme imrpdemee imrpdemee imrpdeeem imrpdeeme imrpdeeem imrpdeeme
imrpdemee imrpdemee imrpdmeee imrpdmeee imrpdmeee imrpdmeee imrpdmeee imrpdmeee imrpedeem imrpedeme imrpedeem
imrpedeme imrpedmee imrpedmee imrpeedem imrpeedme imrpeeedm imrpeeemd imrpeemed imrpeemde imrpeeedm imrpeeemd
imrpeedem imrpeedme imrpeemde imrpeemed imrpemeed imrpemede imrpemeed imrpemede imrpemdee imrpemdee imrpeedem
imrpeedme imrpeeedm imrpeeemd imrpeemed imrpeemde imrpedeem imrpedeme imrpedeem imrpedeme imrpedmee imrpedmee
imrpeedem imrpeedme imrpeeedm imrpeeemd imrpeemed imrpeemde imrpemdee imrpemdee imrpemede imrpemeed imrpemeed
imrpemede imrpeeedm imrpeeemd imrpeedem imrpeedme imrpeemde imrpeemed imrpeeedm imrpeeemd imrpeedem imrpeedme
imrpeemde imrpeemed imrpedeem imrpedeme imrpedeem imrpedeme imrpedmee imrpedmee imrpemede imrpemeed imrpemdee
imrpemdee imrpemede imrpemeed imrpmeeed imrpmeede imrpmeeed imrpmeede imrpmedee imrpmedee imrpmeeed imrpmeede
imrpmeeed imrpmeede imrpmedee imrpmedee imrpmeeed imrpmeede imrpmeeed imrpmeede imrpmedee imrpmedee imrpmdeee
imrpmdeee imrpmdeee imrpmdeee imrpmdeee imrpmdeee imredepem imredepme imredeepm imredeemp imredemep imredempe
imredpeem imredpeme imredpeem imredpeme imredpmee imredpmee imredepem imredepme imredeepm imredeemp imredemep
imredempe imredmpee imredmpee imredmepe imredmeep imredmeep imredmepe imreedpem imreedpme imreedepm imreedemp
imreedmep imreedmpe imreepdem imreepdme imreepedm imreepemd imreepmed imreepmde imreeepdm imreeepmd imreeedpm
imreeedmp imreeemdp imreeempd imreemped imreempde imreemepd imreemedp imreemdep imreemdpe imrepedem imrepedme
imrepeedm imrepeemd imrepemed imrepemde imrepdeem imrepdeme imrepdeem imrepdeme imrepdmee imrepdmee imrepedem
imrepedme imrepeedm imrepeemd imrepemed imrepemde imrepmdee imrepmdee imrepmede imrepmeed imrepmeed imrepmede
imreeepdm imreeepmd imreeedpm imreeedmp imreeemdp imreeempd imreepedm imreepemd imreepdem imreepdme imreepmde
imreepmed imreedpem imreedpme imreedepm imreedemp imreedmep imreedmpe imreempde imreemped imreemdpe imreemdep
imreemedp imreemepd imremeped imremepde imremeepd imremeedp imremedep imremedpe imrempeed imrempede imrempeed
imrempede imrempdee imrempdee imremeped imremepde imremeepd imremeedp imremedep imremedpe imremdpee imremdpee
imremdepe imremdeep imremdeep imremdepe imrmdepee imrmdepee imrmdeepe imrmdeeep imrmdeeep imrmdeepe imrmdpeee
imrmdpeee imrmdpeee imrmdpeee imrmdpeee imrmdpeee imrmdepee imrmdepee imrmdeepe imrmdeeep imrmdeeep imrmdeepe
imrmdepee imrmdepee imrmdeepe imrmdeeep imrmdeeep imrmdeepe imrmedpee imrmedpee imrmedepe imrmedeep imrmedeep
imrmedepe imrmepdee imrmepdee imrmepede imrmepeed imrmepeed imrmepede imrmeepde imrmeeped imrmeedpe imrmeedep
imrmeeedp imrmeeepd imrmeeped imrmeepde imrmeeepd imrmeeedp imrmeedep imrmeedpe imrmpedee imrmpedee imrmpeede
imrmpeeed imrmpeeed imrmpeede imrmpdeee imrmpdeee imrmpdeee imrmpdeee imrmpdeee imrmpdeee imrmpedee imrmpedee
imrmpeede imrmpeeed imrmpeeed imrmpeede imrmpedee imrmpedee imrmpeede imrmpeeed imrmpeeed imrmpeede imrmeepde
