easy ciphers

Easy Ciphers Tools:
cryptography lectures
popular ciphers:

culminisque

thyasiris

mcewen

induplication

urbino

nonnis

overassertiveness

stovebrush

technocrat

originator

paleopedology

hpdod

whited

lauralea

infirmate

perficeque

accesseratque

creosols


Caesar cipher

Caesar cipher, is one of the simplest and most widely known encryption techniques. The transformation can be represented by aligning two alphabets, the cipher alphabet is the plain alphabet rotated left or right by some number of positions.

When encrypting, a person looks up each letter of the message in the 'plain' line and writes down the corresponding letter in the 'cipher' line. Deciphering is done in reverse.
The encryption can also be represented using modular arithmetic by first transforming the letters into numbers, according to the scheme, A = 0, B = 1,..., Z = 25. Encryption of a letter x by a shift n can be described mathematically as

Plaintext: impedere
cipher variations:
jnqfefsf korgfgtg lpshghuh mqtihivi nrujijwj
osvkjkxk ptwlklyl quxmlmzm rvynmnan swzonobo
txapopcp uybqpqdq vzcrqrer wadsrsfs xbetstgt
ycfutuhu zdgvuviv aehwvwjw bfixwxkx cgjyxyly
dhkzyzmz eilazana fjmbabob gkncbcpc hlodcdqd

Decryption is performed similarly,

(There are different definitions for the modulo operation. In the above, the result is in the range 0...25. I.e., if x+n or x-n are not in the range 0...25, we have to subtract or add 26.)
Read more ...
Atbash Cipher

Atbash is an ancient encryption system created in the Middle East. It was originally used in the Hebrew language.
The Atbash cipher is a simple substitution cipher that relies on transposing all the letters in the alphabet such that the resulting alphabet is backwards.
The first letter is replaced with the last letter, the second with the second-last, and so on.
An example plaintext to ciphertext using Atbash:
Plain: impedere
Cipher: rnkvwviv

Read more ...

 

Baconian Cipher

To encode a message, each letter of the plaintext is replaced by a group of five of the letters 'A' or 'B'. This replacement is done according to the alphabet of the Baconian cipher, shown below.
a   AAAAA   g    AABBA     m    ABABB   s    BAAAB     y    BABBA
b   AAAAB   h    AABBB     n    ABBAA   t    BAABA     z    BABBB
c   AAABA   i    ABAAA     o    ABBAB   u    BAABB 
d   AAABB   j    BBBAA     p    ABBBA   v    BBBAB
e   AABAA   k    ABAAB     q    ABBBB   w    BABAA
f   AABAB   l    ABABA     r    BAAAA   x    BABAB

Plain: impedere
Cipher: ABAAA ABABB ABBBA AABAA AAABB AABAA BAAAA AABAA

Read more ...

 

Affine Cipher
In the affine cipher the letters of an alphabet of size m are first mapped to the integers in the range 0..m - 1. It then uses modular arithmetic to transform the integer that each plaintext letter corresponds to into another integer that correspond to a ciphertext letter. The encryption function for a single letter is

where modulus m is the size of the alphabet and a and b are the key of the cipher. The value a must be chosen such that a and m are coprime.
Considering the specific case of encrypting messages in English (i.e. m = 26), there are a total of 286 non-trivial affine ciphers, not counting the 26 trivial Caesar ciphers. This number comes from the fact there are 12 numbers that are coprime with 26 that are less than 26 (these are the possible values of a). Each value of a can have 26 different addition shifts (the b value) ; therefore, there are 12*26 or 312 possible keys.
Plaintext: impedere
cipher variations:
jnqfefsfzlunknanpjyvqvivfhcdwdqdvfglclylldktitgtrzsjujwjhxwrarer
xvazgzmzntehmhuhdripspcptpmxyxkxkorgfgtgamvoloboqkzwrwjwgidexere
wghmdmzmmelujuhusatkvkxkiyxsbsfsywbahanaoufiniviesjqtqdquqnyzyly
lpshghuhbnwpmpcprlaxsxkxhjefyfsfxhinenannfmvkvivtbulwlyljzytctgt
zxcbibobpvgjojwjftkrurervrozazmzmqtihivicoxqnqdqsmbytylyikfgzgtg
yijofoboognwlwjwucvmxmzmkazuduhuaydcjcpcqwhkpkxkgulsvsfswspabana
nrujijwjdpyrorertnczuzmzjlghahuhzjkpgpcpphoxmxkxvdwnynanlbaveviv
bzedkdqdrxilqlylhvmtwtgtxtqbcbobosvkjkxkeqzspsfsuodavanakmhibivi
aklqhqdqqipynylywexozobomcbwfwjwcafeleresyjmrmzmiwnuxuhuyurcdcpc
ptwlklylfratqtgtvpebwboblnijcjwjblmrirerrjqzozmzxfypapcpndcxgxkx
dbgfmfsftzknsnanjxovyvivzvsdedqdquxmlmzmgsburuhuwqfcxcpcmojkdkxk
cmnsjsfsskrapanaygzqbqdqoedyhylyechgngtgualotobokypwzwjwawtefere
rvynmnanhtcvsvivxrgdydqdnpklelyldnotktgttlsbqbobzharcrerpfezizmz
fdihohuhvbmpupcplzqxaxkxbxufgfsfswzonoboiudwtwjwyshezereoqlmfmzm
eopuluhuumtcrcpcaibsdsfsqgfajanagejipiviwcnqvqdqmarybylycyvghgtg
txapopcpjvexuxkxztifafsfprmngnanfpqvmvivvnudsdqdbjctetgtrhgbkbob
hfkjqjwjxdorwrernbszczmzdzwhihuhuybqpqdqkwfyvylyaujgbgtgqsnohobo
gqrwnwjwwovetereckdufuhusihclcpciglkrkxkyepsxsfsoctadanaeaxijivi
vzcrqrerlxgzwzmzbvkhchuhrtopipcphrsxoxkxxpwfufsfdlevgvivtjidmdqd
jhmlslylzfqtytgtpdubebobfbyjkjwjwadsrsfsmyhaxanacwlidivisupqjqdq
istypylyyqxgvgtgemfwhwjwukjenerekinmtmzmagruzuhuqevcfcpcgczklkxk
xbetstgtnzibybobdxmjejwjtvqrkrerjtuzqzmzzryhwhuhfngxixkxvlkfofsf
ljonunanbhsvavivrfwdgdqdhdalmlylycfutuhuoajczcpceynkfkxkuwrslsfs
kuvaranaaszixivigohyjylywmlgpgtgmkpovobocitwbwjwsgxehereiebmnmzm
zdgvuvivpbkdadqdfzolglylvxstmtgtlvwbsbobbtajyjwjhpizkzmzxnmhqhuh
nlqpwpcpdjuxcxkxthyfifsfjfcnonanaehwvwjwqcleberegapmhmzmwytunuhu
mwxctcpccubkzkxkiqjalanayoniriviomrqxqdqekvydylyuizgjgtgkgdopobo
bfixwxkxrdmfcfsfhbqninanxzuvovivnxydudqddvclalyljrkbmbobzpojsjwj
pnsryrerflwzezmzvjahkhuhlhepqpcpcgjyxylysengdgtgicrojoboyavwpwjw
oyzevereewdmbmzmkslcncpcaqpktkxkqotszsfsgmxafanawkbilivimifqrqdq
dhkzyzmztfohehuhjdspkpcpzbwxqxkxpzafwfsffxencnanltmdodqdbrqlulyl
rputatgthnybgbobxlcjmjwjnjgrsrereilazanaugpifiviketqlqdqacxyryly
qabgxgtggyfodobomuneperecsrmvmzmsqvubuhuiozchcpcymdknkxkokhstsfs
fjmbabobvhqjgjwjlfurmrerbdyzszmzrbchyhuhhzgpepcpnvofqfsfdtsnwnan
trwvcvivjpadidqdznelolylplitutgtgkncbcpcwirkhkxkmgvsnsfscezatana
scdiziviiahqfqdqowpgrgtgeutoxobousxwdwjwkqbejereaofmpmzmqmjuvuhu
hlodcdqdxjslilylnhwtotgtdfabubobtdejajwjjbirgrerpxqhshuhfvupypcp
vtyxexkxlrcfkfsfbpgnqnanrnkvwvivimpedereyktmjmzmoixupuhuegbcvcpc
uefkbkxkkcjshsfsqyritivigwvqzqdqwuzyfylymsdglgtgcqhorobosolwxwjw

The decryption function is

where a - 1 is the modular multiplicative inverse of a modulo m. I.e., it satisfies the equation

The multiplicative inverse of a only exists if a and m are coprime. Hence without the restriction on a decryption might not be possible. It can be shown as follows that decryption function is the inverse of the encryption function,

Read more ...

 

ROT13 Cipher
Applying ROT13 to a piece of text merely requires examining its alphabetic characters and replacing each one by the letter 13 places further along in the alphabet, wrapping back to the beginning if necessary. A becomes N, B becomes O, and so on up to M, which becomes Z, then the sequence continues at the beginning of the alphabet: N becomes A, O becomes B, and so on to Z, which becomes M. Only those letters which occur in the English alphabet are affected; numbers, symbols, whitespace, and all other characters are left unchanged. Because there are 26 letters in the English alphabet and 26 = 2 * 13, the ROT13 function is its own inverse:

ROT13(ROT13(x)) = x for any basic Latin-alphabet text x


An example plaintext to ciphertext using ROT13:

Plain: impedere
Cipher: vzcrqrer

Read more ...

 

Polybius Square

A Polybius Square is a table that allows someone to translate letters into numbers. To give a small level of encryption, this table can be randomized and shared with the recipient. In order to fit the 26 letters of the alphabet into the 25 spots created by the table, the letters i and j are usually combined.
1 2 3 4 5
1 A B C D E
2 F G H I/J K
3 L M N O P
4 Q R S T U
5 V W X Y Z

Basic Form:
Plain: impedere
Cipher: 4223535141512451

Extended Methods:
Method #1

Plaintext: impedere
method variations:
orukikwktwzpopbpybeutugudgkzyzmz

Method #2
Bifid cipher
The message is converted to its coordinates in the usual manner, but they are written vertically beneath:
i m p e d e r e 
4 2 5 5 4 5 2 5 
2 3 3 1 1 1 4 1 
They are then read out in rows:
4255452523311141
Then divided up into pairs again, and the pairs turned back into letters using the square:
Plain: impedere
Cipher: izywmcad

Read more ...
Method #3

Plaintext: impedere
method variations:
gxxqvfyq xxqvfyqg xqvfyqgx
qvfyqgxx vfyqgxxq fyqgxxqv
yqgxxqvf qgxxqvfy

Read more ...[RUS] , [EN]

 

Permutation Cipher
In classical cryptography, a permutation cipher is a transposition cipher in which the key is a permutation. To apply a cipher, a random permutation of size E is generated (the larger the value of E the more secure the cipher). The plaintext is then broken into segments of size E and the letters within that segment are permuted according to this key.
In theory, any transposition cipher can be viewed as a permutation cipher where E is equal to the length of the plaintext; this is too cumbersome a generalisation to use in actual practice, however.
The idea behind a permutation cipher is to keep the plaintext characters unchanged, butalter their positions by rearrangement using a permutation
This cipher is defined as:
Let m be a positive integer, and K consist of all permutations of {1,...,m}
For a key (permutation) , define:
The encryption function
The decryption function
A small example, assuming m = 6, and the key is the permutation :

The first row is the value of i, and the second row is the corresponding value of (i)
The inverse permutation, is constructed by interchanging the two rows, andrearranging the columns so that the first row is in increasing order, Therefore, is:

Total variation formula:

e = 2,718281828 , n - plaintext length

Plaintext: impedere

first 5040 cipher variations(40320 total)
impedere impedeer impedree impedree impedere impedeer impeedre impeeder impeerde impeered impeeerd
impeeedr imperede impereed imperdee imperdee imperede impereed impeeerd impeeedr impeered impeerde
impeedre impeeder impdeere impdeeer impderee impderee impdeere impdeeer impdeere impdeeer impderee
impderee impdeere impdeeer impdreee impdreee impdreee impdreee impdreee impdreee impdeere impdeeer
impderee impderee impdeere impdeeer impedere impedeer impedree impedree impedere impedeer impeedre
impeeder impeerde impeered impeeerd impeeedr imperede impereed imperdee imperdee imperede impereed
impeeerd impeeedr impeered impeerde impeedre impeeder imprdeee imprdeee imprdeee imprdeee imprdeee
imprdeee impredee impredee impreede impreeed impreeed impreede impreede impreeed impredee impredee
impreede impreeed impreeed impreede impreeed impreede impredee impredee impedere impedeer impedree
impedree impedere impedeer impeedre impeeder impeerde impeered impeeerd impeeedr imperede impereed
imperdee imperdee imperede impereed impeeerd impeeedr impeered impeerde impeedre impeeder imepdere
imepdeer imepdree imepdree imepdere imepdeer imepedre imepeder imeperde imepered imepeerd imepeedr
imeprede imepreed imeprdee imeprdee imeprede imepreed imepeerd imepeedr imepered imeperde imepedre
imepeder imedpere imedpeer imedpree imedpree imedpere imedpeer imedepre imedeper imederpe imederep
imedeerp imedeepr imedrepe imedreep imedrpee imedrpee imedrepe imedreep imedeerp imedeepr imederep
imederpe imedepre imedeper imeedpre imeedper imeedrpe imeedrep imeederp imeedepr imeepdre imeepder
imeeprde imeepred imeeperd imeepedr imeerpde imeerped imeerdpe imeerdep imeeredp imeerepd imeeeprd
imeeepdr imeeerpd imeeerdp imeeedrp imeeedpr imerdepe imerdeep imerdpee imerdpee imerdepe imerdeep
imeredpe imeredep imerepde imereped imereepd imereedp imerpede imerpeed imerpdee imerpdee imerpede
imerpeed imereepd imereedp imereped imerepde imeredpe imeredep imeederp imeedepr imeedrep imeedrpe
imeedpre imeedper imeeedrp imeeedpr imeeerdp imeeerpd imeeeprd imeeepdr imeeredp imeerepd imeerdep
imeerdpe imeerpde imeerped imeeperd imeepedr imeepred imeeprde imeepdre imeepder imdepere imdepeer
imdepree imdepree imdepere imdepeer imdeepre imdeeper imdeerpe imdeerep imdeeerp imdeeepr imderepe
imdereep imderpee imderpee imderepe imdereep imdeeerp imdeeepr imdeerep imdeerpe imdeepre imdeeper
imdpeere imdpeeer imdperee imdperee imdpeere imdpeeer imdpeere imdpeeer imdperee imdperee imdpeere
imdpeeer imdpreee imdpreee imdpreee imdpreee imdpreee imdpreee imdpeere imdpeeer imdperee imdperee
imdpeere imdpeeer imdepere imdepeer imdepree imdepree imdepere imdepeer imdeepre imdeeper imdeerpe
imdeerep imdeeerp imdeeepr imderepe imdereep imderpee imderpee imderepe imdereep imdeeerp imdeeepr
imdeerep imdeerpe imdeepre imdeeper imdrpeee imdrpeee imdrpeee imdrpeee imdrpeee imdrpeee imdrepee
imdrepee imdreepe imdreeep imdreeep imdreepe imdreepe imdreeep imdrepee imdrepee imdreepe imdreeep
imdreeep imdreepe imdreeep imdreepe imdrepee imdrepee imdepere imdepeer imdepree imdepree imdepere
imdepeer imdeepre imdeeper imdeerpe imdeerep imdeeerp imdeeepr imderepe imdereep imderpee imderpee
imderepe imdereep imdeeerp imdeeepr imdeerep imdeerpe imdeepre imdeeper imeedpre imeedper imeedrpe
imeedrep imeederp imeedepr imeepdre imeepder imeeprde imeepred imeeperd imeepedr imeerpde imeerped
imeerdpe imeerdep imeeredp imeerepd imeeeprd imeeepdr imeeerpd imeeerdp imeeedrp imeeedpr imedepre
imedeper imederpe imederep imedeerp imedeepr imedpere imedpeer imedpree imedpree imedpere imedpeer
imedrpee imedrpee imedrepe imedreep imedreep imedrepe imedepre imedeper imederpe imederep imedeerp
imedeepr imepdere imepdeer imepdree imepdree imepdere imepdeer imepedre imepeder imeperde imepered
imepeerd imepeedr imeprede imepreed imeprdee imeprdee imeprede imepreed imepeerd imepeedr imepered
imeperde imepedre imepeder imerdpee imerdpee imerdepe imerdeep imerdeep imerdepe imerpdee imerpdee
imerpede imerpeed imerpeed imerpede imerepde imereped imeredpe imeredep imereedp imereepd imereped
imerepde imereepd imereedp imeredep imeredpe imeedpre imeedper imeedrpe imeedrep imeederp imeedepr
imeepdre imeepder imeeprde imeepred imeeperd imeepedr imeerpde imeerped imeerdpe imeerdep imeeredp
imeerepd imeeeprd imeeepdr imeeerpd imeeerdp imeeedrp imeeedpr imredepe imredeep imredpee imredpee
imredepe imredeep imreedpe imreedep imreepde imreeped imreeepd imreeedp imrepede imrepeed imrepdee
imrepdee imrepede imrepeed imreeepd imreeedp imreeped imreepde imreedpe imreedep imrdeepe imrdeeep
imrdepee imrdepee imrdeepe imrdeeep imrdeepe imrdeeep imrdepee imrdepee imrdeepe imrdeeep imrdpeee
imrdpeee imrdpeee imrdpeee imrdpeee imrdpeee imrdeepe imrdeeep imrdepee imrdepee imrdeepe imrdeeep
imredepe imredeep imredpee imredpee imredepe imredeep imreedpe imreedep imreepde imreeped imreeepd
imreeedp imrepede imrepeed imrepdee imrepdee imrepede imrepeed imreeepd imreeedp imreeped imreepde
imreedpe imreedep imrpdeee imrpdeee imrpdeee imrpdeee imrpdeee imrpdeee imrpedee imrpedee imrpeede
imrpeeed imrpeeed imrpeede imrpeede imrpeeed imrpedee imrpedee imrpeede imrpeeed imrpeeed imrpeede
imrpeeed imrpeede imrpedee imrpedee imredepe imredeep imredpee imredpee imredepe imredeep imreedpe
imreedep imreepde imreeped imreeepd imreeedp imrepede imrepeed imrepdee imrepdee imrepede imrepeed
imreeepd imreeedp imreeped imreepde imreedpe imreedep imeederp imeedepr imeedrep imeedrpe imeedpre
imeedper imeeedrp imeeedpr imeeerdp imeeerpd imeeeprd imeeepdr imeeredp imeerepd imeerdep imeerdpe
imeerpde imeerped imeeperd imeepedr imeepred imeeprde imeepdre imeepder imedeerp imedeepr imederep
imederpe imedepre imedeper imedeerp imedeepr imederep imederpe imedepre imedeper imedreep imedrepe
imedreep imedrepe imedrpee imedrpee imedpere imedpeer imedpree imedpree imedpere imedpeer imeederp
imeedepr imeedrep imeedrpe imeedpre imeedper imeeedrp imeeedpr imeeerdp imeeerpd imeeeprd imeeepdr
imeeredp imeerepd imeerdep imeerdpe imeerpde imeerped imeeperd imeepedr imeepred imeeprde imeepdre
imeepder imerdeep imerdepe imerdeep imerdepe imerdpee imerdpee imeredep imeredpe imereedp imereepd
imereped imerepde imereedp imereepd imeredep imeredpe imerepde imereped imerpeed imerpede imerpeed
imerpede imerpdee imerpdee imepdere imepdeer imepdree imepdree imepdere imepdeer imepedre imepeder
imeperde imepered imepeerd imepeedr imeprede imepreed imeprdee imeprdee imeprede imepreed imepeerd
imepeedr imepered imeperde imepedre imepeder ipmedere ipmedeer ipmedree ipmedree ipmedere ipmedeer
ipmeedre ipmeeder ipmeerde ipmeered ipmeeerd ipmeeedr ipmerede ipmereed ipmerdee ipmerdee ipmerede
ipmereed ipmeeerd ipmeeedr ipmeered ipmeerde ipmeedre ipmeeder ipmdeere ipmdeeer ipmderee ipmderee
ipmdeere ipmdeeer ipmdeere ipmdeeer ipmderee ipmderee ipmdeere ipmdeeer ipmdreee ipmdreee ipmdreee
ipmdreee ipmdreee ipmdreee ipmdeere ipmdeeer ipmderee ipmderee ipmdeere ipmdeeer ipmedere ipmedeer
ipmedree ipmedree ipmedere ipmedeer ipmeedre ipmeeder ipmeerde ipmeered ipmeeerd ipmeeedr ipmerede
ipmereed ipmerdee ipmerdee ipmerede ipmereed ipmeeerd ipmeeedr ipmeered ipmeerde ipmeedre ipmeeder
ipmrdeee ipmrdeee ipmrdeee ipmrdeee ipmrdeee ipmrdeee ipmredee ipmredee ipmreede ipmreeed ipmreeed
ipmreede ipmreede ipmreeed ipmredee ipmredee ipmreede ipmreeed ipmreeed ipmreede ipmreeed ipmreede
ipmredee ipmredee ipmedere ipmedeer ipmedree ipmedree ipmedere ipmedeer ipmeedre ipmeeder ipmeerde
ipmeered ipmeeerd ipmeeedr ipmerede ipmereed ipmerdee ipmerdee ipmerede ipmereed ipmeeerd ipmeeedr