imrmeeped imrmeedpe imrmeedep imrmeeedp imrmeeepd imrmepede imrmepeed imrmepdee imrmepdee imrmepede imrmepeed
imrmedpee imrmedpee imrmedepe imrmedeep imrmedeep imrmedepe imrmeepde imrmeeped imrmeedpe imrmeedep imrmeeedp
imrmeeepd imrmeeped imrmeepde imrmeeepd imrmeeedp imrmeedep imrmeedpe imrmepeed imrmepede imrmepeed imrmepede
imrmepdee imrmepdee imrmeeped imrmeepde imrmeeepd imrmeeedp imrmeedep imrmeedpe imrmedpee imrmedpee imrmedepe
imrmedeep imrmedeep imrmedepe imeederpm imeedermp imeedeprm imeedepmr imeedempr imeedemrp imeedrepm imeedremp
imeedrpem imeedrpme imeedrmpe imeedrmep imeedprem imeedprme imeedperm imeedpemr imeedpmer imeedpmre imeedmrpe
imeedmrep imeedmpre imeedmper imeedmepr imeedmerp imeeedrpm imeeedrmp imeeedprm imeeedpmr imeeedmpr imeeedmrp
imeeerdpm imeeerdmp imeeerpdm imeeerpmd imeeermpd imeeermdp imeeeprdm imeeeprmd imeeepdrm imeeepdmr imeeepmdr
imeeepmrd imeeemrpd imeeemrdp imeeemprd imeeempdr imeeemdpr imeeemdrp imeeredpm imeeredmp imeerepdm imeerepmd
imeerempd imeeremdp imeerdepm imeerdemp imeerdpem imeerdpme imeerdmpe imeerdmep imeerpdem imeerpdme imeerpedm
imeerpemd imeerpmed imeerpmde imeermdpe imeermdep imeermpde imeermped imeermepd imeermedp imeeperdm imeepermd
imeepedrm imeepedmr imeepemdr imeepemrd imeepredm imeepremd imeeprdem imeeprdme imeeprmde imeeprmed imeepdrem
imeepdrme imeepderm imeepdemr imeepdmer imeepdmre imeepmrde imeepmred imeepmdre imeepmder imeepmedr imeepmerd
imeemerpd imeemerdp imeemeprd imeemepdr imeemedpr imeemedrp imeemrepd imeemredp imeemrped imeemrpde imeemrdpe
imeemrdep imeempred imeemprde imeemperd imeempedr imeempder imeempdre imeemdrpe imeemdrep imeemdpre imeemdper
imeemdepr imeemderp imedeerpm imedeermp imedeeprm imedeepmr imedeempr imedeemrp imederepm imederemp imederpem
imederpme imedermpe imedermep imedeprem imedeprme imedeperm imedepemr imedepmer imedepmre imedemrpe imedemrep
imedempre imedemper imedemepr imedemerp imedeerpm imedeermp imedeeprm imedeepmr imedeempr imedeemrp imederepm
imederemp imederpem imederpme imedermpe imedermep imedeprem imedeprme imedeperm imedepemr imedepmer imedepmre
imedemrpe imedemrep imedempre imedemper imedemepr imedemerp imedreepm imedreemp imedrepem imedrepme imedrempe
imedremep imedreepm imedreemp imedrepem imedrepme imedrempe imedremep imedrpeem imedrpeme imedrpeem imedrpeme
imedrpmee imedrpmee imedrmepe imedrmeep imedrmpee imedrmpee imedrmepe imedrmeep imedperem imedperme imedpeerm
imedpeemr imedpemer imedpemre imedpreem imedpreme imedpreem imedpreme imedprmee imedprmee imedperem imedperme
imedpeerm imedpeemr imedpemer imedpemre imedpmree imedpmree imedpmere imedpmeer imedpmeer imedpmere imedmerpe
imedmerep imedmepre imedmeper imedmeepr imedmeerp imedmrepe imedmreep imedmrpee imedmrpee imedmrepe imedmreep
imedmpree imedmpree imedmpere imedmpeer imedmpeer imedmpere imedmerpe imedmerep imedmepre imedmeper imedmeepr
imedmeerp imeederpm imeedermp imeedeprm imeedepmr imeedempr imeedemrp imeedrepm imeedremp imeedrpem imeedrpme
imeedrmpe imeedrmep imeedprem imeedprme imeedperm imeedpemr imeedpmer imeedpmre imeedmrpe imeedmrep imeedmpre
imeedmper imeedmepr imeedmerp imeeedrpm imeeedrmp imeeedprm imeeedpmr imeeedmpr imeeedmrp imeeerdpm imeeerdmp
imeeerpdm imeeerpmd imeeermpd imeeermdp imeeeprdm imeeeprmd imeeepdrm imeeepdmr imeeepmdr imeeepmrd imeeemrpd
imeeemrdp imeeemprd imeeempdr imeeemdpr imeeemdrp imeeredpm imeeredmp imeerepdm imeerepmd imeerempd imeeremdp
imeerdepm imeerdemp imeerdpem imeerdpme imeerdmpe imeerdmep imeerpdem imeerpdme imeerpedm imeerpemd imeerpmed
imeerpmde imeermdpe imeermdep imeermpde imeermped imeermepd imeermedp imeeperdm imeepermd imeepedrm imeepedmr
imeepemdr imeepemrd imeepredm imeepremd imeeprdem imeeprdme imeeprmde imeeprmed imeepdrem imeepdrme imeepderm
imeepdemr imeepdmer imeepdmre imeepmrde imeepmred imeepmdre imeepmder imeepmedr imeepmerd imeemerpd imeemerdp
imeemeprd imeemepdr imeemedpr imeemedrp imeemrepd imeemredp imeemrped imeemrpde imeemrdpe imeemrdep imeempred
imeemprde imeemperd imeempedr imeempder imeempdre imeemdrpe imeemdrep imeemdpre imeemdper imeemdepr imeemderp
imerdeepm imerdeemp imerdepem imerdepme imerdempe imerdemep imerdeepm imerdeemp imerdepem imerdepme imerdempe
imerdemep imerdpeem imerdpeme imerdpeem imerdpeme imerdpmee imerdpmee imerdmepe imerdmeep imerdmpee imerdmpee
imerdmepe imerdmeep imeredepm imeredemp imeredpem imeredpme imeredmpe imeredmep imereedpm imereedmp imereepdm
imereepmd imereempd imereemdp imerepedm imerepemd imerepdem imerepdme imerepmde imerepmed imeremepd imeremedp
imeremped imerempde imeremdpe imeremdep imereedpm imereedmp imereepdm imereepmd imereempd imereemdp imeredepm
imeredemp imeredpem imeredpme imeredmpe imeredmep imerepdem imerepdme imerepedm imerepemd imerepmed imerepmde
imeremdpe imeremdep imerempde imeremped imeremepd imeremedp imerpeedm imerpeemd imerpedem imerpedme imerpemde
imerpemed imerpeedm imerpeemd imerpedem imerpedme imerpemde imerpemed imerpdeem imerpdeme imerpdeem imerpdeme
imerpdmee imerpdmee imerpmede imerpmeed imerpmdee imerpmdee imerpmede imerpmeed imermeepd imermeedp imermeped
imermepde imermedpe imermedep imermeepd imermeedp imermeped imermepde imermedpe imermedep imermpeed imermpede
imermpeed imermpede imermpdee imermpdee imermdepe imermdeep imermdpee imermdpee imermdepe imermdeep imepderem
imepderme imepdeerm imepdeemr imepdemer imepdemre imepdreem imepdreme imepdreem imepdreme imepdrmee imepdrmee
imepderem imepderme imepdeerm imepdeemr imepdemer imepdemre imepdmree imepdmree imepdmere imepdmeer imepdmeer
imepdmere imepedrem imepedrme imepederm imepedemr imepedmer imepedmre imeperdem imeperdme imeperedm imeperemd
imepermed imepermde imepeerdm imepeermd imepeedrm imepeedmr imepeemdr imepeemrd imepemred imepemrde imepemerd
imepemedr imepemder imepemdre imepredem imepredme imepreedm imepreemd imepremed imepremde imeprdeem imeprdeme
imeprdeem imeprdeme imeprdmee imeprdmee imepredem imepredme imepreedm imepreemd imepremed imepremde imeprmdee