ipmeered ipmeerde ipmeedre ipmeeder ipemdere ipemdeer ipemdree ipemdree ipemdere ipemdeer ipemedre
ipemeder ipemerde ipemered ipemeerd ipemeedr ipemrede ipemreed ipemrdee ipemrdee ipemrede ipemreed
ipemeerd ipemeedr ipemered ipemerde ipemedre ipemeder ipedmere ipedmeer ipedmree ipedmree ipedmere
ipedmeer ipedemre ipedemer ipederme ipederem ipedeerm ipedeemr ipedreme ipedreem ipedrmee ipedrmee
ipedreme ipedreem ipedeerm ipedeemr ipederem ipederme ipedemre ipedemer ipeedmre ipeedmer ipeedrme
ipeedrem ipeederm ipeedemr ipeemdre ipeemder ipeemrde ipeemred ipeemerd ipeemedr ipeermde ipeermed
ipeerdme ipeerdem ipeeredm ipeeremd ipeeemrd ipeeemdr ipeeermd ipeeerdm ipeeedrm ipeeedmr iperdeme
iperdeem iperdmee iperdmee iperdeme iperdeem iperedme iperedem iperemde iperemed ipereemd ipereedm
ipermede ipermeed ipermdee ipermdee ipermede ipermeed ipereemd ipereedm iperemed iperemde iperedme
iperedem ipeederm ipeedemr ipeedrem ipeedrme ipeedmre ipeedmer ipeeedrm ipeeedmr ipeeerdm ipeeermd
ipeeemrd ipeeemdr ipeeredm ipeeremd ipeerdem ipeerdme ipeermde ipeermed ipeemerd ipeemedr ipeemred
ipeemrde ipeemdre ipeemder ipdemere ipdemeer ipdemree ipdemree ipdemere ipdemeer ipdeemre ipdeemer
ipdeerme ipdeerem ipdeeerm ipdeeemr ipdereme ipdereem ipdermee ipdermee ipdereme ipdereem ipdeeerm
ipdeeemr ipdeerem ipdeerme ipdeemre ipdeemer ipdmeere ipdmeeer ipdmeree ipdmeree ipdmeere ipdmeeer
ipdmeere ipdmeeer ipdmeree ipdmeree ipdmeere ipdmeeer ipdmreee ipdmreee ipdmreee ipdmreee ipdmreee
ipdmreee ipdmeere ipdmeeer ipdmeree ipdmeree ipdmeere ipdmeeer ipdemere ipdemeer ipdemree ipdemree
ipdemere ipdemeer ipdeemre ipdeemer ipdeerme ipdeerem ipdeeerm ipdeeemr ipdereme ipdereem ipdermee
ipdermee ipdereme ipdereem ipdeeerm ipdeeemr ipdeerem ipdeerme ipdeemre ipdeemer ipdrmeee ipdrmeee
ipdrmeee ipdrmeee ipdrmeee ipdrmeee ipdremee ipdremee ipdreeme ipdreeem ipdreeem ipdreeme ipdreeme
ipdreeem ipdremee ipdremee ipdreeme ipdreeem ipdreeem ipdreeme ipdreeem ipdreeme ipdremee ipdremee
ipdemere ipdemeer ipdemree ipdemree ipdemere ipdemeer ipdeemre ipdeemer ipdeerme ipdeerem ipdeeerm
ipdeeemr ipdereme ipdereem ipdermee ipdermee ipdereme ipdereem ipdeeerm ipdeeemr ipdeerem ipdeerme
ipdeemre ipdeemer ipeedmre ipeedmer ipeedrme ipeedrem ipeederm ipeedemr ipeemdre ipeemder ipeemrde
ipeemred ipeemerd ipeemedr ipeermde ipeermed ipeerdme ipeerdem ipeeredm ipeeremd ipeeemrd ipeeemdr
ipeeermd ipeeerdm ipeeedrm ipeeedmr ipedemre ipedemer ipederme ipederem ipedeerm ipedeemr ipedmere
ipedmeer ipedmree ipedmree ipedmere ipedmeer ipedrmee ipedrmee ipedreme ipedreem ipedreem ipedreme
ipedemre ipedemer ipederme ipederem ipedeerm ipedeemr ipemdere ipemdeer ipemdree ipemdree ipemdere
ipemdeer ipemedre ipemeder ipemerde ipemered ipemeerd ipemeedr ipemrede ipemreed ipemrdee ipemrdee
ipemrede ipemreed ipemeerd ipemeedr ipemered ipemerde ipemedre ipemeder iperdmee iperdmee iperdeme
iperdeem iperdeem iperdeme ipermdee ipermdee ipermede ipermeed ipermeed ipermede iperemde iperemed
iperedme iperedem ipereedm ipereemd iperemed iperemde ipereemd ipereedm iperedem iperedme ipeedmre
ipeedmer ipeedrme ipeedrem ipeederm ipeedemr ipeemdre ipeemder ipeemrde ipeemred ipeemerd ipeemedr
ipeermde ipeermed ipeerdme ipeerdem ipeeredm ipeeremd ipeeemrd ipeeemdr ipeeermd ipeeerdm ipeeedrm
ipeeedmr ipredeme ipredeem ipredmee ipredmee ipredeme ipredeem ipreedme ipreedem ipreemde ipreemed
ipreeemd ipreeedm ipremede ipremeed ipremdee ipremdee ipremede ipremeed ipreeemd ipreeedm ipreemed
ipreemde ipreedme ipreedem iprdeeme iprdeeem iprdemee iprdemee iprdeeme iprdeeem iprdeeme iprdeeem
iprdemee iprdemee iprdeeme iprdeeem iprdmeee iprdmeee iprdmeee iprdmeee iprdmeee iprdmeee iprdeeme
iprdeeem iprdemee iprdemee iprdeeme iprdeeem ipredeme ipredeem ipredmee ipredmee ipredeme ipredeem
ipreedme ipreedem ipreemde ipreemed ipreeemd ipreeedm ipremede ipremeed ipremdee ipremdee ipremede
ipremeed ipreeemd ipreeedm ipreemed ipreemde ipreedme ipreedem iprmdeee iprmdeee iprmdeee iprmdeee
iprmdeee iprmdeee iprmedee iprmedee iprmeede iprmeeed iprmeeed iprmeede iprmeede iprmeeed iprmedee
iprmedee iprmeede iprmeeed iprmeeed iprmeede iprmeeed iprmeede iprmedee iprmedee ipredeme ipredeem
ipredmee ipredmee ipredeme ipredeem ipreedme ipreedem ipreemde ipreemed ipreeemd ipreeedm ipremede
ipremeed ipremdee ipremdee ipremede ipremeed ipreeemd ipreeedm ipreemed ipreemde ipreedme ipreedem
ipeederm ipeedemr ipeedrem ipeedrme ipeedmre ipeedmer ipeeedrm ipeeedmr ipeeerdm ipeeermd ipeeemrd
ipeeemdr ipeeredm ipeeremd ipeerdem ipeerdme ipeermde ipeermed ipeemerd ipeemedr ipeemred ipeemrde
ipeemdre ipeemder ipedeerm ipedeemr ipederem ipederme ipedemre ipedemer ipedeerm ipedeemr ipederem
ipederme ipedemre ipedemer ipedreem ipedreme ipedreem ipedreme ipedrmee ipedrmee ipedmere ipedmeer
ipedmree ipedmree ipedmere ipedmeer ipeederm ipeedemr ipeedrem ipeedrme ipeedmre ipeedmer ipeeedrm
ipeeedmr ipeeerdm ipeeermd ipeeemrd ipeeemdr ipeeredm ipeeremd ipeerdem ipeerdme ipeermde ipeermed
ipeemerd ipeemedr ipeemred ipeemrde ipeemdre ipeemder iperdeem iperdeme iperdeem iperdeme iperdmee
iperdmee iperedem iperedme ipereedm ipereemd iperemed iperemde ipereedm ipereemd iperedem iperedme
iperemde iperemed ipermeed ipermede ipermeed ipermede ipermdee ipermdee ipemdere ipemdeer ipemdree
ipemdree ipemdere ipemdeer ipemedre ipemeder ipemerde ipemered ipemeerd ipemeedr ipemrede ipemreed
ipemrdee ipemrdee ipemrede ipemreed ipemeerd ipemeedr ipemered ipemerde ipemedre ipemeder iepmdere
iepmdeer iepmdree iepmdree iepmdere iepmdeer iepmedre iepmeder iepmerde iepmered iepmeerd iepmeedr
iepmrede iepmreed iepmrdee iepmrdee iepmrede iepmreed iepmeerd iepmeedr iepmered iepmerde iepmedre
iepmeder iepdmere iepdmeer iepdmree iepdmree iepdmere iepdmeer iepdemre iepdemer iepderme iepderem
iepdeerm iepdeemr iepdreme iepdreem iepdrmee iepdrmee iepdreme iepdreem iepdeerm iepdeemr iepderem
iepderme iepdemre iepdemer iepedmre iepedmer iepedrme iepedrem iepederm iepedemr iepemdre iepemder
iepemrde iepemred iepemerd iepemedr iepermde iepermed ieperdme ieperdem ieperedm ieperemd iepeemrd
iepeemdr iepeermd iepeerdm iepeedrm iepeedmr ieprdeme ieprdeem ieprdmee ieprdmee ieprdeme ieprdeem
iepredme iepredem iepremde iepremed iepreemd iepreedm ieprmede ieprmeed ieprmdee ieprmdee ieprmede
ieprmeed iepreemd iepreedm iepremed iepremde iepredme iepredem iepederm iepedemr iepedrem iepedrme
iepedmre iepedmer iepeedrm iepeedmr iepeerdm iepeermd iepeemrd iepeemdr ieperedm ieperemd ieperdem
ieperdme iepermde iepermed iepemerd iepemedr iepemred iepemrde iepemdre iepemder iempdere iempdeer
iempdree iempdree iempdere iempdeer iempedre iempeder iemperde iempered iempeerd iempeedr iemprede
iempreed iemprdee iemprdee iemprede iempreed iempeerd iempeedr iempered iemperde iempedre iempeder
iemdpere iemdpeer iemdpree iemdpree iemdpere iemdpeer iemdepre iemdeper iemderpe iemderep iemdeerp
iemdeepr iemdrepe iemdreep iemdrpee iemdrpee iemdrepe iemdreep iemdeerp iemdeepr iemderep iemderpe
iemdepre iemdeper iemedpre iemedper iemedrpe iemedrep iemederp iemedepr iemepdre iemepder iemeprde
iemepred iemeperd iemepedr iemerpde iemerped iemerdpe iemerdep iemeredp iemerepd iemeeprd iemeepdr
iemeerpd iemeerdp iemeedrp iemeedpr iemrdepe iemrdeep iemrdpee iemrdpee iemrdepe iemrdeep iemredpe
iemredep iemrepde iemreped iemreepd iemreedp iemrpede iemrpeed iemrpdee iemrpdee iemrpede iemrpeed
iemreepd iemreedp iemreped iemrepde iemredpe iemredep iemederp iemedepr iemedrep iemedrpe iemedpre
iemedper iemeedrp iemeedpr iemeerdp iemeerpd iemeeprd iemeepdr iemeredp iemerepd iemerdep iemerdpe
iemerpde iemerped iemeperd iemepedr iemepred iemeprde iemepdre iemepder iedmpere iedmpeer iedmpree
iedmpree iedmpere iedmpeer iedmepre iedmeper iedmerpe iedmerep iedmeerp iedmeepr iedmrepe iedmreep
iedmrpee iedmrpee iedmrepe iedmreep iedmeerp iedmeepr iedmerep iedmerpe iedmepre iedmeper iedpmere
iedpmeer iedpmree iedpmree iedpmere iedpmeer iedpemre iedpemer iedperme iedperem iedpeerm iedpeemr
iedpreme iedpreem iedprmee iedprmee iedpreme iedpreem iedpeerm iedpeemr iedperem iedperme iedpemre
iedpemer iedepmre iedepmer iedeprme iedeprem iedeperm iedepemr iedempre iedemper iedemrpe iedemrep
iedemerp iedemepr iedermpe iedermep iederpme iederpem iederepm iederemp iedeemrp iedeempr iedeermp
iedeerpm iedeeprm iedeepmr iedrpeme iedrpeem iedrpmee iedrpmee iedrpeme iedrpeem iedrepme iedrepem
iedrempe iedremep iedreemp iedreepm iedrmepe iedrmeep iedrmpee iedrmpee iedrmepe iedrmeep iedreemp
iedreepm iedremep iedrempe iedrepme iedrepem iedeperm iedepemr iedeprem iedeprme iedepmre iedepmer
iedeeprm iedeepmr iedeerpm iedeermp iedeemrp iedeempr iederepm iederemp iederpem iederpme iedermpe
iedermep iedemerp iedemepr iedemrep iedemrpe iedempre iedemper ieemdpre ieemdper ieemdrpe ieemdrep
ieemderp ieemdepr ieempdre ieempder ieemprde ieempred ieemperd ieempedr ieemrpde ieemrped ieemrdpe
ieemrdep ieemredp ieemrepd ieemeprd ieemepdr ieemerpd ieemerdp ieemedrp ieemedpr ieedmpre ieedmper
ieedmrpe ieedmrep ieedmerp ieedmepr ieedpmre ieedpmer ieedprme ieedprem ieedperm ieedpemr ieedrpme
ieedrpem ieedrmpe ieedrmep ieedremp ieedrepm ieedeprm ieedepmr ieederpm ieedermp ieedemrp ieedempr
ieepdmre ieepdmer ieepdrme ieepdrem ieepderm ieepdemr ieepmdre ieepmder ieepmrde ieepmred ieepmerd
ieepmedr ieeprmde ieeprmed ieeprdme ieeprdem ieepredm ieepremd ieepemrd ieepemdr ieepermd ieeperdm
ieepedrm ieepedmr ieerdpme ieerdpem ieerdmpe ieerdmep ieerdemp ieerdepm ieerpdme ieerpdem ieerpmde
ieerpmed ieerpemd ieerpedm ieermpde ieermped ieermdpe ieermdep ieermedp ieermepd ieerepmd ieerepdm
ieerempd ieeremdp ieeredmp ieeredpm ieeedprm ieeedpmr ieeedrpm ieeedrmp ieeedmrp ieeedmpr ieeepdrm
ieeepdmr ieeeprdm ieeeprmd ieeepmrd ieeepmdr ieeerpdm ieeerpmd ieeerdpm ieeerdmp ieeermdp ieeermpd
ieeemprd ieeempdr ieeemrpd ieeemrdp ieeemdrp ieeemdpr iermdepe iermdeep iermdpee iermdpee iermdepe
iermdeep iermedpe iermedep iermepde iermeped iermeepd iermeedp iermpede iermpeed iermpdee iermpdee
iermpede iermpeed iermeepd iermeedp iermeped iermepde iermedpe iermedep ierdmepe ierdmeep ierdmpee
ierdmpee ierdmepe ierdmeep ierdempe ierdemep ierdepme ierdepem ierdeepm ierdeemp ierdpeme ierdpeem
ierdpmee ierdpmee ierdpeme ierdpeem ierdeepm ierdeemp ierdepem ierdepme ierdempe ierdemep ieredmpe
ieredmep ieredpme ieredpem ieredepm ieredemp ieremdpe ieremdep ierempde ieremped ieremepd ieremedp
ierepmde ierepmed ierepdme ierepdem ierepedm ierepemd iereempd iereemdp iereepmd iereepdm iereedpm
iereedmp ierpdeme ierpdeem ierpdmee ierpdmee ierpdeme ierpdeem ierpedme ierpedem ierpemde ierpemed
ierpeemd ierpeedm ierpmede ierpmeed ierpmdee ierpmdee ierpmede ierpmeed ierpeemd ierpeedm ierpemed
ierpemde ierpedme ierpedem ieredepm ieredemp ieredpem ieredpme ieredmpe ieredmep iereedpm iereedmp
iereepdm iereepmd iereempd iereemdp ierepedm ierepemd ierepdem ierepdme ierepmde ierepmed ieremepd
ieremedp ieremped ierempde ieremdpe ieremdep ieemderp ieemdepr ieemdrep ieemdrpe ieemdpre ieemdper
ieemedrp ieemedpr ieemerdp ieemerpd ieemeprd ieemepdr ieemredp ieemrepd ieemrdep ieemrdpe ieemrpde
ieemrped ieemperd ieempedr ieempred ieemprde ieempdre ieempder ieedmerp ieedmepr ieedmrep ieedmrpe
ieedmpre ieedmper ieedemrp ieedempr ieedermp ieederpm ieedeprm ieedepmr ieedremp ieedrepm ieedrmep
ieedrmpe ieedrpme ieedrpem ieedperm ieedpemr ieedprem ieedprme ieedpmre ieedpmer ieeedmrp ieeedmpr
ieeedrmp ieeedrpm ieeedprm ieeedpmr ieeemdrp ieeemdpr ieeemrdp ieeemrpd ieeemprd ieeempdr ieeermdp
ieeermpd ieeerdmp ieeerdpm ieeerpdm ieeerpmd ieeepmrd ieeepmdr ieeeprmd ieeeprdm ieeepdrm ieeepdmr
ieerdemp ieerdepm ieerdmep ieerdmpe ieerdpme ieerdpem ieeredmp ieeredpm ieeremdp ieerempd ieerepmd
ieerepdm ieermedp ieermepd ieermdep ieermdpe ieermpde ieermped ieerpemd ieerpedm ieerpmed ieerpmde
ieerpdme ieerpdem ieepderm ieepdemr ieepdrem ieepdrme ieepdmre ieepdmer ieepedrm ieepedmr ieeperdm
ieepermd ieepemrd ieepemdr ieepredm ieepremd ieeprdem ieeprdme ieeprmde ieeprmed ieepmerd ieepmedr
ieepmred ieepmrde ieepmdre ieepmder idpemere idpemeer idpemree idpemree idpemere idpemeer idpeemre
idpeemer idpeerme idpeerem idpeeerm idpeeemr idpereme idpereem idpermee idpermee idpereme idpereem
idpeeerm idpeeemr idpeerem idpeerme idpeemre idpeemer idpmeere idpmeeer idpmeree idpmeree idpmeere
idpmeeer idpmeere idpmeeer idpmeree idpmeree idpmeere idpmeeer idpmreee idpmreee idpmreee idpmreee
idpmreee idpmreee idpmeere idpmeeer idpmeree idpmeree idpmeere idpmeeer idpemere idpemeer idpemree
idpemree idpemere idpemeer idpeemre idpeemer idpeerme idpeerem idpeeerm idpeeemr idpereme idpereem
idpermee idpermee idpereme idpereem idpeeerm idpeeemr idpeerem idpeerme idpeemre idpeemer idprmeee
idprmeee idprmeee idprmeee idprmeee idprmeee idpremee idpremee idpreeme idpreeem idpreeem idpreeme
idpreeme idpreeem idpremee idpremee idpreeme idpreeem idpreeem idpreeme idpreeem idpreeme idpremee
idpremee idpemere idpemeer idpemree idpemree idpemere idpemeer idpeemre idpeemer idpeerme idpeerem
idpeeerm idpeeemr idpereme idpereem idpermee idpermee idpereme idpereem idpeeerm idpeeemr idpeerem
idpeerme idpeemre idpeemer idepmere idepmeer idepmree idepmree idepmere idepmeer idepemre idepemer
ideperme ideperem idepeerm idepeemr idepreme idepreem ideprmee ideprmee idepreme idepreem idepeerm
idepeemr ideperem ideperme idepemre idepemer idempere idempeer idempree idempree idempere idempeer
idemepre idemeper idemerpe idemerep idemeerp idemeepr idemrepe idemreep idemrpee idemrpee idemrepe
idemreep idemeerp idemeepr idemerep idemerpe idemepre idemeper ideempre ideemper ideemrpe ideemrep
ideemerp ideemepr ideepmre ideepmer ideeprme ideeprem ideeperm ideepemr ideerpme ideerpem ideermpe
ideermep ideeremp ideerepm ideeeprm ideeepmr ideeerpm ideeermp ideeemrp ideeempr idermepe idermeep
idermpee idermpee idermepe idermeep iderempe ideremep iderepme iderepem idereepm idereemp iderpeme
iderpeem iderpmee iderpmee iderpeme iderpeem idereepm idereemp iderepem iderepme iderempe ideremep
ideemerp ideemepr ideemrep ideemrpe ideempre ideemper ideeemrp ideeempr ideeermp ideeerpm ideeeprm
ideeepmr ideeremp ideerepm ideermep ideermpe ideerpme ideerpem ideeperm ideepemr ideeprem ideeprme
ideepmre ideepmer idmepere idmepeer idmepree idmepree idmepere idmepeer idmeepre idmeeper idmeerpe
idmeerep idmeeerp idmeeepr idmerepe idmereep idmerpee idmerpee idmerepe idmereep idmeeerp idmeeepr
idmeerep idmeerpe idmeepre idmeeper idmpeere idmpeeer idmperee idmperee idmpeere idmpeeer idmpeere
idmpeeer idmperee idmperee idmpeere idmpeeer idmpreee idmpreee idmpreee idmpreee idmpreee idmpreee
idmpeere idmpeeer idmperee idmperee idmpeere idmpeeer idmepere idmepeer idmepree idmepree idmepere
idmepeer idmeepre idmeeper idmeerpe idmeerep idmeeerp idmeeepr idmerepe idmereep idmerpee idmerpee
idmerepe idmereep idmeeerp idmeeepr idmeerep idmeerpe idmeepre idmeeper idmrpeee idmrpeee idmrpeee
idmrpeee idmrpeee idmrpeee idmrepee idmrepee idmreepe idmreeep idmreeep idmreepe idmreepe idmreeep
idmrepee idmrepee idmreepe idmreeep idmreeep idmreepe idmreeep idmreepe idmrepee idmrepee idmepere
idmepeer idmepree idmepree idmepere idmepeer idmeepre idmeeper idmeerpe idmeerep idmeeerp idmeeepr
idmerepe idmereep idmerpee idmerpee idmerepe idmereep idmeeerp idmeeepr idmeerep idmeerpe idmeepre