imeprmdee imeprmede imeprmeed imeprmeed imeprmede imepeerdm imepeermd imepeedrm imepeedmr imepeemdr imepeemrd
imeperedm imeperemd imeperdem imeperdme imepermde imepermed imepedrem imepedrme imepederm imepedemr imepedmer
imepedmre imepemrde imepemred imepemdre imepemder imepemedr imepemerd imepmered imepmerde imepmeerd imepmeedr
imepmeder imepmedre imepmreed imepmrede imepmreed imepmrede imepmrdee imepmrdee imepmered imepmerde imepmeerd
imepmeedr imepmeder imepmedre imepmdree imepmdree imepmdere imepmdeer imepmdeer imepmdere imemderpe imemderep
imemdepre imemdeper imemdeepr imemdeerp imemdrepe imemdreep imemdrpee imemdrpee imemdrepe imemdreep imemdpree
imemdpree imemdpere imemdpeer imemdpeer imemdpere imemderpe imemderep imemdepre imemdeper imemdeepr imemdeerp
imemedrpe imemedrep imemedpre imemedper imemedepr imemederp imemerdpe imemerdep imemerpde imemerped imemerepd
imemeredp imemeprde imemepred imemepdre imemepder imemepedr imemeperd imemeerpd imemeerdp imemeeprd imemeepdr
imemeedpr imemeedrp imemredpe imemredep imemrepde imemreped imemreepd imemreedp imemrdepe imemrdeep imemrdpee
imemrdpee imemrdepe imemrdeep imemrpdee imemrpdee imemrpede imemrpeed imemrpeed imemrpede imemredpe imemredep
imemrepde imemreped imemreepd imemreedp imemperde imempered imempedre imempeder imempeedr imempeerd imemprede
imempreed imemprdee imemprdee imemprede imempreed imempdree imempdree imempdere imempdeer imempdeer imempdere
imemperde imempered imempedre imempeder imempeedr imempeerd imemeerpd imemeerdp imemeeprd imemeepdr imemeedpr
imemeedrp imemerepd imemeredp imemerped imemerpde imemerdpe imemerdep imemepred imemeprde imemeperd imemepedr
imemepder imemepdre imemedrpe imemedrep imemedpre imemedper imemedepr imemederp immederep immederpe immedeerp
immedeepr immedeper immedepre immedreep immedrepe immedreep immedrepe immedrpee immedrpee immederep immederpe
immedeerp immedeepr immedeper immedepre immedpree immedpree immedpere immedpeer immedpeer immedpere immeedrep
immeedrpe immeederp immeedepr immeedper immeedpre immeerdep immeerdpe immeeredp immeerepd immeerped immeerpde
immeeerdp immeeerpd immeeedrp immeeedpr immeeepdr immeeeprd immeepred immeeprde immeeperd immeepedr immeepder
immeepdre immeredep immeredpe immereedp immereepd immereped immerepde immerdeep immerdepe immerdeep immerdepe
immerdpee immerdpee immeredep immeredpe immereedp immereepd immereped immerepde immerpdee immerpdee immerpede
immerpeed immerpeed immerpede immeeerdp immeeerpd immeeedrp immeeedpr immeeepdr immeeeprd immeeredp immeerepd
immeerdep immeerdpe immeerpde immeerped immeedrep immeedrpe immeederp immeedepr immeedper immeedpre immeeprde
immeepred immeepdre immeepder immeepedr immeeperd immepered immeperde immepeerd immepeedr immepeder immepedre
immepreed immeprede immepreed immeprede immeprdee immeprdee immepered immeperde immepeerd immepeedr immepeder
immepedre immepdree immepdree immepdere immepdeer immepdeer immepdere immdeerep immdeerpe immdeeerp immdeeepr