idmeeper ideempre ideemper ideemrpe ideemrep ideemerp ideemepr ideepmre ideepmer ideeprme ideeprem
ideeperm ideepemr ideerpme ideerpem ideermpe ideermep ideeremp ideerepm ideeeprm ideeepmr ideeerpm
ideeermp ideeemrp ideeempr idemepre idemeper idemerpe idemerep idemeerp idemeepr idempere idempeer
idempree idempree idempere idempeer idemrpee idemrpee idemrepe idemreep idemreep idemrepe idemepre
idemeper idemerpe idemerep idemeerp idemeepr idepmere idepmeer idepmree idepmree idepmere idepmeer
idepemre idepemer ideperme ideperem idepeerm idepeemr idepreme idepreem ideprmee ideprmee idepreme
idepreem idepeerm idepeemr ideperem ideperme idepemre idepemer idermpee idermpee idermepe idermeep
idermeep idermepe iderpmee iderpmee iderpeme iderpeem iderpeem iderpeme iderepme iderepem iderempe
ideremep idereemp idereepm iderepem iderepme idereepm idereemp ideremep iderempe ideempre ideemper
ideemrpe ideemrep ideemerp ideemepr ideepmre ideepmer ideeprme ideeprem ideeperm ideepemr ideerpme
ideerpem ideermpe ideermep ideeremp ideerepm ideeeprm ideeepmr ideeerpm ideeermp ideeemrp ideeempr
idremepe idremeep idrempee idrempee idremepe idremeep idreempe idreemep idreepme idreepem idreeepm
idreeemp idrepeme idrepeem idrepmee idrepmee idrepeme idrepeem idreeepm idreeemp idreepem idreepme
idreempe idreemep idrmeepe idrmeeep idrmepee idrmepee idrmeepe idrmeeep idrmeepe idrmeeep idrmepee
idrmepee idrmeepe idrmeeep idrmpeee idrmpeee idrmpeee idrmpeee idrmpeee idrmpeee idrmeepe idrmeeep
idrmepee idrmepee idrmeepe idrmeeep idremepe idremeep idrempee idrempee idremepe idremeep idreempe
idreemep idreepme idreepem idreeepm idreeemp idrepeme idrepeem idrepmee idrepmee idrepeme idrepeem
idreeepm idreeemp idreepem idreepme idreempe idreemep idrpmeee idrpmeee idrpmeee idrpmeee idrpmeee
idrpmeee idrpemee idrpemee idrpeeme idrpeeem idrpeeem idrpeeme idrpeeme idrpeeem idrpemee idrpemee
idrpeeme idrpeeem idrpeeem idrpeeme idrpeeem idrpeeme idrpemee idrpemee idremepe idremeep idrempee
idrempee idremepe idremeep idreempe idreemep idreepme idreepem idreeepm idreeemp idrepeme idrepeem
idrepmee idrepmee idrepeme idrepeem idreeepm idreeemp idreepem idreepme idreempe idreemep ideemerp
ideemepr ideemrep ideemrpe ideempre ideemper ideeemrp ideeempr ideeermp ideeerpm ideeeprm ideeepmr
ideeremp ideerepm ideermep ideermpe ideerpme ideerpem ideeperm ideepemr ideeprem ideeprme ideepmre
ideepmer idemeerp idemeepr idemerep idemerpe idemepre idemeper idemeerp idemeepr idemerep idemerpe
idemepre idemeper idemreep idemrepe idemreep idemrepe idemrpee idemrpee idempere idempeer idempree
idempree idempere idempeer ideemerp ideemepr ideemrep ideemrpe ideempre ideemper ideeemrp ideeempr
ideeermp ideeerpm ideeeprm ideeepmr ideeremp ideerepm ideermep ideermpe ideerpme ideerpem ideeperm
ideepemr ideeprem ideeprme ideepmre ideepmer idermeep idermepe idermeep idermepe idermpee idermpee
ideremep iderempe idereemp idereepm iderepem iderepme idereemp idereepm ideremep iderempe iderepme
iderepem iderpeem iderpeme iderpeem iderpeme iderpmee iderpmee idepmere idepmeer idepmree idepmree
idepmere idepmeer idepemre idepemer ideperme ideperem idepeerm idepeemr idepreme idepreem ideprmee
ideprmee idepreme idepreem idepeerm idepeemr ideperem ideperme idepemre idepemer iepedmre iepedmer
iepedrme iepedrem iepederm iepedemr iepemdre iepemder iepemrde iepemred iepemerd iepemedr iepermde
iepermed ieperdme ieperdem ieperedm ieperemd iepeemrd iepeemdr iepeermd iepeerdm iepeedrm iepeedmr
iepdemre iepdemer iepderme iepderem iepdeerm iepdeemr iepdmere iepdmeer iepdmree iepdmree iepdmere
iepdmeer iepdrmee iepdrmee iepdreme iepdreem iepdreem iepdreme iepdemre iepdemer iepderme iepderem
iepdeerm iepdeemr iepmdere iepmdeer iepmdree iepmdree iepmdere iepmdeer iepmedre iepmeder iepmerde
iepmered iepmeerd iepmeedr iepmrede iepmreed iepmrdee iepmrdee iepmrede iepmreed iepmeerd iepmeedr
iepmered iepmerde iepmedre iepmeder ieprdmee ieprdmee ieprdeme ieprdeem ieprdeem ieprdeme ieprmdee
ieprmdee ieprmede ieprmeed ieprmeed ieprmede iepremde iepremed iepredme iepredem iepreedm iepreemd
iepremed iepremde iepreemd iepreedm iepredem iepredme iepedmre iepedmer iepedrme iepedrem iepederm
iepedemr iepemdre iepemder iepemrde iepemred iepemerd iepemedr iepermde iepermed ieperdme ieperdem
ieperedm ieperemd iepeemrd iepeemdr iepeermd iepeerdm iepeedrm iepeedmr ieepdmre ieepdmer ieepdrme
ieepdrem ieepderm ieepdemr ieepmdre ieepmder ieepmrde ieepmred ieepmerd ieepmedr ieeprmde ieeprmed
ieeprdme ieeprdem ieepredm ieepremd ieepemrd ieepemdr ieepermd ieeperdm ieepedrm ieepedmr ieedpmre
ieedpmer ieedprme ieedprem ieedperm ieedpemr ieedmpre ieedmper ieedmrpe ieedmrep ieedmerp ieedmepr
ieedrmpe ieedrmep ieedrpme ieedrpem ieedrepm ieedremp ieedemrp ieedempr ieedermp ieederpm ieedeprm
ieedepmr ieemdpre ieemdper ieemdrpe ieemdrep ieemderp ieemdepr ieempdre ieempder ieemprde ieempred
ieemperd ieempedr ieemrpde ieemrped ieemrdpe ieemrdep ieemredp ieemrepd ieemeprd ieemepdr ieemerpd
ieemerdp ieemedrp ieemedpr ieerdmpe ieerdmep ieerdpme ieerdpem ieerdepm ieerdemp ieermdpe ieermdep
ieermpde ieermped ieermepd ieermedp ieerpmde ieerpmed ieerpdme ieerpdem ieerpedm ieerpemd ieerempd
ieeremdp ieerepmd ieerepdm ieeredpm ieeredmp ieeedmrp ieeedmpr ieeedrmp ieeedrpm ieeedprm ieeedpmr
ieeemdrp ieeemdpr ieeemrdp ieeemrpd ieeemprd ieeempdr ieeermdp ieeermpd ieeerdmp ieeerdpm ieeerpdm
ieeerpmd ieeepmrd ieeepmdr ieeeprmd ieeeprdm ieeepdrm ieeepdmr iedepmre iedepmer iedeprme iedeprem
iedeperm iedepemr iedempre iedemper iedemrpe iedemrep iedemerp iedemepr iedermpe iedermep iederpme
iederpem iederepm iederemp iedeemrp iedeempr iedeermp iedeerpm iedeeprm iedeepmr iedpemre iedpemer
iedperme iedperem iedpeerm iedpeemr iedpmere iedpmeer iedpmree iedpmree iedpmere iedpmeer iedprmee
iedprmee iedpreme iedpreem iedpreem iedpreme iedpemre iedpemer iedperme iedperem iedpeerm iedpeemr
iedmpere iedmpeer iedmpree iedmpree iedmpere iedmpeer iedmepre iedmeper iedmerpe iedmerep iedmeerp
iedmeepr iedmrepe iedmreep iedmrpee iedmrpee iedmrepe iedmreep iedmeerp iedmeepr iedmerep iedmerpe
iedmepre iedmeper iedrpmee iedrpmee iedrpeme iedrpeem iedrpeem iedrpeme iedrmpee iedrmpee iedrmepe
iedrmeep iedrmeep iedrmepe iedrempe iedremep iedrepme iedrepem iedreepm iedreemp iedremep iedrempe
iedreemp iedreepm iedrepem iedrepme iedepmre iedepmer iedeprme iedeprem iedeperm iedepemr iedempre
iedemper iedemrpe iedemrep iedemerp iedemepr iedermpe iedermep iederpme iederpem iederepm iederemp
iedeemrp iedeempr iedeermp iedeerpm iedeeprm iedeepmr iemedpre iemedper iemedrpe iemedrep iemederp
iemedepr iemepdre iemepder iemeprde iemepred iemeperd iemepedr iemerpde iemerped iemerdpe iemerdep
iemeredp iemerepd iemeeprd iemeepdr iemeerpd iemeerdp iemeedrp iemeedpr iemdepre iemdeper iemderpe
iemderep iemdeerp iemdeepr iemdpere iemdpeer iemdpree iemdpree iemdpere iemdpeer iemdrpee iemdrpee
iemdrepe iemdreep iemdreep iemdrepe iemdepre iemdeper iemderpe iemderep iemdeerp iemdeepr iempdere
iempdeer iempdree iempdree iempdere iempdeer iempedre iempeder iemperde iempered iempeerd iempeedr
iemprede iempreed iemprdee iemprdee iemprede iempreed iempeerd iempeedr iempered iemperde iempedre
iempeder iemrdpee iemrdpee iemrdepe iemrdeep iemrdeep iemrdepe iemrpdee iemrpdee iemrpede iemrpeed
iemrpeed iemrpede iemrepde iemreped iemredpe iemredep iemreedp iemreepd iemreped iemrepde iemreepd
iemreedp iemredep iemredpe iemedpre iemedper iemedrpe iemedrep iemederp iemedepr iemepdre iemepder
iemeprde iemepred iemeperd iemepedr iemerpde iemerped iemerdpe iemerdep iemeredp iemerepd iemeeprd
iemeepdr iemeerpd iemeerdp iemeedrp iemeedpr ieredmpe ieredmep ieredpme ieredpem ieredepm ieredemp