immdeeper immdeepre immdereep immderepe immdereep immderepe immderpee immderpee immdeerep immdeerpe immdeeerp
immdeeepr immdeeper immdeepre immdepree immdepree immdepere immdepeer immdepeer immdepere immdeerep immdeerpe
immdeeerp immdeeepr immdeeper immdeepre immdereep immderepe immdereep immderepe immderpee immderpee immdeerep
immdeerpe immdeeerp immdeeepr immdeeper immdeepre immdepree immdepree immdepere immdepeer immdepeer immdepere
immdreeep immdreepe immdreeep immdreepe immdrepee immdrepee immdreeep immdreepe immdreeep immdreepe immdrepee
immdrepee immdreeep immdreepe immdreeep immdreepe immdrepee immdrepee immdrpeee immdrpeee immdrpeee immdrpeee
immdrpeee immdrpeee immdeerep immdeerpe immdeeerp immdeeepr immdeeper immdeepre immdereep immderepe immdereep
immderepe immderpee immderpee immdeerep immdeerpe immdeeerp immdeeepr immdeeper immdeepre immdepree immdepree
immdepere immdepeer immdepeer immdepere immdperee immdperee immdpeere immdpeeer immdpeeer immdpeere immdpreee
immdpreee immdpreee immdpreee immdpreee immdpreee immdperee immdperee immdpeere immdpeeer immdpeeer immdpeere
immdperee immdperee immdpeere immdpeeer immdpeeer immdpeere immederep immederpe immedeerp immedeepr immedeper
immedepre immedreep immedrepe immedreep immedrepe immedrpee immedrpee immederep immederpe immedeerp immedeepr
immedeper immedepre immedpree immedpree immedpere immedpeer immedpeer immedpere immeedrep immeedrpe immeederp
immeedepr immeedper immeedpre immeerdep immeerdpe immeeredp immeerepd immeerped immeerpde immeeerdp immeeerpd
immeeedrp immeeedpr immeeepdr immeeeprd immeepred immeeprde immeeperd immeepedr immeepder immeepdre immeredep
immeredpe immereedp immereepd immereped immerepde immerdeep immerdepe immerdeep immerdepe immerdpee immerdpee
immeredep immeredpe immereedp immereepd immereped immerepde immerpdee immerpdee immerpede immerpeed immerpeed
immerpede immeeerdp immeeerpd immeeedrp immeeedpr immeeepdr immeeeprd immeeredp immeerepd immeerdep immeerdpe
immeerpde immeerped immeedrep immeedrpe immeederp immeedepr immeedper immeedpre immeeprde immeepred immeepdre
immeepder immeepedr immeeperd immepered immeperde immepeerd immepeedr immepeder immepedre immepreed immeprede
immepreed immeprede immeprdee immeprdee immepered immeperde immepeerd immepeedr immepeder immepedre immepdree
immepdree immepdere immepdeer immepdeer immepdere immrdeeep immrdeepe immrdeeep immrdeepe immrdepee immrdepee
immrdeeep immrdeepe immrdeeep immrdeepe immrdepee immrdepee immrdeeep immrdeepe immrdeeep immrdeepe immrdepee
immrdepee immrdpeee immrdpeee immrdpeee immrdpeee immrdpeee immrdpeee immredeep immredepe immredeep immredepe
immredpee immredpee immreedep immreedpe immreeedp immreeepd immreeped immreepde immreeedp immreeepd immreedep
immreedpe immreepde immreeped immrepeed immrepede immrepeed immrepede immrepdee immrepdee immreedep immreedpe
immreeedp immreeepd immreeped immreepde immredeep immredepe immredeep immredepe immredpee immredpee immreedep
immreedpe immreeedp immreeepd immreeped immreepde immrepdee immrepdee immrepede immrepeed immrepeed immrepede
immreeedp immreeepd immreedep immreedpe immreepde immreeped immreeedp immreeepd immreedep immreedpe immreepde
immreeped immredeep immredepe immredeep immredepe immredpee immredpee immrepede immrepeed immrepdee immrepdee
immrepede immrepeed immrpeeed immrpeede immrpeeed immrpeede immrpedee immrpedee immrpeeed immrpeede immrpeeed
immrpeede immrpedee immrpedee immrpeeed immrpeede immrpeeed immrpeede immrpedee immrpedee immrpdeee immrpdeee
immrpdeee immrpdeee immrpdeee immrpdeee immederep immederpe immedeerp immedeepr immedeper immedepre immedreep
immedrepe immedreep immedrepe immedrpee immedrpee immederep immederpe immedeerp immedeepr immedeper immedepre
immedpree immedpree immedpere immedpeer immedpeer immedpere immeedrep immeedrpe immeederp immeedepr immeedper
immeedpre immeerdep immeerdpe immeeredp immeerepd immeerped immeerpde immeeerdp immeeerpd immeeedrp immeeedpr
immeeepdr immeeeprd immeepred immeeprde immeeperd immeepedr immeepder immeepdre immeredep immeredpe immereedp
immereepd immereped immerepde immerdeep immerdepe immerdeep immerdepe immerdpee immerdpee immeredep immeredpe
immereedp immereepd immereped immerepde immerpdee immerpdee immerpede immerpeed immerpeed immerpede immeeerdp
immeeerpd immeeedrp immeeedpr immeeepdr immeeeprd immeeredp immeerepd immeerdep immeerdpe immeerpde immeerped
immeedrep immeedrpe immeederp immeedepr immeedper immeedpre immeeprde immeepred immeepdre immeepder immeepedr
immeeperd immepered immeperde immepeerd immepeedr immepeder immepedre immepreed immeprede immepreed immeprede
immeprdee immeprdee immepered immeperde immepeerd immepeedr immepeder immepedre immepdree immepdree immepdere
immepdeer immepdeer immepdere immpderee immpderee immpdeere immpdeeer immpdeeer immpdeere immpdreee immpdreee
immpdreee immpdreee immpdreee immpdreee immpderee immpderee immpdeere immpdeeer immpdeeer immpdeere immpderee
immpderee immpdeere immpdeeer immpdeeer immpdeere immpedree immpedree immpedere immpedeer immpedeer immpedere
immperdee immperdee immperede immpereed immpereed immperede immpeerde immpeered immpeedre immpeeder immpeeedr
immpeeerd immpeered immpeerde immpeeerd immpeeedr immpeeder immpeedre immpredee immpredee immpreede immpreeed
immpreeed immpreede immprdeee immprdeee immprdeee immprdeee immprdeee immprdeee immpredee immpredee immpreede
immpreeed immpreeed immpreede immpredee immpredee immpreede immpreeed immpreeed immpreede immpeerde immpeered
immpeedre immpeeder immpeeedr immpeeerd immperede immpereed immperdee immperdee immperede immpereed immpedree
immpedree immpedere immpedeer immpedeer immpedere immpeerde immpeered immpeedre immpeeder immpeeedr immpeeerd
immpeered immpeerde immpeeerd immpeeedr immpeeder immpeedre immpereed immperede immpereed immperede immperdee
immperdee immpeered immpeerde immpeeerd immpeeedr immpeeder immpeedre immpedree immpedree immpedere immpedeer
immpedeer immpedere

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us