ieremdpe ieremdep ierempde ieremped ieremepd ieremedp ierepmde ierepmed ierepdme ierepdem ierepedm
ierepemd iereempd iereemdp iereepmd iereepdm iereedpm iereedmp ierdempe ierdemep ierdepme ierdepem
ierdeepm ierdeemp ierdmepe ierdmeep ierdmpee ierdmpee ierdmepe ierdmeep ierdpmee ierdpmee ierdpeme
ierdpeem ierdpeem ierdpeme ierdempe ierdemep ierdepme ierdepem ierdeepm ierdeemp iermdepe iermdeep
iermdpee iermdpee iermdepe iermdeep iermedpe iermedep iermepde iermeped iermeepd iermeedp iermpede
iermpeed iermpdee iermpdee iermpede iermpeed iermeepd iermeedp iermeped iermepde iermedpe iermedep
ierpdmee ierpdmee ierpdeme ierpdeem ierpdeem ierpdeme ierpmdee ierpmdee ierpmede ierpmeed ierpmeed
ierpmede ierpemde ierpemed ierpedme ierpedem ierpeedm ierpeemd ierpemed ierpemde ierpeemd ierpeedm
ierpedem ierpedme ieredmpe ieredmep ieredpme ieredpem ieredepm ieredemp ieremdpe ieremdep ierempde
ieremped ieremepd ieremedp ierepmde ierepmed ierepdme ierepdem ierepedm ierepemd iereempd iereemdp
iereepmd iereepdm iereedpm iereedmp ieeedmrp ieeedmpr ieeedrmp ieeedrpm ieeedprm ieeedpmr ieeemdrp
ieeemdpr ieeemrdp ieeemrpd ieeemprd ieeempdr ieeermdp ieeermpd ieeerdmp ieeerdpm ieeerpdm ieeerpmd
ieeepmrd ieeepmdr ieeeprmd ieeeprdm ieeepdrm ieeepdmr ieedemrp ieedempr ieedermp ieederpm ieedeprm
ieedepmr ieedmerp ieedmepr ieedmrep ieedmrpe ieedmpre ieedmper ieedrmep ieedrmpe ieedremp ieedrepm
ieedrpem ieedrpme ieedpmre ieedpmer ieedprme ieedprem ieedperm ieedpemr ieemderp ieemdepr ieemdrep
ieemdrpe ieemdpre ieemdper ieemedrp ieemedpr ieemerdp ieemerpd ieemeprd ieemepdr ieemredp ieemrepd
ieemrdep ieemrdpe ieemrpde ieemrped ieemperd ieempedr ieempred ieemprde ieempdre ieempder ieerdmep
ieerdmpe ieerdemp ieerdepm ieerdpem ieerdpme ieermdep ieermdpe ieermedp ieermepd ieermped ieermpde
ieeremdp ieerempd ieeredmp ieeredpm ieerepdm ieerepmd ieerpmed ieerpmde ieerpemd ieerpedm ieerpdem
ieerpdme ieepdmre ieepdmer ieepdrme ieepdrem ieepderm ieepdemr ieepmdre ieepmder ieepmrde ieepmred
ieepmerd ieepmedr ieeprmde ieeprmed ieeprdme ieeprdem ieepredm ieepremd ieepemrd ieepemdr ieepermd
ieeperdm ieepedrm ieepedmr irpedeme irpedeem irpedmee irpedmee irpedeme irpedeem irpeedme irpeedem
irpeemde irpeemed irpeeemd irpeeedm irpemede irpemeed irpemdee irpemdee irpemede irpemeed irpeeemd
irpeeedm irpeemed irpeemde irpeedme irpeedem irpdeeme irpdeeem irpdemee irpdemee irpdeeme irpdeeem
irpdeeme irpdeeem irpdemee irpdemee irpdeeme irpdeeem irpdmeee irpdmeee irpdmeee irpdmeee irpdmeee
irpdmeee irpdeeme irpdeeem irpdemee irpdemee irpdeeme irpdeeem irpedeme irpedeem irpedmee irpedmee
irpedeme irpedeem irpeedme irpeedem irpeemde irpeemed irpeeemd irpeeedm irpemede irpemeed irpemdee
irpemdee irpemede irpemeed irpeeemd irpeeedm irpeemed irpeemde irpeedme irpeedem irpmdeee irpmdeee
irpmdeee irpmdeee irpmdeee irpmdeee irpmedee irpmedee irpmeede irpmeeed irpmeeed irpmeede irpmeede
irpmeeed irpmedee irpmedee irpmeede irpmeeed irpmeeed irpmeede irpmeeed irpmeede irpmedee irpmedee
irpedeme irpedeem irpedmee irpedmee irpedeme irpedeem irpeedme irpeedem irpeemde irpeemed irpeeemd
irpeeedm irpemede irpemeed irpemdee irpemdee irpemede irpemeed irpeeemd irpeeedm irpeemed irpeemde
irpeedme irpeedem irepdeme irepdeem irepdmee irepdmee irepdeme irepdeem irepedme irepedem irepemde
irepemed irepeemd irepeedm irepmede irepmeed irepmdee irepmdee irepmede irepmeed irepeemd irepeedm
irepemed irepemde irepedme irepedem iredpeme iredpeem iredpmee iredpmee iredpeme iredpeem iredepme
iredepem iredempe iredemep iredeemp iredeepm iredmepe iredmeep iredmpee iredmpee iredmepe iredmeep
iredeemp iredeepm iredemep iredempe iredepme iredepem ireedpme ireedpem ireedmpe ireedmep ireedemp
ireedepm ireepdme ireepdem ireepmde ireepmed ireepemd ireepedm ireempde ireemped ireemdpe ireemdep
ireemedp ireemepd ireeepmd ireeepdm ireeempd ireeemdp ireeedmp ireeedpm iremdepe iremdeep iremdpee
iremdpee iremdepe iremdeep iremedpe iremedep iremepde iremeped iremeepd iremeedp irempede irempeed
irempdee irempdee irempede irempeed iremeepd iremeedp iremeped iremepde iremedpe iremedep ireedemp
ireedepm ireedmep ireedmpe ireedpme ireedpem ireeedmp ireeedpm ireeemdp ireeempd ireeepmd ireeepdm
ireemedp ireemepd ireemdep ireemdpe ireempde ireemped ireepemd ireepedm ireepmed ireepmde ireepdme
ireepdem irdepeme irdepeem irdepmee irdepmee irdepeme irdepeem irdeepme irdeepem irdeempe irdeemep
irdeeemp irdeeepm irdemepe irdemeep irdempee irdempee irdemepe irdemeep irdeeemp irdeeepm irdeemep
irdeempe irdeepme irdeepem irdpeeme irdpeeem irdpemee irdpemee irdpeeme irdpeeem irdpeeme irdpeeem
irdpemee irdpemee irdpeeme irdpeeem irdpmeee irdpmeee irdpmeee irdpmeee irdpmeee irdpmeee irdpeeme
irdpeeem irdpemee irdpemee irdpeeme irdpeeem irdepeme irdepeem irdepmee irdepmee irdepeme irdepeem
irdeepme irdeepem irdeempe irdeemep irdeeemp irdeeepm irdemepe irdemeep irdempee irdempee irdemepe
irdemeep irdeeemp irdeeepm irdeemep irdeempe irdeepme irdeepem irdmpeee irdmpeee irdmpeee irdmpeee
irdmpeee irdmpeee irdmepee irdmepee irdmeepe irdmeeep irdmeeep irdmeepe irdmeepe irdmeeep irdmepee
irdmepee irdmeepe irdmeeep irdmeeep irdmeepe irdmeeep irdmeepe irdmepee irdmepee irdepeme irdepeem
irdepmee irdepmee irdepeme irdepeem irdeepme irdeepem irdeempe irdeemep irdeeemp irdeeepm irdemepe
irdemeep irdempee irdempee irdemepe irdemeep irdeeemp irdeeepm irdeemep irdeempe irdeepme irdeepem
ireedpme ireedpem ireedmpe ireedmep ireedemp ireedepm ireepdme ireepdem ireepmde ireepmed ireepemd
ireepedm ireempde ireemped ireemdpe ireemdep ireemedp ireemepd ireeepmd ireeepdm ireeempd ireeemdp
ireeedmp ireeedpm iredepme iredepem iredempe iredemep iredeemp iredeepm iredpeme iredpeem iredpmee
iredpmee iredpeme iredpeem iredmpee iredmpee iredmepe iredmeep iredmeep iredmepe iredepme iredepem
iredempe iredemep iredeemp iredeepm irepdeme irepdeem irepdmee irepdmee irepdeme irepdeem irepedme
irepedem irepemde irepemed irepeemd irepeedm irepmede irepmeed irepmdee irepmdee irepmede irepmeed
irepeemd irepeedm irepemed irepemde irepedme irepedem iremdpee iremdpee iremdepe iremdeep iremdeep
iremdepe irempdee irempdee irempede irempeed irempeed irempede iremepde iremeped iremedpe iremedep
iremeedp iremeepd iremeped iremepde iremeepd iremeedp iremedep iremedpe ireedpme ireedpem ireedmpe
ireedmep ireedemp ireedepm ireepdme ireepdem ireepmde ireepmed ireepemd ireepedm ireempde ireemped
ireemdpe ireemdep ireemedp ireemepd ireeepmd ireeepdm ireeempd ireeemdp ireeedmp ireeedpm irmedepe
irmedeep irmedpee irmedpee irmedepe irmedeep irmeedpe irmeedep irmeepde irmeeped irmeeepd irmeeedp
irmepede irmepeed irmepdee irmepdee irmepede irmepeed irmeeepd irmeeedp irmeeped irmeepde irmeedpe
irmeedep irmdeepe irmdeeep irmdepee irmdepee irmdeepe irmdeeep irmdeepe irmdeeep irmdepee irmdepee
irmdeepe irmdeeep irmdpeee irmdpeee irmdpeee irmdpeee irmdpeee irmdpeee irmdeepe irmdeeep irmdepee
irmdepee irmdeepe irmdeeep irmedepe irmedeep irmedpee irmedpee irmedepe irmedeep irmeedpe irmeedep
irmeepde irmeeped irmeeepd irmeeedp irmepede irmepeed irmepdee irmepdee irmepede irmepeed irmeeepd
irmeeedp irmeeped irmeepde irmeedpe irmeedep irmpdeee irmpdeee irmpdeee irmpdeee irmpdeee irmpdeee
irmpedee irmpedee irmpeede irmpeeed irmpeeed irmpeede irmpeede irmpeeed irmpedee irmpedee irmpeede
irmpeeed irmpeeed irmpeede irmpeeed irmpeede irmpedee irmpedee irmedepe irmedeep irmedpee irmedpee
irmedepe irmedeep irmeedpe irmeedep irmeepde irmeeped irmeeepd irmeeedp irmepede irmepeed irmepdee
irmepdee irmepede irmepeed irmeeepd irmeeedp irmeeped irmeepde irmeedpe irmeedep ireedemp ireedepm
ireedmep ireedmpe ireedpme ireedpem ireeedmp ireeedpm ireeemdp ireeempd ireeepmd ireeepdm ireemedp
ireemepd ireemdep ireemdpe ireempde ireemped ireepemd ireepedm ireepmed ireepmde ireepdme ireepdem
iredeemp iredeepm iredemep iredempe iredepme iredepem iredeemp iredeepm iredemep iredempe iredepme
iredepem iredmeep iredmepe iredmeep iredmepe iredmpee iredmpee iredpeme iredpeem iredpmee iredpmee
iredpeme iredpeem ireedemp ireedepm ireedmep ireedmpe ireedpme ireedpem ireeedmp ireeedpm ireeemdp
ireeempd ireeepmd ireeepdm ireemedp ireemepd ireemdep ireemdpe ireempde ireemped ireepemd ireepedm
ireepmed ireepmde ireepdme ireepdem iremdeep iremdepe iremdeep iremdepe iremdpee iremdpee iremedep
iremedpe iremeedp iremeepd iremeped iremepde iremeedp iremeepd iremedep iremedpe iremepde iremeped
irempeed irempede irempeed irempede irempdee irempdee irepdeme irepdeem irepdmee irepdmee irepdeme
irepdeem irepedme irepedem irepemde irepemed irepeemd irepeedm irepmede irepmeed irepmdee irepmdee
irepmede irepmeed irepeemd irepeedm irepemed irepemde irepedme irepedem iepederm iepedemr iepedrem
iepedrme iepedmre iepedmer iepeedrm iepeedmr iepeerdm iepeermd iepeemrd iepeemdr ieperedm ieperemd
ieperdem ieperdme iepermde iepermed iepemerd iepemedr iepemred iepemrde iepemdre iepemder iepdeerm
iepdeemr iepderem iepderme iepdemre iepdemer iepdeerm iepdeemr iepderem iepderme iepdemre iepdemer
iepdreem iepdreme iepdreem iepdreme iepdrmee iepdrmee iepdmere iepdmeer iepdmree iepdmree iepdmere
iepdmeer iepederm iepedemr iepedrem iepedrme iepedmre iepedmer iepeedrm iepeedmr iepeerdm iepeermd
iepeemrd iepeemdr ieperedm ieperemd ieperdem ieperdme iepermde iepermed iepemerd iepemedr iepemred
iepemrde iepemdre iepemder ieprdeem ieprdeme ieprdeem ieprdeme ieprdmee ieprdmee iepredem iepredme
iepreedm iepreemd iepremed iepremde iepreedm iepreemd iepredem iepredme iepremde iepremed ieprmeed
ieprmede ieprmeed ieprmede ieprmdee ieprmdee iepmdere iepmdeer iepmdree iepmdree iepmdere iepmdeer
iepmedre iepmeder iepmerde iepmered iepmeerd iepmeedr iepmrede iepmreed iepmrdee iepmrdee iepmrede
iepmreed iepmeerd iepmeedr iepmered iepmerde iepmedre iepmeder ieepderm ieepdemr ieepdrem ieepdrme
ieepdmre ieepdmer ieepedrm ieepedmr ieeperdm ieepermd ieepemrd ieepemdr ieepredm ieepremd ieeprdem
ieeprdme ieeprmde ieeprmed ieepmerd ieepmedr ieepmred ieepmrde ieepmdre ieepmder ieedperm ieedpemr
ieedprem ieedprme ieedpmre ieedpmer ieedeprm ieedepmr ieederpm ieedermp ieedemrp ieedempr ieedrepm
ieedremp ieedrpem ieedrpme ieedrmpe ieedrmep ieedmerp ieedmepr ieedmrep ieedmrpe ieedmpre ieedmper
ieeedprm ieeedpmr ieeedrpm ieeedrmp ieeedmrp ieeedmpr ieeepdrm ieeepdmr ieeeprdm ieeeprmd ieeepmrd
ieeepmdr ieeerpdm ieeerpmd ieeerdpm ieeerdmp ieeermdp ieeermpd ieeemprd ieeempdr ieeemrpd ieeemrdp
ieeemdrp ieeemdpr ieerdepm ieerdemp ieerdpem ieerdpme ieerdmpe ieerdmep ieeredpm ieeredmp ieerepdm
ieerepmd ieerempd ieeremdp ieerpedm ieerpemd ieerpdem ieerpdme ieerpmde ieerpmed ieermepd ieermedp
ieermped ieermpde ieermdpe ieermdep ieemderp ieemdepr ieemdrep ieemdrpe ieemdpre ieemdper ieemedrp
ieemedpr ieemerdp ieemerpd ieemeprd ieemepdr ieemredp ieemrepd ieemrdep ieemrdpe ieemrpde ieemrped
ieemperd ieempedr ieempred ieemprde ieempdre ieempder iedeperm iedepemr iedeprem iedeprme iedepmre
iedepmer iedeeprm iedeepmr iedeerpm iedeermp iedeemrp iedeempr iederepm iederemp iederpem iederpme
iedermpe iedermep iedemerp iedemepr iedemrep iedemrpe iedempre iedemper iedpeerm iedpeemr iedperem
iedperme iedpemre iedpemer iedpeerm iedpeemr iedperem iedperme iedpemre iedpemer iedpreem iedpreme
iedpreem iedpreme iedprmee iedprmee iedpmere iedpmeer iedpmree iedpmree iedpmere iedpmeer iedeperm
iedepemr iedeprem iedeprme iedepmre iedepmer iedeeprm iedeepmr iedeerpm iedeermp iedeemrp iedeempr
iederepm iederemp iederpem iederpme iedermpe iedermep iedemerp iedemepr iedemrep iedemrpe iedempre
iedemper iedrpeem iedrpeme iedrpeem iedrpeme iedrpmee iedrpmee iedrepem iedrepme iedreepm iedreemp
iedremep iedrempe iedreepm iedreemp iedrepem iedrepme iedrempe iedremep iedrmeep iedrmepe iedrmeep
iedrmepe iedrmpee iedrmpee iedmpere iedmpeer iedmpree iedmpree iedmpere iedmpeer iedmepre iedmeper
iedmerpe iedmerep iedmeerp iedmeepr iedmrepe iedmreep iedmrpee iedmrpee iedmrepe iedmreep iedmeerp
iedmeepr iedmerep iedmerpe iedmepre iedmeper ieeedprm ieeedpmr ieeedrpm ieeedrmp ieeedmrp ieeedmpr
ieeepdrm ieeepdmr ieeeprdm ieeeprmd ieeepmrd ieeepmdr ieeerpdm ieeerpmd ieeerdpm ieeerdmp ieeermdp
ieeermpd ieeemprd ieeempdr ieeemrpd ieeemrdp ieeemdrp ieeemdpr ieedeprm ieedepmr ieederpm ieedermp
ieedemrp ieedempr ieedperm ieedpemr ieedprem ieedprme ieedpmre ieedpmer ieedrpem ieedrpme ieedrepm
ieedremp ieedrmep ieedrmpe ieedmpre ieedmper ieedmrpe ieedmrep ieedmerp ieedmepr ieepderm ieepdemr
ieepdrem ieepdrme ieepdmre ieepdmer ieepedrm ieepedmr ieeperdm ieepermd ieepemrd ieepemdr ieepredm
ieepremd ieeprdem ieeprdme ieeprmde ieeprmed ieepmerd ieepmedr ieepmred ieepmrde ieepmdre ieepmder
ieerdpem ieerdpme ieerdepm ieerdemp ieerdmep ieerdmpe ieerpdem ieerpdme ieerpedm ieerpemd ieerpmed
ieerpmde ieerepdm ieerepmd ieeredpm ieeredmp ieeremdp ieerempd ieermped ieermpde ieermepd ieermedp
ieermdep ieermdpe ieemdpre ieemdper ieemdrpe ieemdrep ieemderp ieemdepr ieempdre ieempder ieemprde
ieempred ieemperd ieempedr ieemrpde ieemrped ieemrdpe ieemrdep ieemredp ieemrepd ieemeprd ieemepdr
ieemerpd ieemerdp ieemedrp ieemedpr ieredepm ieredemp ieredpem ieredpme ieredmpe ieredmep iereedpm
iereedmp iereepdm iereepmd iereempd iereemdp ierepedm ierepemd ierepdem ierepdme ierepmde ierepmed
ieremepd ieremedp ieremped ierempde ieremdpe ieremdep ierdeepm ierdeemp ierdepem ierdepme ierdempe
ierdemep ierdeepm ierdeemp ierdepem ierdepme ierdempe ierdemep ierdpeem ierdpeme ierdpeem ierdpeme
ierdpmee ierdpmee ierdmepe ierdmeep ierdmpee ierdmpee ierdmepe ierdmeep ieredepm ieredemp ieredpem
ieredpme ieredmpe ieredmep iereedpm iereedmp iereepdm iereepmd iereempd iereemdp ierepedm ierepemd
ierepdem ierepdme ierepmde ierepmed ieremepd ieremedp ieremped ierempde ieremdpe ieremdep ierpdeem
ierpdeme ierpdeem ierpdeme ierpdmee ierpdmee ierpedem ierpedme ierpeedm ierpeemd ierpemed ierpemde
ierpeedm ierpeemd ierpedem ierpedme ierpemde ierpemed ierpmeed ierpmede ierpmeed ierpmede ierpmdee
ierpmdee iermdepe iermdeep iermdpee iermdpee iermdepe iermdeep iermedpe iermedep iermepde iermeped
iermeepd iermeedp iermpede iermpeed iermpdee iermpdee iermpede iermpeed iermeepd iermeedp iermeped
iermepde iermedpe iermedep iemederp iemedepr iemedrep iemedrpe iemedpre iemedper iemeedrp iemeedpr
iemeerdp iemeerpd iemeeprd iemeepdr iemeredp iemerepd iemerdep iemerdpe iemerpde iemerped iemeperd
iemepedr iemepred iemeprde iemepdre iemepder iemdeerp iemdeepr iemderep iemderpe iemdepre iemdeper
iemdeerp iemdeepr iemderep iemderpe iemdepre iemdeper iemdreep iemdrepe iemdreep iemdrepe iemdrpee
iemdrpee iemdpere iemdpeer iemdpree iemdpree iemdpere iemdpeer iemederp iemedepr iemedrep iemedrpe
iemedpre iemedper iemeedrp iemeedpr iemeerdp iemeerpd iemeeprd iemeepdr iemeredp iemerepd iemerdep
iemerdpe iemerpde iemerped iemeperd iemepedr iemepred iemeprde iemepdre iemepder iemrdeep iemrdepe
iemrdeep iemrdepe iemrdpee iemrdpee iemredep iemredpe iemreedp iemreepd iemreped iemrepde iemreedp
iemreepd iemredep iemredpe iemrepde iemreped iemrpeed iemrpede iemrpeed iemrpede iemrpdee iemrpdee
iempdere iempdeer iempdree iempdree iempdere iempdeer iempedre iempeder iemperde iempered iempeerd
iempeedr iemprede iempreed iemprdee iemprdee iemprede iempreed iempeerd iempeedr iempered iemperde
iempedre iempeder

Read more ...[1] , [2] , [3]

History of cryptography
2011 Easy Ciphers. All rights reserved. contact us